Psyllid ID: psy6066

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370
MAPPKKLGKKKVVGKSKKVAPAPLAVKKVEVKKVVNPLFEKKARNFGIGQDIQPKRDLSRFVKWPKYIRIQRQKAVLQKRLKVPPPVHQFTQAVDKQTGQDIQPKRDLSRFVKWPKYIRIQRQKAVLQKRLKVPPPVHQFTQAVDKQTASQLFKFLEKYRPESWEAKKQRLKARAEKKIAKKEDTPTKKPNQIKQGTNTVTRLVVKKKASLVIIAHDVDPIELFKFLEKYRPESWEAKKQRLKARAEKKIAKKEDTPTKKPNQIKQGTNTVTRLVVKKKASLVIIAHDVDPIELVLFLPALCRKMGIPYCIVDSSDKANLAKLIESVKVNFTDRYDEIRRQWGGGSLGSKSAARIAKLERAKAKELAQKV
cccccccccccccccccccccccccHHHHHHccccccHHHcccccccccccccccccccccccccccHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHcccccccccccccccccHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHccccccccccccccccccccEEEEEEEcccEEEEEEcccccHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccEEEEcccEEEEEEcccccHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHccHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHcc
cccccccccccEccccccccccccHHHHHHccccccccHccccccccccccccccccccccccccccccccHccHHHHHHcccccccccEcccccccccccccccccccHEccccHHHHHHHHHHHHHHHccccHHHHHHHHHHcHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHcccccccccccHHHHHcHHHHHHHHHHcccEEEEEEcccccEEEEEEcccccHHHHHHHHHHHHHHHHHHHHHHccccccccccEEccccccEEEEEEcccEEEEEEEcccEEEEEEEccccccEEEEEEEEccHHcHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHcc
mappkklgkkkvvgkskkvapaplavkKVEVKKVVNPLfekkarnfgigqdiqpkrdlsrfvkwpkyIRIQRQKAVLQKrlkvpppvhqftqavdkqtgqdiqpkrdlsrfvkwpkyIRIQRQKAVLQKrlkvpppvhqftqAVDKQTASQLFKFLEKYRPESWEAKKQRLKARAEKKIakkedtptkkpnqikqgtnTVTRLVVKKKASLVIIAHDVDPIELFKFLEKYRPESWEAKKQRLKARAEKKIakkedtptkkpnqikqgtnTVTRLVVKKKASLVIIahdvdpielVLFLPALCrkmgipycivdssdKANLAKLIESVKVNFTDRYDeirrqwgggslgsKSAARIAKLERAKAKELAQKV
mappkklgkkkvvgkskkvapaplavkkvevkkvvnplfekkarnfgigqdiqpkrdlsrfvkwpkyiRIQRQKAVLQKRLKVPPPVHqftqavdkqtgqdiqpkrdlsrfvkwpkyiRIQRQKAVLQKRLKVPPPVHQFTQAVDKQTASQLFKFLEkyrpesweakkqRLKARAekkiakkedtptkkpnqikqgtntvtrlVVKKKASLviiahdvdpiELFKFLEkyrpesweakkqrLKARAekkiakkedtptkkpnqikqgtntvtrlVVKKKASLViiahdvdpiELVLFLPALCRKMGIPYCIVDSSDKANLAKLIEsvkvnftdrydeirrqwgggslgsksAARIAKLERAKAKELAQKV
MappkklgkkkvvgkskkvapaplavkkvevkkvvnpLFEKKARNFGIGQDIQPKRDLSRFVKWPKYIRIQRQKAVLQKRLKVPPPVHQFTQAVDKQTGQDIQPKRDLSRFVKWPKYIRIQRQKAVLQKRLKVPPPVHQFTQAVDKQTASQLFKFLEKYRPESWEAKKQRLkaraekkiakkeDTPTKKPNQIKQGTNTVTRLVVKKKASLVIIAHDVDPIELFKFLEKYRPESWEAKKQRLkaraekkiakkeDTPTKKPNQIKQGTNTVTRLVVKKKASLVIIAHDVDPIELVLFLPALCRKMGIPYCIVDSSDKANLAKLIESVKVNFTDRYDEIRRQWGGGSLGSKSaariaklerakakelaQKV
***********************LAVKKVEVKKVVNPLFEKKARNFGIGQDIQPKRDLSRFVKWPKYIRIQRQKAVLQKRLKVPPPVHQF****************DLSRFVKWPKYIRIQRQKAVLQKRLKVPPPVHQFTQAVDKQTASQLFKFLEKY**************************************NTVTRLVVKKKASLVIIAHDVDPIELFKFLEKYR*************************************NTVTRLVVKKKASLVIIAHDVDPIELVLFLPALCRKMGIPYCIVDSSDKANLAKLIESVKVNFTDRYDEIRRQWGG**************************
*******************************************************RDLSRFVKW*************************FTQAVDKQTGQDIQPKRDLSRFVKWPKYIRIQRQ*A*****LKVPPPVHQFTQAVDKQTASQLFKFLEKYR********************************IKQGTNTVTRLVVKKKASLVIIAHDVDPIELFKFLEKYRPESWEAKKQRLKARAEKKIAKKEDTPTKKPNQIKQGTNTVTRLVVKKKASLVIIAHDVDPIELVLFLPALCRKMGIPYCIVDSS******KLIESVKVNFTDRYDEIRRQWGGGSLGSKSAARIAKLERAKAKE**QK*
******************VAPAPLAVKKVEVKKVVNPLFEKKARNFGIGQDIQPKRDLSRFVKWPKYIRIQRQKAVLQKRLKVPPPVHQFTQAVDKQTGQDIQPKRDLSRFVKWPKYIRIQRQKAVLQKRLKVPPPVHQFTQAVDKQTASQLFKFLEKYRPESW**************IAKKEDTPTKKPNQIKQGTNTVTRLVVKKKASLVIIAHDVDPIELFKFLEKYRPESW**************IAKKEDTPTKKPNQIKQGTNTVTRLVVKKKASLVIIAHDVDPIELVLFLPALCRKMGIPYCIVDSSDKANLAKLIESVKVNFTDRYDEIRRQWGGGSLGSKSAARIAKLER**********
**********************************VNPLFEKKARNFGIGQDIQPKRDLSRFVKWPKYIRIQRQKAVLQKRLKVPPPVHQFTQAVDKQTGQDIQPKRDLSRFVKWPKYIRIQRQKAVLQKRLKVPPPVHQFTQAVDKQTASQLFKFLEKYRPESWEAKKQRLKARAEKKIAK*EDTPTKKPNQIKQGTNTVTRLVVKKKASLVIIAHDVDPIELFKFLEKYRPESWEAKKQRLKARAEKKIAKKEDTPTKKPNQIKQGTNTVTRLVVKKKASLVIIAHDVDPIELVLFLPALCRKMGIPYCIVDSSDKANLAKLIESVKVNFTDRYDEIRRQWGGGSLGSKSAARIAKLERAKAKE*****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAPPKKLGKKKVVGKSKKVAPAPLAVKKVEVKKVVNPLFEKKARNFGIGQDIQPKRDLSRFVKWPKYIRIQRQKAVLQKRLKVPPPVHQFTQAVDKQTGQDIQPKRDLSRFVKWPKYIRIQRQKAVLQKRLKVPPPVHQFTQAVDKQTASQLFKFLEKYRPESWxxxxxxxxxxxxxxxxxxxxxPTKKPNQIKQGTNTVTRLVVKKKASLVIIAHDVDPIELFKFLEKYRPESWxxxxxxxxxxxxxxxxxxxxxPTKKPNQIKQGTNTVTRLVVKKKASLVIIAHDVDPIELVLFLPALCRKMGIPYCIVDSSDKANLAKLIESVKVNFTDRYDEIRRQWGGGSLGSKSAARIAKLERAKAKELAQKV
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query370 2.2.26 [Sep-21-2011]
Q2TBQ5266 60S ribosomal protein L7a yes N/A 0.675 0.939 0.454 2e-69
P62425266 60S ribosomal protein L7a yes N/A 0.675 0.939 0.454 2e-69
Q4R5C2266 60S ribosomal protein L7a N/A N/A 0.675 0.939 0.454 2e-69
P62424266 60S ribosomal protein L7a yes N/A 0.675 0.939 0.454 2e-69
P12970266 60S ribosomal protein L7a yes N/A 0.675 0.939 0.451 4e-69
P32429266 60S ribosomal protein L7a yes N/A 0.675 0.939 0.448 3e-68
P46223271 60S ribosomal protein L7a yes N/A 0.681 0.929 0.462 6e-67
O57592266 60S ribosomal protein L7a N/A N/A 0.675 0.939 0.436 1e-66
Q90YW2266 60S ribosomal protein L7a N/A N/A 0.670 0.932 0.431 5e-66
O76732271 60S ribosomal protein L7a yes N/A 0.681 0.929 0.427 2e-60
>sp|Q2TBQ5|RL7A_BOVIN 60S ribosomal protein L7a OS=Bos taurus GN=RPL7A PE=2 SV=3 Back     alignment and function desciption
 Score =  263 bits (671), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 158/348 (45%), Positives = 191/348 (54%), Gaps = 98/348 (28%)

Query: 23  PLAVKKVEVKKVVNPLFEKKARNFGIGQDIQPKRDLSRFVKWPKYIRIQRQKAVLQKRLK 82
           P  VKK E KKVVNPLFEK+ +NFGI                                  
Sbjct: 16  PAVVKKQEAKKVVNPLFEKRPKNFGI---------------------------------- 41

Query: 83  VPPPVHQFTQAVDKQTGQDIQPKRDLSRFVKWPKYIRIQRQKAVLQKRLKVPPPVHQFTQ 142
                           GQDIQPKRDL+RFVKWP+YIR+QRQ+A+L KRLKVPP ++QFTQ
Sbjct: 42  ----------------GQDIQPKRDLTRFVKWPRYIRLQRQRAILYKRLKVPPAINQFTQ 85

Query: 143 AVDKQTASQLFKFLEKYRPESWEAKKQRLKARAEKKIAKKEDTPTKKPNQIKQGTNTVTR 202
           A+D+QTA+QL K   KYRPE+ + KKQRL ARAEKK A K D PTK+P  ++ G NTVT 
Sbjct: 86  ALDRQTATQLLKLAHKYRPETKQEKKQRLLARAEKKAAGKGDVPTKRPPVLRAGVNTVTT 145

Query: 203 LVVKKKASLVIIAHDVDPIELFKFLEKYRPESWEAKKQRLKARAEKKIAKKEDTPTKKPN 262
           LV  KKA LV+IAHDVDPIEL  FL                      + +K   P     
Sbjct: 146 LVENKKAQLVVIAHDVDPIELVVFLP--------------------ALCRKMGVPY---- 181

Query: 263 QIKQGTNTVTRLVVKKKASLVIIAHDVDPIELVLFLPALCRKMGIPYCIVDSSDKANLAK 322
            I +G   + RLV +K  + V                            V+S DK+ LAK
Sbjct: 182 CIIKGKARLGRLVHRKTCTTVAFTQ------------------------VNSEDKSALAK 217

Query: 323 LIESVKVNFTDRYDEIRRQWGGGSLGSKSAARIAKLERAKAKELAQKV 370
           L+E+++ N+ DRYDEIRR WGG  LG KS ARIAKLE+AKAKELA K+
Sbjct: 218 LVEAIRTNYNDRYDEIRRHWGGNVLGPKSVARIAKLEKAKAKELATKL 265

Bos taurus (taxid: 9913)
>sp|P62425|RL7A_RAT 60S ribosomal protein L7a OS=Rattus norvegicus GN=Rpl7a PE=1 SV=2 Back     alignment and function description
>sp|Q4R5C2|RL7A_MACFA 60S ribosomal protein L7a OS=Macaca fascicularis GN=RPL7A PE=2 SV=1 Back     alignment and function description
>sp|P62424|RL7A_HUMAN 60S ribosomal protein L7a OS=Homo sapiens GN=RPL7A PE=1 SV=2 Back     alignment and function description
>sp|P12970|RL7A_MOUSE 60S ribosomal protein L7a OS=Mus musculus GN=Rpl7a PE=2 SV=2 Back     alignment and function description
>sp|P32429|RL7A_CHICK 60S ribosomal protein L7a OS=Gallus gallus GN=RPL7A PE=2 SV=2 Back     alignment and function description
>sp|P46223|RL7A_DROME 60S ribosomal protein L7a OS=Drosophila melanogaster GN=RpL7A PE=2 SV=2 Back     alignment and function description
>sp|O57592|RL7A_TAKRU 60S ribosomal protein L7a OS=Takifugu rubripes GN=rpl7a PE=3 SV=3 Back     alignment and function description
>sp|Q90YW2|RL7A_ICTPU 60S ribosomal protein L7a OS=Ictalurus punctatus GN=rpl7a PE=2 SV=3 Back     alignment and function description
>sp|O76732|RL7A_ANOGA 60S ribosomal protein L7a OS=Anopheles gambiae GN=RpL7A PE=3 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query370
48105889268 PREDICTED: 60S ribosomal protein L7a [Ap 0.672 0.929 0.518 1e-81
322802719301 hypothetical protein SINV_04293 [Solenop 0.672 0.827 0.515 9e-81
383852459268 PREDICTED: 60S ribosomal protein L7a-lik 0.672 0.929 0.512 4e-80
62083327268 ribosomal protein L7a [Lysiphlebus testa 0.683 0.944 0.507 5e-80
307182302268 60S ribosomal protein L7a [Camponotus fl 0.672 0.929 0.510 2e-79
229577209268 ribosomal protein L7A [Nasonia vitripenn 0.672 0.929 0.510 3e-79
332020288307 60S ribosomal protein L7a [Acromyrmex ec 0.672 0.811 0.507 3e-79
263173277266 60S ribosomal protein L7A [Cimex lectula 0.683 0.951 0.481 7e-77
70909641269 ribosomal protein L7Ae [Scarabaeus latic 0.683 0.940 0.501 3e-76
340727956268 PREDICTED: 60S ribosomal protein L7a-lik 0.672 0.929 0.487 2e-75
>gi|48105889|ref|XP_393034.1| PREDICTED: 60S ribosomal protein L7a [Apis mellifera] gi|380016847|ref|XP_003692383.1| PREDICTED: 60S ribosomal protein L7a-like [Apis florea] Back     alignment and taxonomy information
 Score =  309 bits (792), Expect = 1e-81,   Method: Compositional matrix adjust.
 Identities = 180/347 (51%), Positives = 206/347 (59%), Gaps = 98/347 (28%)

Query: 23  PLAVKKVEVKKVVNPLFEKKARNFGIGQDIQPKRDLSRFVKWPKYIRIQRQKAVLQKRLK 82
           PLAVKKVE KK  NPLFEK+ RNFGI                                  
Sbjct: 18  PLAVKKVEPKKQTNPLFEKRTRNFGI---------------------------------- 43

Query: 83  VPPPVHQFTQAVDKQTGQDIQPKRDLSRFVKWPKYIRIQRQKAVLQKRLKVPPPVHQFTQ 142
                           GQDIQP RDLSRFVKWPKYIRIQRQ+AVLQKRLKVPPP++QFTQ
Sbjct: 44  ----------------GQDIQPARDLSRFVKWPKYIRIQRQRAVLQKRLKVPPPINQFTQ 87

Query: 143 AVDKQTASQLFKFLEKYRPESWEAKKQRLKARAEKKIAKKEDTPTKKPNQIKQGTNTVTR 202
            +DKQTA+QLFK LEKYRPES   KK RLKARAE+K+AKKEDTPTKKPN ++ GTNTVT 
Sbjct: 88  TLDKQTATQLFKMLEKYRPESAAMKKMRLKARAEQKVAKKEDTPTKKPNVLRSGTNTVTT 147

Query: 203 LVVKKKASLVIIAHDVDPIELFKFLEKYRPESWEAKKQRLKARAEKKIAKKEDTPTKKPN 262
           LV +KKA LV+IAHDVDPIE+  FL                      + +K   P     
Sbjct: 148 LVEQKKAQLVVIAHDVDPIEIVLFLP--------------------ALCRKMGVPY---- 183

Query: 263 QIKQGTNTVTRLVVKKKASLVIIAHDVDPIELVLFLPALCRKMGIPYCIVDSSDKANLAK 322
            I +G + + RLV +K  + V +                          VDS D+AN AK
Sbjct: 184 CIIKGKSRLGRLVRRKTCTAVALVQ------------------------VDSGDRANFAK 219

Query: 323 LIESVKVNFTDRYDEIRRQWGGGSLGSKSAARIAKLERAKAKELAQK 369
           L+E++K NF DRYDEIRR WGGG LGSKSAARIAKLE+AKAKELAQK
Sbjct: 220 LVEAIKTNFNDRYDEIRRHWGGGLLGSKSAARIAKLEKAKAKELAQK 266

Source: Apis mellifera

Species: Apis mellifera

Genus: Apis

Family: Apidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|322802719|gb|EFZ22936.1| hypothetical protein SINV_04293 [Solenopsis invicta] Back     alignment and taxonomy information
>gi|383852459|ref|XP_003701744.1| PREDICTED: 60S ribosomal protein L7a-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|62083327|gb|AAX62388.1| ribosomal protein L7a [Lysiphlebus testaceipes] Back     alignment and taxonomy information
>gi|307182302|gb|EFN69603.1| 60S ribosomal protein L7a [Camponotus floridanus] Back     alignment and taxonomy information
>gi|229577209|ref|NP_001153326.1| ribosomal protein L7A [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|332020288|gb|EGI60719.1| 60S ribosomal protein L7a [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|263173277|gb|ACY69898.1| 60S ribosomal protein L7A [Cimex lectularius] Back     alignment and taxonomy information
>gi|70909641|emb|CAJ17245.1| ribosomal protein L7Ae [Scarabaeus laticollis] Back     alignment and taxonomy information
>gi|340727956|ref|XP_003402299.1| PREDICTED: 60S ribosomal protein L7a-like [Bombus terrestris] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query370
FB|FBgn0014026271 RpL7A "Ribosomal protein L7A" 0.448 0.612 0.554 1.3e-55
WB|WBGene00004419265 rpl-7A [Caenorhabditis elegans 0.413 0.577 0.528 1.3e-49
UNIPROTKB|F1M394264 F1M394 "Uncharacterized protei 0.332 0.465 0.573 1.2e-45
ZFIN|ZDB-GENE-031001-9266 rpl7a "ribosomal protein L7a" 0.348 0.484 0.643 6.1e-54
RGD|2320354266 LOC100361311 "ribosomal protei 0.348 0.484 0.635 9.9e-54
UNIPROTKB|Q2TBQ5266 RPL7A "60S ribosomal protein L 0.348 0.484 0.635 9.9e-54
UNIPROTKB|F2Z4P2266 RPL7A "Uncharacterized protein 0.348 0.484 0.635 1.3e-53
UNIPROTKB|P62424266 RPL7A "60S ribosomal protein L 0.348 0.484 0.635 1.3e-53
RGD|1307586266 Rpl7a "ribosomal protein L7a" 0.348 0.484 0.635 1.3e-53
UNIPROTKB|P62425266 Rpl7a "60S ribosomal protein L 0.348 0.484 0.635 1.3e-53
FB|FBgn0014026 RpL7A "Ribosomal protein L7A" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 443 (161.0 bits), Expect = 1.3e-55, Sum P(2) = 1.3e-55
 Identities = 96/173 (55%), Positives = 116/173 (67%)

Query:    62 VKWPKYIRIQRQKAVLQKRLKVPPPVHQ--FTQAVDKQT-----GQDIQPKRDLSRFVKW 114
             VK P+  +    K V    L V  PV +    Q  +K+      GQ++QPKRDLSRFV+W
Sbjct:     3 VKKPRPKKKPVTKKVAPAPLAVKKPVVKKVVNQLFEKRPKNFGIGQNVQPKRDLSRFVRW 62

Query:   115 PKYIRIQRQKAVLQKRLKVPPPVHQFTQAVDKQTASQLFKFLEKYRPESWEAKKQRLXXX 174
             PKYIR+QRQKAVLQKRLKVPPP+HQF+Q +DK TA +LFK LEKYRPES  AKK RL   
Sbjct:    63 PKYIRVQRQKAVLQKRLKVPPPIHQFSQTLDKTTAVKLFKLLEKYRPESPLAKKLRLKKI 122

Query:   175 XXXXXXXXXDTPTKKPNQIKQGTNTVTRLVVKKKASLVIIAHDVDPIELFKFL 227
                        P KKP+ +  GTNTVT+L+ +KKA LV+IAHDVDP+EL  FL
Sbjct:   123 AEAKAKGKDVEPKKKPSYVSAGTNTVTKLIEQKKAQLVVIAHDVDPLELVLFL 175
GO:0022625 "cytosolic large ribosomal subunit" evidence=ISS;NAS
GO:0006412 "translation" evidence=ISS;NAS
GO:0003735 "structural constituent of ribosome" evidence=ISS;IDA;NAS
GO:0005840 "ribosome" evidence=IDA;NAS
GO:0042254 "ribosome biogenesis" evidence=IEA
GO:0007052 "mitotic spindle organization" evidence=IMP
GO:0000022 "mitotic spindle elongation" evidence=IMP
GO:0051298 "centrosome duplication" evidence=IMP
GO:0051297 "centrosome organization" evidence=IMP
WB|WBGene00004419 rpl-7A [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
UNIPROTKB|F1M394 F1M394 "Uncharacterized protein" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-031001-9 rpl7a "ribosomal protein L7a" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
RGD|2320354 LOC100361311 "ribosomal protein L7a-like" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q2TBQ5 RPL7A "60S ribosomal protein L7a" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F2Z4P2 RPL7A "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|P62424 RPL7A "60S ribosomal protein L7a" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
RGD|1307586 Rpl7a "ribosomal protein L7a" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|P62425 Rpl7a "60S ribosomal protein L7a" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
P35685RL7A_ORYSJNo assigned EC number0.36180.67290.9651yesN/A
Q966C6RL7A_CAEELNo assigned EC number0.38640.64050.8943yesN/A
O13672RL8_SCHPONo assigned EC number0.36980.64320.9189yesN/A
P62424RL7A_HUMANNo assigned EC number0.45400.67560.9398yesN/A
P62425RL7A_RATNo assigned EC number0.45400.67560.9398yesN/A
Q8U160RL7A_PYRFUNo assigned EC number0.50940.14320.4308yesN/A
Q8TV03RL7A_METKANo assigned EC number0.50900.14860.4471yesN/A
P54066RL7A_METJANo assigned EC number0.52720.13510.4273yesN/A
P62008RL7A_PYRABNo assigned EC number0.50940.14320.4308yesN/A
P62009RL7A_PYRHONo assigned EC number0.50940.14320.4308yesN/A
P46223RL7A_DROMENo assigned EC number0.46280.68100.9298yesN/A
P32429RL7A_CHICKNo assigned EC number0.44820.67560.9398yesN/A
P17076RL8A_YEASTNo assigned EC number0.33980.67290.9726yesN/A
P12970RL7A_MOUSENo assigned EC number0.45110.67560.9398yesN/A
Q2TBQ5RL7A_BOVINNo assigned EC number0.45400.67560.9398yesN/A
O76732RL7A_ANOGANo assigned EC number0.42730.68100.9298yesN/A
P29453RL8B_YEASTNo assigned EC number0.33980.67290.9726yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query370
PTZ00365266 PTZ00365, PTZ00365, 60S ribosomal protein L7Ae-lik 5e-49
PTZ00222263 PTZ00222, PTZ00222, 60S ribosomal protein L7a; Pro 2e-31
pfam0124895 pfam01248, Ribosomal_L7Ae, Ribosomal protein L7Ae/ 4e-14
COG1358116 COG1358, RPL8A, Ribosomal protein HS6-type (S12/L3 1e-10
PRK04175122 PRK04175, rpl7ae, 50S ribosomal protein L7Ae; Vali 4e-10
TIGR03677117 TIGR03677, rpl7ae, 50S ribosomal protein L7Ae 1e-09
pfam0124895 pfam01248, Ribosomal_L7Ae, Ribosomal protein L7Ae/ 9e-06
COG1358116 COG1358, RPL8A, Ribosomal protein HS6-type (S12/L3 2e-04
PRK04175122 PRK04175, rpl7ae, 50S ribosomal protein L7Ae; Vali 0.001
TIGR03677117 TIGR03677, rpl7ae, 50S ribosomal protein L7Ae 0.002
>gnl|CDD|240382 PTZ00365, PTZ00365, 60S ribosomal protein L7Ae-like; Provisional Back     alignment and domain information 
 Score =  165 bits (420), Expect = 5e-49
 Identities = 128/360 (35%), Positives = 170/360 (47%), Gaps = 100/360 (27%)

Query: 11  KVVGKSKKVAPAPLAVKKVEVKKVVNPLFEKKARNFGIGQDIQPKRDLSRFVKWPKYIRI 70
           K   K  K  PAP  +KK + KK  +PLFEK  RNF IG DI+PK DLSR+V+WP+YI  
Sbjct: 2   KGSVKKSKKLPAPAPLKKSKKKKQKHPLFEKTPRNFRIGGDIRPKVDLSRYVRWPRYI-- 59

Query: 71  QRQKAVLQKRLKVPPPVHQFTQAVDKQTGQDIQPKRDLSRFVKWPKYIRIQRQKAVLQKR 130
                                                            +QRQ+ VL +R
Sbjct: 60  ------------------------------------------------LLQRQRRVLLQR 71

Query: 131 LKVPPPVHQFTQAVDKQTASQLFKFLEKYRPESWEAKKQRLKARAEKKIAKKEDTPTKKP 190
           LKVPP ++QFT  +DK  ASQL + L KY+PE+   KK RL   AE K A  E+  +KKP
Sbjct: 72  LKVPPALNQFTYTLDKNQASQLLRLLSKYKPETRAEKKARLLKEAE-KAAAGEEVESKKP 130

Query: 191 NQIKQGTNTVTRLVVKKKASLVIIAHDVDPIELFKFLEKYRPESWEAKKQRLKARAEKKI 250
             +K G N VT LV  KKA LV+IAHDVDPIEL  FL                      +
Sbjct: 131 FMLKYGLNHVTDLVEYKKAKLVVIAHDVDPIELVCFL--------------------PAL 170

Query: 251 AKKEDTPTKKPNQIKQGTNTVTRLVVKKKASLVIIAHDVDPIELVLFLPALCRKMGIPYC 310
            +K++ P      I +G + + +LV +K A++V I +                       
Sbjct: 171 CRKKEVPY----CIIKGKSRLGKLVHQKTAAVVAIDN----------------------- 203

Query: 311 IVDSSDKANLAKLIESVKVNFTDRYDEIRRQWGGGSLGSKSAARIAKLERAKAKELAQKV 370
            V   D+A    L ++ +  F D   E+RR+WGGG +G KS   IAK E+  A E A+K+
Sbjct: 204 -VRKEDQAEFDNLCKNFRAMFNDNS-ELRRRWGGGIMGIKSQHVIAKREKLIAMENAKKL 261

Length = 266
>gnl|CDD|140249 PTZ00222, PTZ00222, 60S ribosomal protein L7a; Provisional Back     alignment and domain information
>gnl|CDD|216387 pfam01248, Ribosomal_L7Ae, Ribosomal protein L7Ae/L30e/S12e/Gadd45 family Back     alignment and domain information
>gnl|CDD|224277 COG1358, RPL8A, Ribosomal protein HS6-type (S12/L30/L7a) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|179766 PRK04175, rpl7ae, 50S ribosomal protein L7Ae; Validated Back     alignment and domain information
>gnl|CDD|188367 TIGR03677, rpl7ae, 50S ribosomal protein L7Ae Back     alignment and domain information
>gnl|CDD|216387 pfam01248, Ribosomal_L7Ae, Ribosomal protein L7Ae/L30e/S12e/Gadd45 family Back     alignment and domain information
>gnl|CDD|224277 COG1358, RPL8A, Ribosomal protein HS6-type (S12/L30/L7a) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|179766 PRK04175, rpl7ae, 50S ribosomal protein L7Ae; Validated Back     alignment and domain information
>gnl|CDD|188367 TIGR03677, rpl7ae, 50S ribosomal protein L7Ae Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 370
PTZ00365266 60S ribosomal protein L7Ae-like; Provisional 100.0
PTZ00222263 60S ribosomal protein L7a; Provisional 100.0
KOG3166|consensus209 100.0
PTZ00365266 60S ribosomal protein L7Ae-like; Provisional 99.87
PTZ00222263 60S ribosomal protein L7a; Provisional 99.86
KOG3166|consensus209 99.73
KOG3167|consensus153 99.71
COG1358116 RPL8A Ribosomal protein HS6-type (S12/L30/L7a) [Tr 99.67
KOG3387|consensus131 99.43
PRK1360084 putative ribosomal protein L7Ae-like; Provisional 99.36
TIGR03677117 rpl7ae 50S ribosomal protein L7Ae. Multifunctional 99.15
PRK04175122 rpl7ae 50S ribosomal protein L7Ae; Validated 99.14
PF0124895 Ribosomal_L7Ae: Ribosomal protein L7Ae/L30e/S12e/G 99.04
PRK1360282 putative ribosomal protein L7Ae-like; Provisional 98.86
COG1358116 RPL8A Ribosomal protein HS6-type (S12/L30/L7a) [Tr 98.56
PRK1360182 putative L7Ae-like ribosomal protein; Provisional 98.51
PRK0101899 50S ribosomal protein L30e; Reviewed 98.42
PRK0668382 hypothetical protein; Provisional 98.3
KOG3406|consensus134 98.23
PRK07714100 hypothetical protein; Provisional 98.03
TIGR03677117 rpl7ae 50S ribosomal protein L7Ae. Multifunctional 97.2
PTZ00106108 60S ribosomal protein L30; Provisional 97.19
PRK04175122 rpl7ae 50S ribosomal protein L7Ae; Validated 97.17
PRK0728398 hypothetical protein; Provisional 97.08
PF0124895 Ribosomal_L7Ae: Ribosomal protein L7Ae/L30e/S12e/G 96.59
PRK1360084 putative ribosomal protein L7Ae-like; Provisional 96.06
PRK05583104 ribosomal protein L7Ae family protein; Provisional 95.88
KOG3387|consensus131 95.24
PRK1360282 putative ribosomal protein L7Ae-like; Provisional 94.88
PRK09190220 hypothetical protein; Provisional 93.37
PRK0101899 50S ribosomal protein L30e; Reviewed 93.16
KOG3167|consensus153 92.94
PRK1360182 putative L7Ae-like ribosomal protein; Provisional 91.92
COG1911100 RPL30 Ribosomal protein L30E [Translation, ribosom 91.39
PRK0668382 hypothetical protein; Provisional 89.02
PF08228158 RNase_P_pop3: RNase P subunit Pop3; InterPro: IPR0 88.44
PTZ00106108 60S ribosomal protein L30; Provisional 86.83
PRK07714100 hypothetical protein; Provisional 85.98
PF1008797 DUF2325: Uncharacterized protein conserved in bact 84.53
>PTZ00365 60S ribosomal protein L7Ae-like; Provisional Back     alignment and domain information 
Probab=100.00  E-value=4.1e-85  Score=619.42  Aligned_cols=234  Identities=54%  Similarity=0.846  Sum_probs=212.6

Q ss_pred             CCCCccCCCccchhhhhhhcccCccccccccccccCccCCCccccccccccchhhhhhhhHHHHhhhhcCCCCCcccccc
Q psy6066          14 GKSKKVAPAPLAVKKVEVKKVVNPLFEKKARNFGIGQDIQPKRDLSRFVKWPKYIRIQRQKAVLQKRLKVPPPVHQFTQA   93 (370)
Q Consensus        14 ~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~f~~g~~i~~k~dl~rfvkwP~yir~Qrqk~il~krlKvP~~i~qf~~~   93 (370)
                      .++++++|+|...++++.++++|||||+|||||||||||||+|||||||+||+||||||||+||++||||||+||||   
T Consensus         5 ~~~~k~~~ap~~~~~~~~~k~~~plfe~rpknf~iG~~iqpkrdlsrfvkwP~yirlQRqk~iL~~RlKvPp~inqF---   81 (266)
T PTZ00365          5 VKKSKKLPAPAPLKKSKKKKQKHPLFEKTPRNFRIGGDIRPKVDLSRYVRWPRYILLQRQRRVLLQRLKVPPALNQF---   81 (266)
T ss_pred             cccccccCCCccccccccccccCcccccCccccCcCCCCCCCccchhhcccchhhhHHHHHHHHHHhcCCCccHhhh---
Confidence            45677899998888878888999999999999999999999999999999999999999999999999665555555   


Q ss_pred             ccccccccccccccccccccchhHHHHHHHHHHHhhccCCCCCccccchhcchhhHHHHHHHhhhcCcchHHHHHHHHHH
Q psy6066          94 VDKQTGQDIQPKRDLSRFVKWPKYIRIQRQKAVLQKRLKVPPPVHQFTQAVDKQTASQLFKFLEKYRPESWEAKKQRLKA  173 (370)
Q Consensus        94 ld~~~~~~~~~k~dl~rfv~wPkYirIQrQraiL~~~lKipp~i~qf~~~l~~~~~~~l~~l~~KyrPE~k~ekk~RL~a  173 (370)
                                                                     +++||++++++||+||+|||||+++||      
T Consensus        82 -----------------------------------------------~~~ldk~~a~~lfkll~KYrPEtk~~k------  108 (266)
T PTZ00365         82 -----------------------------------------------TYTLDKNQASQLLRLLSKYKPETRAEK------  108 (266)
T ss_pred             -----------------------------------------------hhhhcHhhHHHHHHHHHhcCCccHHHH------
Confidence                                                           555566678899999999999999888      


Q ss_pred             HHHHHhhccCCCCCCCCccccccchhhhHHhhcccceEEEEecCCChHHHHHHhhhcCcCcHHHHHHHHHHHHHHHHcCC
Q psy6066         174 RAEKKIAKKEDTPTKKPNQIKQGTNTVTRLVVKKKASLVIIAHDVDPIELFKFLEKYRPESWEAKKQRLKARAEKKIAKK  253 (370)
Q Consensus       174 ~a~~ka~~k~~~~~kkp~~i~~Gin~Vt~lIE~kka~LVvIA~dVdPielv~~Lpky~pes~~~Kk~rL~~~a~~~~~~k  253 (370)
                                                                                       ++||+++|+++++|+
T Consensus       109 -----------------------------------------------------------------k~RL~~~A~~~a~g~  123 (266)
T PTZ00365        109 -----------------------------------------------------------------KARLLKEAEKAAAGE  123 (266)
T ss_pred             -----------------------------------------------------------------HHHHHHHHHHHhcCC
Confidence                                                                             555566666777777


Q ss_pred             CCCCCCCCcccccchhHHHHHHhcCcceEEEEeccCCchhHHHhHHHHhhhcCCcEEEE---------------------
Q psy6066         254 EDTPTKKPNQIKQGTNTVTRLVVKKKASLVIIAHDVDPIELVLFLPALCRKMGIPYCIV---------------------  312 (370)
Q Consensus       254 ~~~~~kkp~~Lk~GineVtklIekkkA~LVVIA~DVdPiElV~~LPaLCek~~VPY~iV---------------------  312 (370)
                      .+. +++|.+|++|+||||++||+|+|+|||||+||||++++.|||.||++||||||||                     
T Consensus       124 ~~~-~kkp~~vk~Gin~VtklIekkKAkLVIIA~DVsP~t~kk~LP~LC~k~~VPY~iv~sK~eLG~AIGkktraVVAIt  202 (266)
T PTZ00365        124 EVE-SKKPFMLKYGLNHVTDLVEYKKAKLVVIAHDVDPIELVCFLPALCRKKEVPYCIIKGKSRLGKLVHQKTAAVVAID  202 (266)
T ss_pred             CCC-CCCchHHHhhhHHHHHHHHhCCccEEEEeCCCCHHHHHHHHHHHHhccCCCEEEECCHHHHHHHhCCCCceEEEec
Confidence            654 7899999999999999999999999999999999999999999999999999999                     


Q ss_pred             --ccccHHHHHHHHHHHhhhhhhhHHHHhhhhCCCCCCcchHHHHHHHHHHHHhHHhhcC
Q psy6066         313 --DSSDKANLAKLIESVKVNFTDRYDEIRRQWGGGSLGSKSAARIAKLERAKAKELAQKV  370 (370)
Q Consensus       313 --~SeDkg~lakLve~ir~nynD~ydEi~~~wGG~ilg~ks~~~~~~~~~~~~~~~~~~~  370 (370)
                        ++||+++|++||+++++|||| |||+++|||||+||.||+++++++|+++++|+|+++
T Consensus       203 dV~~EDk~~l~~lv~~~~~~~nd-~~e~rr~wGG~~~g~ks~~~~~k~~k~~~~e~~~k~  261 (266)
T PTZ00365        203 NVRKEDQAEFDNLCKNFRAMFND-NSELRRRWGGGIMGIKSQHVIAKREKLIAMENAKKL  261 (266)
T ss_pred             ccCHHHHHHHHHHHHHHHHhccc-cHhhhhhcCCCccChhHHHHHHHHHHHHHHHHHHhh
Confidence              789999999999999999999 999999999999999999999999999999999874

>PTZ00222 60S ribosomal protein L7a; Provisional Back     alignment and domain information
>KOG3166|consensus Back     alignment and domain information
>PTZ00365 60S ribosomal protein L7Ae-like; Provisional Back     alignment and domain information
>PTZ00222 60S ribosomal protein L7a; Provisional Back     alignment and domain information
>KOG3166|consensus Back     alignment and domain information
>KOG3167|consensus Back     alignment and domain information
>COG1358 RPL8A Ribosomal protein HS6-type (S12/L30/L7a) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG3387|consensus Back     alignment and domain information
>PRK13600 putative ribosomal protein L7Ae-like; Provisional Back     alignment and domain information
>TIGR03677 rpl7ae 50S ribosomal protein L7Ae Back     alignment and domain information
>PRK04175 rpl7ae 50S ribosomal protein L7Ae; Validated Back     alignment and domain information
>PF01248 Ribosomal_L7Ae: Ribosomal protein L7Ae/L30e/S12e/Gadd45 family; InterPro: IPR004038 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>PRK13602 putative ribosomal protein L7Ae-like; Provisional Back     alignment and domain information
>COG1358 RPL8A Ribosomal protein HS6-type (S12/L30/L7a) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK13601 putative L7Ae-like ribosomal protein; Provisional Back     alignment and domain information
>PRK01018 50S ribosomal protein L30e; Reviewed Back     alignment and domain information
>PRK06683 hypothetical protein; Provisional Back     alignment and domain information
>KOG3406|consensus Back     alignment and domain information
>PRK07714 hypothetical protein; Provisional Back     alignment and domain information
>TIGR03677 rpl7ae 50S ribosomal protein L7Ae Back     alignment and domain information
>PTZ00106 60S ribosomal protein L30; Provisional Back     alignment and domain information
>PRK04175 rpl7ae 50S ribosomal protein L7Ae; Validated Back     alignment and domain information
>PRK07283 hypothetical protein; Provisional Back     alignment and domain information
>PF01248 Ribosomal_L7Ae: Ribosomal protein L7Ae/L30e/S12e/Gadd45 family; InterPro: IPR004038 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>PRK13600 putative ribosomal protein L7Ae-like; Provisional Back     alignment and domain information
>PRK05583 ribosomal protein L7Ae family protein; Provisional Back     alignment and domain information
>KOG3387|consensus Back     alignment and domain information
>PRK13602 putative ribosomal protein L7Ae-like; Provisional Back     alignment and domain information
>PRK09190 hypothetical protein; Provisional Back     alignment and domain information
>PRK01018 50S ribosomal protein L30e; Reviewed Back     alignment and domain information
>KOG3167|consensus Back     alignment and domain information
>PRK13601 putative L7Ae-like ribosomal protein; Provisional Back     alignment and domain information
>COG1911 RPL30 Ribosomal protein L30E [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK06683 hypothetical protein; Provisional Back     alignment and domain information
>PF08228 RNase_P_pop3: RNase P subunit Pop3; InterPro: IPR013241 This family of fungal proteins form a subunit of RNase P, the ribonucleoprotein enzyme that cleaves the leader sequence of precursor tRNAs to generate mature tRNAs Back     alignment and domain information
>PTZ00106 60S ribosomal protein L30; Provisional Back     alignment and domain information
>PRK07714 hypothetical protein; Provisional Back     alignment and domain information
>PF10087 DUF2325: Uncharacterized protein conserved in bacteria (DUF2325); InterPro: IPR016772 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query370
2zkr_f266 Structure Of A Mammalian Ribosomal 60s Subunit With 3e-53
3izr_H258 Localization Of The Large Subunit Ribosomal Protein 4e-40
3izs_H256 Localization Of The Large Subunit Ribosomal Protein 3e-39
4a17_F255 T.Thermophila 60s Ribosomal Subunit In Complex With 2e-37
3zf7_x276 High-resolution Cryo-electron Microscopy Structure 2e-29
3jyw_G113 Structure Of The 60s Proteins For Eukaryotic Riboso 1e-13
1s1i_G119 Structure Of The Ribosomal 80s-Eef2-Sordarin Comple 2e-13
3paf_A117 M. Jannaschii L7ae Mutant Length = 117 8e-09
2fc3_A124 Crystal Structure Of The Extremely Thermostable Aer 2e-08
3o85_A122 Giardia Lamblia 15.5kd Rna Binding Protein Length = 4e-08
3lwo_C123 Structure Of HACA RNP BOUND TO A SUBSTRATE RNA CONT 5e-08
3nmu_C129 Crystal Structure Of Substrate-Bound Halfmer Box CD 5e-08
2hvy_D130 Crystal Structure Of An HACA BOX RNP FROM PYROCOCCU 5e-08
2czw_A124 Crystal Structure Analysis Of Protein Component Ph1 5e-08
1pxw_A128 Crystal Structure Of L7ae Srnp Core Protein From Py 5e-08
3hjw_C120 Structure Of A Functional Ribonucleoprotein Pseudou 5e-08
3id5_C130 Crystal Structure Of Sulfolobus Solfataricus CD RNP 7e-08
1ra4_A120 Crystal Structure Of The Methanococcus Jannaschii L 3e-07
1sds_A117 Structure Of Protein L7ae Bound To A K-Turn Derived 4e-07
1rlg_A119 Molecular Basis Of Box CD RNA-Protein Interaction: 6e-07
1s72_F120 Refined Crystal Structure Of The Haloarcula Marismo 4e-06
3g4s_F119 Co-Crystal Structure Of Tiamulin Bound To The Large 4e-06
1ffk_E119 Crystal Structure Of The Large Ribosomal Subunit Fr 7e-06
2ale_A134 Crystal Structure Of Yeast Rna Splicing Factor Snu1 3e-05
1zwz_A126 Structural Comparison Of Yeast Snornp And Splicesom 3e-05
2jnb_A144 Solution Structure Of Rna-Binding Protein 15.5k Len 8e-05
2ozb_A130 Structure Of A Human Prp31-15.5k-U4 Snrna Complex L 9e-05
1e7k_A128 Crystal Structure Of The Spliceosomal 15.5kd Protei 1e-04
2aif_A135 Crystal Structure Of High Mobility Like Protein, Nh 1e-04
2lbx_A121 Solution Structure Of The S. Cerevisiae HACA RNP PR 5e-04
>pdb|2ZKR|FF Chain f, Structure Of A Mammalian Ribosomal 60s Subunit Within An 80s Complex Obtained By Docking Homology Models Of The Rna And Proteins Into An 8.7 A Cryo-Em Map Length = 266 Back     alignment and structure 
Iteration: 1

 Score =  205 bits (522), Expect = 3e-53,   Method: Compositional matrix adjust.
 Identities = 117/253 (46%), Positives = 144/253 (56%), Gaps = 48/253 (18%)
Query: 99  GQDIQPKRDLSRFVKWPKYIRIQRQKAVLQKRLKVPPPVHQFTQAVDKQTASQLFKFLEK 158
           GQDIQPKRDL+RFVKWP+YIR+QRQ+A+L KRLKVPP ++QFTQA+D+QTA+QL K   K
Sbjct: 42  GQDIQPKRDLTRFVKWPRYIRLQRQRAILYKRLKVPPAINQFTQALDRQTATQLLKLAHK 101
Query: 159 YRPESWEAKKQRLXXXXXXXXXXXXDTPTKKPNQIKQGTNTVTRLVVKKKASLVIIAHDV 218
           YRPE+ + KKQRL            D PTK+P  ++ G NTVT LV  KKA LV+IAHDV
Sbjct: 102 YRPETKQEKKQRLLARAEKKAAGKGDVPTKRPPVLRAGVNTVTTLVENKKAQLVVIAHDV 161
Query: 219 DPIELFKFLEKYRPESWEAKKQRLXXXXXXXXXXXXDTPTKKPNQIKQGTNTVTRLVVKK 278
           DPIEL  FL    P                                K G   V   ++K 
Sbjct: 162 DPIELVVFL----PALCR----------------------------KMG---VPYCIIKG 186
Query: 279 KASLVIIAHDVDPIELVLFLPALCRKMGIPYCIVDSSDKANLAKLIESVKVNFTDRYDEI 338
           KA L  + H              C    + +  V+S DK  LAKL+E+++ N+ DRYDEI
Sbjct: 187 KARLGHLVHR-----------KTC--TTVAFTQVNSEDKGALAKLVEAIRTNYNDRYDEI 233
Query: 339 RRQWGGGSLGSKS 351
           RR WGG  LG KS
Sbjct: 234 RRHWGGNVLGPKS 246
>pdb|3IZR|H Chain H, Localization Of The Large Subunit Ribosomal Proteins Into A 5.5 A Cryo-Em Map Of Triticum Aestivum Translating 80s Ribosome Length = 258 Back     alignment and structure
>pdb|3IZS|H Chain H, Localization Of The Large Subunit Ribosomal Proteins Into A 6.1 A Cryo-Em Map Of Saccharomyces Cerevisiae Translating 80s Ribosome Length = 256 Back     alignment and structure
>pdb|4A17|F Chain F, T.Thermophila 60s Ribosomal Subunit In Complex With Initiation Factor 6. This File Contains 5s Rrna, 5.8s Rrna And Proteins Of Molecule 2. Length = 255 Back     alignment and structure
>pdb|3ZF7|XX Chain x, High-resolution Cryo-electron Microscopy Structure Of The Trypanosoma Brucei Ribosome Length = 276 Back     alignment and structure
>pdb|3JYW|G Chain G, Structure Of The 60s Proteins For Eukaryotic Ribosome Based On Cryo-Em Map Of Thermomyces Lanuginosus Ribosome At 8.9a Resolution Length = 113 Back     alignment and structure
>pdb|1S1I|G Chain G, Structure Of The Ribosomal 80s-Eef2-Sordarin Complex From Yeast Obtained By Docking Atomic Models For Rna And Protein Components Into A 11.7 A Cryo-Em Map. This File, 1s1i, Contains 60s Subunit. The 40s Ribosomal Subunit Is In File 1s1h Length = 119 Back     alignment and structure
>pdb|3PAF|A Chain A, M. Jannaschii L7ae Mutant Length = 117 Back     alignment and structure
>pdb|2FC3|A Chain A, Crystal Structure Of The Extremely Thermostable Aeropyrum Pernix L7ae Multifunctional Protein Length = 124 Back     alignment and structure
>pdb|3O85|A Chain A, Giardia Lamblia 15.5kd Rna Binding Protein Length = 122 Back     alignment and structure
>pdb|3LWO|C Chain C, Structure Of HACA RNP BOUND TO A SUBSTRATE RNA CONTAINING 5BRU Length = 123 Back     alignment and structure
>pdb|3NMU|C Chain C, Crystal Structure Of Substrate-Bound Halfmer Box CD RNP Length = 129 Back     alignment and structure
>pdb|2HVY|D Chain D, Crystal Structure Of An HACA BOX RNP FROM PYROCOCCUS FURIOSUS Length = 130 Back     alignment and structure
>pdb|2CZW|A Chain A, Crystal Structure Analysis Of Protein Component Ph1496p Of P.Horikoshii Ribonuclease P Length = 124 Back     alignment and structure
>pdb|1PXW|A Chain A, Crystal Structure Of L7ae Srnp Core Protein From Pyrococcus Abyssii Length = 128 Back     alignment and structure
>pdb|3HJW|C Chain C, Structure Of A Functional Ribonucleoprotein Pseudouridine Synthase Bound To A Substrate Rna Length = 120 Back     alignment and structure
>pdb|3ID5|C Chain C, Crystal Structure Of Sulfolobus Solfataricus CD RNP ASSEMBLED WITH Nop5, Fibrillarin, L7ae And A Split Half CD RNA Length = 130 Back     alignment and structure
>pdb|1RA4|A Chain A, Crystal Structure Of The Methanococcus Jannaschii L7ae Protein Length = 120 Back     alignment and structure
>pdb|1SDS|A Chain A, Structure Of Protein L7ae Bound To A K-Turn Derived From An Archaeal Box HACA SRNA Length = 117 Back     alignment and structure
>pdb|1RLG|A Chain A, Molecular Basis Of Box CD RNA-Protein Interaction: Co- Crystal Structure Of The Archaeal Srnp Intiation Complex Length = 119 Back     alignment and structure
>pdb|1S72|F Chain F, Refined Crystal Structure Of The Haloarcula Marismortui Large Ribosomal Subunit At 2.4 Angstrom Resolution Length = 120 Back     alignment and structure
>pdb|3G4S|F Chain F, Co-Crystal Structure Of Tiamulin Bound To The Large Ribosomal Subunit Length = 119 Back     alignment and structure
>pdb|1FFK|E Chain E, Crystal Structure Of The Large Ribosomal Subunit From Haloarcula Marismortui At 2.4 Angstrom Resolution Length = 119 Back     alignment and structure
>pdb|2ALE|A Chain A, Crystal Structure Of Yeast Rna Splicing Factor Snu13p Length = 134 Back     alignment and structure
>pdb|1ZWZ|A Chain A, Structural Comparison Of Yeast Snornp And Splicesomal Protein Snu13p With Its Homologs Length = 126 Back     alignment and structure
>pdb|2JNB|A Chain A, Solution Structure Of Rna-Binding Protein 15.5k Length = 144 Back     alignment and structure
>pdb|2OZB|A Chain A, Structure Of A Human Prp31-15.5k-U4 Snrna Complex Length = 130 Back     alignment and structure
>pdb|1E7K|A Chain A, Crystal Structure Of The Spliceosomal 15.5kd Protein Bound To A U4 Snrna Fragment Length = 128 Back     alignment and structure
>pdb|2AIF|A Chain A, Crystal Structure Of High Mobility Like Protein, Nhp2, Putative From Cryptosporidium Parvum Length = 135 Back     alignment and structure
>pdb|2LBX|A Chain A, Solution Structure Of The S. Cerevisiae HACA RNP PROTEIN NHP2P Length = 121 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query370
2zkr_f266 60S ribosomal protein L7A; protein-RNA complex, 60 6e-44
3izc_H256 60S ribosomal protein RPL8 (L7AE); eukaryotic ribo 4e-43
3iz5_H258 60S ribosomal protein L7A (L7AE); eukaryotic ribos 2e-38
4a17_F255 RPL7A, 60S ribosomal protein L9; eukaryotic riboso 4e-38
3jyw_G113 60S ribosomal protein L8(A); eukaryotic ribosome, 3e-20
3jyw_G113 60S ribosomal protein L8(A); eukaryotic ribosome, 1e-11
1xbi_A120 50S ribosomal protein L7AE; alpha-beta-alpha sandw 2e-16
1xbi_A120 50S ribosomal protein L7AE; alpha-beta-alpha sandw 2e-08
2aif_A135 Ribosomal protein L7A; high-mobility like protein, 6e-16
2aif_A135 Ribosomal protein L7A; high-mobility like protein, 2e-09
2jnb_A144 NHP2-like protein 1; splicing, KINK-turn RNA-bindi 4e-15
2jnb_A144 NHP2-like protein 1; splicing, KINK-turn RNA-bindi 1e-06
2lbw_A121 H/ACA ribonucleoprotein complex subunit 2; L7AE, s 7e-15
2fc3_A124 50S ribosomal protein L7AE; alpha-beta-alpha sandw 8e-15
2fc3_A124 50S ribosomal protein L7AE; alpha-beta-alpha sandw 1e-05
3o85_A122 Ribosomal protein L7AE; alpha beta sandwich fold, 1e-14
3o85_A122 Ribosomal protein L7AE; alpha beta sandwich fold, 4e-06
2ale_A134 SNU13, NHP2/L7AE family protein YEL026W; splicing, 1e-14
2ale_A134 SNU13, NHP2/L7AE family protein YEL026W; splicing, 1e-05
1vq8_F120 50S ribosomal protein L7AE; ribosome 50S, protein- 8e-14
1vq8_F120 50S ribosomal protein L7AE; ribosome 50S, protein- 3e-05
2xzm_U126 Ribosomal protein L7AE containing protein; ribosom 5e-13
2xzm_U126 Ribosomal protein L7AE containing protein; ribosom 9e-05
3v7e_A82 Ribosome-associated protein L7AE-like; RNA-protein 2e-12
3v7e_A82 Ribosome-associated protein L7AE-like; RNA-protein 4e-04
1rlg_A119 50S ribosomal protein L7AE; protein-RNA, structura 3e-12
1rlg_A119 50S ribosomal protein L7AE; protein-RNA, structura 1e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-09
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 6e-05
3v7q_A101 Probable ribosomal protein YLXQ; L7AE superfamily, 5e-05
>2zkr_f 60S ribosomal protein L7A; protein-RNA complex, 60S ribosomal subunit, ribosomal protein/RNA complex; 8.70A {Canis familiaris} Length = 266 Back     alignment and structure
 Score =  152 bits (383), Expect = 6e-44
 Identities = 166/361 (45%), Positives = 196/361 (54%), Gaps = 98/361 (27%)

Query: 10  KKVVGKSKKVAPAPLAVKKVEVKKVVNPLFEKKARNFGIGQDIQPKRDLSRFVKWPKYIR 69
           K    K KKVAPAP  VKK E KKVVNPLFEK+ +NFGIGQDIQPKRDL+RFVKWP+YIR
Sbjct: 3   KGKKAKGKKVAPAPAVVKKQEAKKVVNPLFEKRPKNFGIGQDIQPKRDLTRFVKWPRYIR 62

Query: 70  IQRQKAVLQKRLKVPPPVHQFTQAVDKQTGQDIQPKRDLSRFVKWPKYIRIQRQKAVLQK 129
           +QRQ+A+L KRLKVPP ++QFTQA+D+QT                               
Sbjct: 63  LQRQRAILYKRLKVPPAINQFTQALDRQT------------------------------- 91

Query: 130 RLKVPPPVHQFTQAVDKQTASQLFKFLEKYRPESWEAKKQRLKARAEKKIAKKEDTPTKK 189
                              A+QL K   KYRPE+ + KKQRL ARAEKK A K D PTK+
Sbjct: 92  -------------------ATQLLKLAHKYRPETKQEKKQRLLARAEKKAAGKGDVPTKR 132

Query: 190 PNQIKQGTNTVTRLVVKKKASLVIIAHDVDPIELFKFLEKYRPESWEAKKQRLKARAEKK 249
           P  ++ G NTVT LV  KKA LV+IAHDVDPIEL  F               L A   K 
Sbjct: 133 PPVLRAGVNTVTTLVENKKAQLVVIAHDVDPIELVVF---------------LPALCRKM 177

Query: 250 IAKKEDTPTKKPNQIKQGTNTVTRLVVKKKASLVIIAHDVDPIELVLFLPALCRKMGIPY 309
                      P  I +G   +  LV +K  + V                          
Sbjct: 178 ---------GVPYCIIKGKARLGHLVHRKTCTTVAFTQ---------------------- 206

Query: 310 CIVDSSDKANLAKLIESVKVNFTDRYDEIRRQWGGGSLGSKSAARIAKLERAKAKELAQK 369
             V+S DK  LAKL+E+++ N+ DRYDEIRR WGG  LG KS ARIAKLE+AKAKELA K
Sbjct: 207 --VNSEDKGALAKLVEAIRTNYNDRYDEIRRHWGGNVLGPKSVARIAKLEKAKAKELATK 264

Query: 370 V 370
           +
Sbjct: 265 L 265
>4a17_F RPL7A, 60S ribosomal protein L9; eukaryotic ribosome, ribosome, eukaryotic initiation factor 60S, translation, large ribosomal subunit; 3.52A {Tetrahymena thermophila} PDB: 4a1a_F 4a1c_F 4a1e_F Length = 255 Back     alignment and structure
>3jyw_G 60S ribosomal protein L8(A); eukaryotic ribosome, RACK1 protein, flexible fitting; 8.90A {Thermomyces lanuginosus} PDB: 1s1i_G Length = 113 Back     alignment and structure
>3jyw_G 60S ribosomal protein L8(A); eukaryotic ribosome, RACK1 protein, flexible fitting; 8.90A {Thermomyces lanuginosus} PDB: 1s1i_G Length = 113 Back     alignment and structure
>1xbi_A 50S ribosomal protein L7AE; alpha-beta-alpha sandwich fold, RNA binding protein/structural protein complex; HET: EPE; 1.45A {Methanocaldococcus jannaschii} SCOP: d.79.3.1 PDB: 1ra4_A* 1sds_A 3paf_A Length = 120 Back     alignment and structure
>1xbi_A 50S ribosomal protein L7AE; alpha-beta-alpha sandwich fold, RNA binding protein/structural protein complex; HET: EPE; 1.45A {Methanocaldococcus jannaschii} SCOP: d.79.3.1 PDB: 1ra4_A* 1sds_A 3paf_A Length = 120 Back     alignment and structure
>2aif_A Ribosomal protein L7A; high-mobility like protein, transcription factor, structural genomics, structural genomics consortium, SGC; 1.90A {Cryptosporidium parvum} SCOP: d.79.3.1 Length = 135 Back     alignment and structure
>2aif_A Ribosomal protein L7A; high-mobility like protein, transcription factor, structural genomics, structural genomics consortium, SGC; 1.90A {Cryptosporidium parvum} SCOP: d.79.3.1 Length = 135 Back     alignment and structure
>2jnb_A NHP2-like protein 1; splicing, KINK-turn RNA-binding protein, NHPX, RNA binding protein; NMR {Homo sapiens} SCOP: d.79.3.1 Length = 144 Back     alignment and structure
>2jnb_A NHP2-like protein 1; splicing, KINK-turn RNA-binding protein, NHPX, RNA binding protein; NMR {Homo sapiens} SCOP: d.79.3.1 Length = 144 Back     alignment and structure
>2lbw_A H/ACA ribonucleoprotein complex subunit 2; L7AE, snoRNP, scaRNP, RNA binding protein; NMR {Saccharomyces cerevisiae} PDB: 2lbx_A Length = 121 Back     alignment and structure
>2fc3_A 50S ribosomal protein L7AE; alpha-beta-alpha sandwich, ribosome, RNA binding protein; 1.56A {Aeropyrum pernix} SCOP: d.79.3.1 PDB: 3pla_C* 3id5_C* 3hax_D* 2hvy_D* 3hay_D* 3nvi_B 3nmu_C 3nvk_E* 3lwr_C 3lwo_C* 3lwq_C* 3lwp_C 3lwv_C 3hjw_C* 2czw_A 1pxw_A Length = 124 Back     alignment and structure
>2fc3_A 50S ribosomal protein L7AE; alpha-beta-alpha sandwich, ribosome, RNA binding protein; 1.56A {Aeropyrum pernix} SCOP: d.79.3.1 PDB: 3pla_C* 3id5_C* 3hax_D* 2hvy_D* 3hay_D* 3nvi_B 3nmu_C 3nvk_E* 3lwr_C 3lwo_C* 3lwq_C* 3lwp_C 3lwv_C 3hjw_C* 2czw_A 1pxw_A Length = 124 Back     alignment and structure
>3o85_A Ribosomal protein L7AE; alpha beta sandwich fold, K-turn RNA binding protein, KINK T ribosomal protein; 1.81A {Giardia lamblia} Length = 122 Back     alignment and structure
>3o85_A Ribosomal protein L7AE; alpha beta sandwich fold, K-turn RNA binding protein, KINK T ribosomal protein; 1.81A {Giardia lamblia} Length = 122 Back     alignment and structure
>2ale_A SNU13, NHP2/L7AE family protein YEL026W; splicing, RNA, yeast, His-TAG, RNA binding protein; 1.80A {Saccharomyces cerevisiae} SCOP: d.79.3.1 PDB: 1zwz_A 2ozb_A 3siu_A 3siv_A 1e7k_A Length = 134 Back     alignment and structure
>2ale_A SNU13, NHP2/L7AE family protein YEL026W; splicing, RNA, yeast, His-TAG, RNA binding protein; 1.80A {Saccharomyces cerevisiae} SCOP: d.79.3.1 PDB: 1zwz_A 2ozb_A 3siu_A 3siv_A 1e7k_A Length = 134 Back     alignment and structure
>1vq8_F 50S ribosomal protein L7AE; ribosome 50S, protein-protein complex, RNA-RNA complex, PROT complex, peptidyl transferase reaction; HET: 1MA OMU OMG UR3 PSU SPS; 2.20A {Haloarcula marismortui} SCOP: d.79.3.1 PDB: 1vq4_F* 1vq5_F* 1vq6_F* 1vq7_F* 1s72_F* 1vq9_F* 1vqk_F* 1vql_F* 1vqm_F* 1vqn_F* 1vqo_F* 1vqp_F* 1yhq_F* 1yi2_F* 1yij_F* 1yit_F* 1yj9_F* 1yjn_F* 1yjw_F* 2otj_F* ... Length = 120 Back     alignment and structure
>1vq8_F 50S ribosomal protein L7AE; ribosome 50S, protein-protein complex, RNA-RNA complex, PROT complex, peptidyl transferase reaction; HET: 1MA OMU OMG UR3 PSU SPS; 2.20A {Haloarcula marismortui} SCOP: d.79.3.1 PDB: 1vq4_F* 1vq5_F* 1vq6_F* 1vq7_F* 1s72_F* 1vq9_F* 1vqk_F* 1vql_F* 1vqm_F* 1vqn_F* 1vqo_F* 1vqp_F* 1yhq_F* 1yi2_F* 1yij_F* 1yit_F* 1yj9_F* 1yjn_F* 1yjw_F* 2otj_F* ... Length = 120 Back     alignment and structure
>2xzm_U Ribosomal protein L7AE containing protein; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_U Length = 126 Back     alignment and structure
>2xzm_U Ribosomal protein L7AE containing protein; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_U Length = 126 Back     alignment and structure
>3v7e_A Ribosome-associated protein L7AE-like; RNA-protein complex, K-turn, L7AE-like, A member L7AE/L30E superfamily; HET: SAM; 2.80A {Bacillus subtilis} Length = 82 Back     alignment and structure
>3v7e_A Ribosome-associated protein L7AE-like; RNA-protein complex, K-turn, L7AE-like, A member L7AE/L30E superfamily; HET: SAM; 2.80A {Bacillus subtilis} Length = 82 Back     alignment and structure
>1rlg_A 50S ribosomal protein L7AE; protein-RNA, structural protein/RNA complex; HET: 5BU; 2.70A {Archaeoglobus fulgidus} SCOP: d.79.3.1 Length = 119 Back     alignment and structure
>1rlg_A 50S ribosomal protein L7AE; protein-RNA, structural protein/RNA complex; HET: 5BU; 2.70A {Archaeoglobus fulgidus} SCOP: d.79.3.1 Length = 119 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3v7q_A Probable ribosomal protein YLXQ; L7AE superfamily, K-turn binding, K-turn RNA, hypothetical R protein, RNA binding protein; HET: CIT; 1.55A {Bacillus subtilis} Length = 101 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query370
3iz5_H258 60S ribosomal protein L7A (L7AE); eukaryotic ribos 100.0
4a17_F255 RPL7A, 60S ribosomal protein L9; eukaryotic riboso 100.0
3izc_H256 60S ribosomal protein RPL8 (L7AE); eukaryotic ribo 100.0
2zkr_f266 60S ribosomal protein L7A; protein-RNA complex, 60 100.0
3iz5_H258 60S ribosomal protein L7A (L7AE); eukaryotic ribos 99.9
3jyw_G113 60S ribosomal protein L8(A); eukaryotic ribosome, 99.88
4a17_F255 RPL7A, 60S ribosomal protein L9; eukaryotic riboso 99.85
3izc_H256 60S ribosomal protein RPL8 (L7AE); eukaryotic ribo 99.8
2lbw_A121 H/ACA ribonucleoprotein complex subunit 2; L7AE, s 99.75
2zkr_f266 60S ribosomal protein L7A; protein-RNA complex, 60 99.71
2ale_A134 SNU13, NHP2/L7AE family protein YEL026W; splicing, 99.63
3jyw_G113 60S ribosomal protein L8(A); eukaryotic ribosome, 99.51
2jnb_A144 NHP2-like protein 1; splicing, KINK-turn RNA-bindi 99.45
3v7e_A82 Ribosome-associated protein L7AE-like; RNA-protein 99.44
1xbi_A120 50S ribosomal protein L7AE; alpha-beta-alpha sandw 99.43
2xzm_U126 Ribosomal protein L7AE containing protein; ribosom 99.43
1rlg_A119 50S ribosomal protein L7AE; protein-RNA, structura 99.4
1vq8_F120 50S ribosomal protein L7AE; ribosome 50S, protein- 99.39
2fc3_A124 50S ribosomal protein L7AE; alpha-beta-alpha sandw 99.36
3o85_A122 Ribosomal protein L7AE; alpha beta sandwich fold, 99.35
2aif_A135 Ribosomal protein L7A; high-mobility like protein, 99.3
3cpq_A110 50S ribosomal protein L30E; RNA-protein, elongatio 99.14
2kg4_A165 Growth arrest and DNA-damage-inducible protein GA 99.12
3u5c_M143 40S ribosomal protein S12, 40S ribosomal protein S 99.12
1w41_A101 50S ribosomal protein L30E; electrostatic interact 99.11
3on1_A101 BH2414 protein; structural genomics, PSI-2, protei 99.01
3v7q_A101 Probable ribosomal protein YLXQ; L7AE superfamily, 98.99
3j21_Z99 50S ribosomal protein L30E; archaea, archaeal, KIN 98.88
4a18_G104 RPL30; ribosome, eukaryotic initiation factor 6, E 98.77
3iz5_f112 60S ribosomal protein L30 (L30E); eukaryotic ribos 98.7
3u5e_c105 L32, RP73, YL38, 60S ribosomal protein L30; transl 98.65
2xzm_U126 Ribosomal protein L7AE containing protein; ribosom 98.32
2lbw_A121 H/ACA ribonucleoprotein complex subunit 2; L7AE, s 98.1
1xbi_A120 50S ribosomal protein L7AE; alpha-beta-alpha sandw 98.03
2ale_A134 SNU13, NHP2/L7AE family protein YEL026W; splicing, 97.95
3vi6_A125 60S ribosomal protein L30; three-layer alpha/beta/ 97.94
3v7e_A82 Ribosome-associated protein L7AE-like; RNA-protein 97.94
1rlg_A119 50S ribosomal protein L7AE; protein-RNA, structura 97.86
1vq8_F120 50S ribosomal protein L7AE; ribosome 50S, protein- 97.83
2fc3_A124 50S ribosomal protein L7AE; alpha-beta-alpha sandw 97.76
2jnb_A144 NHP2-like protein 1; splicing, KINK-turn RNA-bindi 97.7
3cg6_A146 Growth arrest and DNA-damage-inducible 45 gamma; a 97.49
3o85_A122 Ribosomal protein L7AE; alpha beta sandwich fold, 97.46
2aif_A135 Ribosomal protein L7A; high-mobility like protein, 97.26
3cpq_A110 50S ribosomal protein L30E; RNA-protein, elongatio 97.21
3ffm_A167 Growth arrest and DNA-damage-inducible protein GAD 97.21
1w41_A101 50S ribosomal protein L30E; electrostatic interact 97.13
3v7q_A101 Probable ribosomal protein YLXQ; L7AE superfamily, 96.88
3on1_A101 BH2414 protein; structural genomics, PSI-2, protei 96.67
3j21_Z99 50S ribosomal protein L30E; archaea, archaeal, KIN 96.12
2kg4_A165 Growth arrest and DNA-damage-inducible protein GA 95.28
4a18_G104 RPL30; ribosome, eukaryotic initiation factor 6, E 94.83
3u5c_M143 40S ribosomal protein S12, 40S ribosomal protein S 94.46
3iz5_f112 60S ribosomal protein L30 (L30E); eukaryotic ribos 94.24
3vi6_A125 60S ribosomal protein L30; three-layer alpha/beta/ 92.97
3u5e_c105 L32, RP73, YL38, 60S ribosomal protein L30; transl 91.85
1b93_A152 Protein (methylglyoxal synthase); glycolytic bypas 82.66
2xw6_A134 MGS, methylglyoxal synthase; lyase; 1.08A {Thermus 80.76
>4a17_F RPL7A, 60S ribosomal protein L9; eukaryotic ribosome, ribosome, eukaryotic initiation factor 60S, translation, large ribosomal subunit; 3.52A {Tetrahymena thermophila} PDB: 4a1a_F 4a1c_F 4a1e_F Back     alignment and structure
>2zkr_f 60S ribosomal protein L7A; protein-RNA complex, 60S ribosomal subunit, ribosomal protein/RNA complex; 8.70A {Canis familiaris} Back     alignment and structure
>3jyw_G 60S ribosomal protein L8(A); eukaryotic ribosome, RACK1 protein, flexible fitting; 8.90A {Thermomyces lanuginosus} PDB: 1s1i_G Back     alignment and structure
>4a17_F RPL7A, 60S ribosomal protein L9; eukaryotic ribosome, ribosome, eukaryotic initiation factor 60S, translation, large ribosomal subunit; 3.52A {Tetrahymena thermophila} PDB: 4a1a_F 4a1c_F 4a1e_F Back     alignment and structure
>2lbw_A H/ACA ribonucleoprotein complex subunit 2; L7AE, snoRNP, scaRNP, RNA binding protein; NMR {Saccharomyces cerevisiae} PDB: 2lbx_A Back     alignment and structure
>2zkr_f 60S ribosomal protein L7A; protein-RNA complex, 60S ribosomal subunit, ribosomal protein/RNA complex; 8.70A {Canis familiaris} Back     alignment and structure
>2ale_A SNU13, NHP2/L7AE family protein YEL026W; splicing, RNA, yeast, His-TAG, RNA binding protein; 1.80A {Saccharomyces cerevisiae} SCOP: d.79.3.1 PDB: 1zwz_A 2ozb_A 3siu_A 3siv_A 1e7k_A Back     alignment and structure
>3jyw_G 60S ribosomal protein L8(A); eukaryotic ribosome, RACK1 protein, flexible fitting; 8.90A {Thermomyces lanuginosus} PDB: 1s1i_G Back     alignment and structure
>2jnb_A NHP2-like protein 1; splicing, KINK-turn RNA-binding protein, NHPX, RNA binding protein; NMR {Homo sapiens} SCOP: d.79.3.1 Back     alignment and structure
>3v7e_A Ribosome-associated protein L7AE-like; RNA-protein complex, K-turn, L7AE-like, A member L7AE/L30E superfamily; HET: SAM; 2.80A {Bacillus subtilis} Back     alignment and structure
>1xbi_A 50S ribosomal protein L7AE; alpha-beta-alpha sandwich fold, RNA binding protein/structural protein complex; HET: EPE; 1.45A {Methanocaldococcus jannaschii} SCOP: d.79.3.1 PDB: 1ra4_A* 1sds_A 3paf_A Back     alignment and structure
>2xzm_U Ribosomal protein L7AE containing protein; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_U Back     alignment and structure
>1rlg_A 50S ribosomal protein L7AE; protein-RNA, structural protein/RNA complex; HET: 5BU; 2.70A {Archaeoglobus fulgidus} SCOP: d.79.3.1 Back     alignment and structure
>1vq8_F 50S ribosomal protein L7AE; ribosome 50S, protein-protein complex, RNA-RNA complex, PROT complex, peptidyl transferase reaction; HET: 1MA OMU OMG UR3 PSU SPS; 2.20A {Haloarcula marismortui} SCOP: d.79.3.1 PDB: 1vq4_F* 1vq5_F* 1vq6_F* 1vq7_F* 1s72_F* 1vq9_F* 1vqk_F* 1vql_F* 1vqm_F* 1vqn_F* 1vqo_F* 1vqp_F* 1yhq_F* 1yi2_F* 1yij_F* 1yit_F* 1yj9_F* 1yjn_F* 1yjw_F* 2otj_F* ... Back     alignment and structure
>2fc3_A 50S ribosomal protein L7AE; alpha-beta-alpha sandwich, ribosome, RNA binding protein; 1.56A {Aeropyrum pernix} SCOP: d.79.3.1 PDB: 3pla_C* 3id5_C* 3hax_D* 2hvy_D* 3hay_D* 3nvi_B 3nmu_C 3nvk_E* 3lwr_C 3lwo_C* 3lwq_C* 3lwp_C 3lwv_C 3hjw_C* 2czw_A 1pxw_A Back     alignment and structure
>3o85_A Ribosomal protein L7AE; alpha beta sandwich fold, K-turn RNA binding protein, KINK T ribosomal protein; 1.81A {Giardia lamblia} Back     alignment and structure
>2aif_A Ribosomal protein L7A; high-mobility like protein, transcription factor, structural genomics, structural genomics consortium, SGC; 1.90A {Cryptosporidium parvum} SCOP: d.79.3.1 Back     alignment and structure
>3cpq_A 50S ribosomal protein L30E; RNA-protein, elongation factor, ribonucleoprotein, structural genomics, NPPSFA; 1.90A {Methanocaldococcus jannaschii} Back     alignment and structure
>2kg4_A Growth arrest and DNA-damage-inducible protein GA alpha; GADD45, flexible regions, monomer cycle; NMR {Homo sapiens} Back     alignment and structure
>3u5c_M 40S ribosomal protein S12, 40S ribosomal protein S11-A; translation, ribosome, ribosomal, ribosomal R ribosomal protein, eukaryotic ribosome, RNA-protein C; 3.00A {Saccharomyces cerevisiae} PDB: 3u5g_M Back     alignment and structure
>1w41_A 50S ribosomal protein L30E; electrostatic interactions, thermostability, protein engineering; 1.7A {Thermococcus celer} SCOP: d.79.3.1 PDB: 3n4y_A 3lfo_A 1w40_A 1go0_A 1go1_A 1h7m_A 1w42_A 1w3e_X 3ra6_A 3ra5_A 3n4z_A 2bo1_A Back     alignment and structure
>3on1_A BH2414 protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG, unknown function; HET: MSE; 1.65A {Bacillus halodurans} Back     alignment and structure
>3v7q_A Probable ribosomal protein YLXQ; L7AE superfamily, K-turn binding, K-turn RNA, hypothetical R protein, RNA binding protein; HET: CIT; 1.55A {Bacillus subtilis} Back     alignment and structure
>3j21_Z 50S ribosomal protein L30E; archaea, archaeal, KINK-turn, protein synthe ribosome; 6.60A {Pyrococcus furiosus} Back     alignment and structure
>4a18_G RPL30; ribosome, eukaryotic initiation factor 6, EIF6, transla large ribosomal subunit, rRNA; 3.52A {Tetrahymena thermophila} PDB: 4a19_G 4a1b_G 4a1d_G 4adx_6 Back     alignment and structure
>3u5e_c L32, RP73, YL38, 60S ribosomal protein L30; translation, ribosome, ribosomal R ribosomal protein, STM1, eukaryotic ribosome; 3.00A {Saccharomyces cerevisiae} PDB: 3izc_f 3izs_f 3o58_Z 3o5h_Z 1t0k_B 3u5i_c 4b6a_c 1ck2_A 1cn7_A 1nmu_B* 3jyw_2 Back     alignment and structure
>2xzm_U Ribosomal protein L7AE containing protein; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_U Back     alignment and structure
>2lbw_A H/ACA ribonucleoprotein complex subunit 2; L7AE, snoRNP, scaRNP, RNA binding protein; NMR {Saccharomyces cerevisiae} PDB: 2lbx_A Back     alignment and structure
>1xbi_A 50S ribosomal protein L7AE; alpha-beta-alpha sandwich fold, RNA binding protein/structural protein complex; HET: EPE; 1.45A {Methanocaldococcus jannaschii} SCOP: d.79.3.1 PDB: 1ra4_A* 1sds_A 3paf_A Back     alignment and structure
>2ale_A SNU13, NHP2/L7AE family protein YEL026W; splicing, RNA, yeast, His-TAG, RNA binding protein; 1.80A {Saccharomyces cerevisiae} SCOP: d.79.3.1 PDB: 1zwz_A 2ozb_A 3siu_A 3siv_A 1e7k_A Back     alignment and structure
>3vi6_A 60S ribosomal protein L30; three-layer alpha/beta/ALPA; 1.59A {Homo sapiens} PDB: 2zkr_6 1ysh_C Back     alignment and structure
>3v7e_A Ribosome-associated protein L7AE-like; RNA-protein complex, K-turn, L7AE-like, A member L7AE/L30E superfamily; HET: SAM; 2.80A {Bacillus subtilis} Back     alignment and structure
>1rlg_A 50S ribosomal protein L7AE; protein-RNA, structural protein/RNA complex; HET: 5BU; 2.70A {Archaeoglobus fulgidus} SCOP: d.79.3.1 Back     alignment and structure
>1vq8_F 50S ribosomal protein L7AE; ribosome 50S, protein-protein complex, RNA-RNA complex, PROT complex, peptidyl transferase reaction; HET: 1MA OMU OMG UR3 PSU SPS; 2.20A {Haloarcula marismortui} SCOP: d.79.3.1 PDB: 1vq4_F* 1vq5_F* 1vq6_F* 1vq7_F* 1s72_F* 1vq9_F* 1vqk_F* 1vql_F* 1vqm_F* 1vqn_F* 1vqo_F* 1vqp_F* 1yhq_F* 1yi2_F* 1yij_F* 1yit_F* 1yj9_F* 1yjn_F* 1yjw_F* 2otj_F* ... Back     alignment and structure
>2fc3_A 50S ribosomal protein L7AE; alpha-beta-alpha sandwich, ribosome, RNA binding protein; 1.56A {Aeropyrum pernix} SCOP: d.79.3.1 PDB: 3pla_C* 3id5_C* 3hax_D* 2hvy_D* 3hay_D* 3nvi_B 3nmu_C 3nvk_E* 3lwr_C 3lwo_C* 3lwq_C* 3lwp_C 3lwv_C 3hjw_C* 2czw_A 1pxw_A Back     alignment and structure
>2jnb_A NHP2-like protein 1; splicing, KINK-turn RNA-binding protein, NHPX, RNA binding protein; NMR {Homo sapiens} SCOP: d.79.3.1 Back     alignment and structure
>3cg6_A Growth arrest and DNA-damage-inducible 45 gamma; alpha/beta, cell cycle; 1.70A {Mus musculus} PDB: 2wal_A Back     alignment and structure
>3o85_A Ribosomal protein L7AE; alpha beta sandwich fold, K-turn RNA binding protein, KINK T ribosomal protein; 1.81A {Giardia lamblia} Back     alignment and structure
>2aif_A Ribosomal protein L7A; high-mobility like protein, transcription factor, structural genomics, structural genomics consortium, SGC; 1.90A {Cryptosporidium parvum} SCOP: d.79.3.1 Back     alignment and structure
>3cpq_A 50S ribosomal protein L30E; RNA-protein, elongation factor, ribonucleoprotein, structural genomics, NPPSFA; 1.90A {Methanocaldococcus jannaschii} Back     alignment and structure
>3ffm_A Growth arrest and DNA-damage-inducible protein GADD45 gamma; beta-turn-helix, cell cycle; 2.30A {Homo sapiens} Back     alignment and structure
>1w41_A 50S ribosomal protein L30E; electrostatic interactions, thermostability, protein engineering; 1.7A {Thermococcus celer} SCOP: d.79.3.1 PDB: 3n4y_A 3lfo_A 1w40_A 1go0_A 1go1_A 1h7m_A 1w42_A 1w3e_X 3ra6_A 3ra5_A 3n4z_A 2bo1_A Back     alignment and structure
>3v7q_A Probable ribosomal protein YLXQ; L7AE superfamily, K-turn binding, K-turn RNA, hypothetical R protein, RNA binding protein; HET: CIT; 1.55A {Bacillus subtilis} Back     alignment and structure
>3on1_A BH2414 protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG, unknown function; HET: MSE; 1.65A {Bacillus halodurans} Back     alignment and structure
>3j21_Z 50S ribosomal protein L30E; archaea, archaeal, KINK-turn, protein synthe ribosome; 6.60A {Pyrococcus furiosus} Back     alignment and structure
>2kg4_A Growth arrest and DNA-damage-inducible protein GA alpha; GADD45, flexible regions, monomer cycle; NMR {Homo sapiens} Back     alignment and structure
>4a18_G RPL30; ribosome, eukaryotic initiation factor 6, EIF6, transla large ribosomal subunit, rRNA; 3.52A {Tetrahymena thermophila} PDB: 4a19_G 4a1b_G 4a1d_G 4adx_6 Back     alignment and structure
>3u5c_M 40S ribosomal protein S12, 40S ribosomal protein S11-A; translation, ribosome, ribosomal, ribosomal R ribosomal protein, eukaryotic ribosome, RNA-protein C; 3.00A {Saccharomyces cerevisiae} PDB: 3u5g_M Back     alignment and structure
>3vi6_A 60S ribosomal protein L30; three-layer alpha/beta/ALPA; 1.59A {Homo sapiens} PDB: 2zkr_6 1ysh_C Back     alignment and structure
>3u5e_c L32, RP73, YL38, 60S ribosomal protein L30; translation, ribosome, ribosomal R ribosomal protein, STM1, eukaryotic ribosome; 3.00A {Saccharomyces cerevisiae} PDB: 3izc_f 3izs_f 3o58_Z 3o5h_Z 1t0k_B 3u5i_c 4b6a_c 1ck2_A 1cn7_A 1nmu_B* 3jyw_2 Back     alignment and structure
>1b93_A Protein (methylglyoxal synthase); glycolytic bypass, lyase; 1.90A {Escherichia coli} SCOP: c.24.1.2 PDB: 1egh_A 1ik4_A* 1s8a_A 1s89_A Back     alignment and structure
>2xw6_A MGS, methylglyoxal synthase; lyase; 1.08A {Thermus SP} PDB: 2x8w_A 1wo8_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 370
d1xbia1115 d.79.3.1 (A:2-116) Ribosomal protein L7ae {Archaeo 7e-13
d1xbia1115 d.79.3.1 (A:2-116) Ribosomal protein L7ae {Archaeo 9e-06
d1rlga_113 d.79.3.1 (A:) Ribosomal protein L7ae {Archaeon Arc 4e-12
d1rlga_113 d.79.3.1 (A:) Ribosomal protein L7ae {Archaeon Arc 4e-05
d2fc3a1124 d.79.3.1 (A:4-127) Ribosomal protein L7ae {Aeropyr 4e-11
d2fc3a1124 d.79.3.1 (A:4-127) Ribosomal protein L7ae {Aeropyr 1e-05
d2ozba1125 d.79.3.1 (A:4-128) Spliceosomal 15.5kd protein {Hu 1e-10
d2ozba1125 d.79.3.1 (A:4-128) Spliceosomal 15.5kd protein {Hu 6e-05
d2alea1126 d.79.3.1 (A:1-126) Small nuclear ribonucleoprotein 1e-10
d2alea1126 d.79.3.1 (A:1-126) Small nuclear ribonucleoprotein 4e-05
d1vqof1119 d.79.3.1 (F:1-119) Ribosomal protein L7ae {Archaeo 1e-10
d1vqof1119 d.79.3.1 (F:1-119) Ribosomal protein L7ae {Archaeo 9e-06
d2aifa1115 d.79.3.1 (A:16-130) Ribosomal protein L7ae {Crypto 3e-09
d2aifa1115 d.79.3.1 (A:16-130) Ribosomal protein L7ae {Crypto 2e-04
d1w3ex198 d.79.3.1 (X:1-98) Eukaryotic ribosomal protein L30 3e-07
d2bo1a1100 d.79.3.1 (A:1-100) Eukaryotic ribosomal protein L3 5e-05
d1t0kb_97 d.79.3.1 (B:) Eukaryotic ribosomal protein L30 (L3 5e-05
>d1xbia1 d.79.3.1 (A:2-116) Ribosomal protein L7ae {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 115 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Bacillus chorismate mutase-like
superfamily: L30e-like
family: L30e/L7ae ribosomal proteins
domain: Ribosomal protein L7ae
species: Archaeon Methanococcus jannaschii [TaxId: 2190]

 Score = 62.2 bits (151), Expect = 7e-13
 Identities = 31/70 (44%), Positives = 40/70 (57%)

Query: 248 KKIAKKEDTPTKKPNQIKQGTNTVTRLVVKKKASLVIIAHDVDPIELVLFLPALCRKMGI 307
           ++I K+      K  +IK+G N VT+ V +  A LVIIA DV P E+V  LP LC + GI
Sbjct: 10  EEIQKELLDAVAKAQKIKKGANEVTKAVERGIAKLVIIAEDVKPEEVVAHLPYLCEEKGI 69

Query: 308 PYCIVDSSDK 317
           PY  V S   
Sbjct: 70  PYAYVASKQD 79
>d1xbia1 d.79.3.1 (A:2-116) Ribosomal protein L7ae {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 115 Back     information, alignment and structure
>d1rlga_ d.79.3.1 (A:) Ribosomal protein L7ae {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 113 Back     information, alignment and structure
>d1rlga_ d.79.3.1 (A:) Ribosomal protein L7ae {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 113 Back     information, alignment and structure
>d2fc3a1 d.79.3.1 (A:4-127) Ribosomal protein L7ae {Aeropyrum pernix [TaxId: 56636]} Length = 124 Back     information, alignment and structure
>d2fc3a1 d.79.3.1 (A:4-127) Ribosomal protein L7ae {Aeropyrum pernix [TaxId: 56636]} Length = 124 Back     information, alignment and structure
>d2ozba1 d.79.3.1 (A:4-128) Spliceosomal 15.5kd protein {Human (Homo sapiens) [TaxId: 9606]} Length = 125 Back     information, alignment and structure
>d2ozba1 d.79.3.1 (A:4-128) Spliceosomal 15.5kd protein {Human (Homo sapiens) [TaxId: 9606]} Length = 125 Back     information, alignment and structure
>d2alea1 d.79.3.1 (A:1-126) Small nuclear ribonucleoprotein-associated protein 1, Snu13p {Saccharomyces cerevisiae [TaxId: 4932]} Length = 126 Back     information, alignment and structure
>d2alea1 d.79.3.1 (A:1-126) Small nuclear ribonucleoprotein-associated protein 1, Snu13p {Saccharomyces cerevisiae [TaxId: 4932]} Length = 126 Back     information, alignment and structure
>d1vqof1 d.79.3.1 (F:1-119) Ribosomal protein L7ae {Archaeon Haloarcula marismortui [TaxId: 2238]} Length = 119 Back     information, alignment and structure
>d1vqof1 d.79.3.1 (F:1-119) Ribosomal protein L7ae {Archaeon Haloarcula marismortui [TaxId: 2238]} Length = 119 Back     information, alignment and structure
>d2aifa1 d.79.3.1 (A:16-130) Ribosomal protein L7ae {Cryptosporidium parvum [TaxId: 5807]} Length = 115 Back     information, alignment and structure
>d2aifa1 d.79.3.1 (A:16-130) Ribosomal protein L7ae {Cryptosporidium parvum [TaxId: 5807]} Length = 115 Back     information, alignment and structure
>d1w3ex1 d.79.3.1 (X:1-98) Eukaryotic ribosomal protein L30 (L30e) {Archaeon Thermococcus celer [TaxId: 2264]} Length = 98 Back     information, alignment and structure
>d2bo1a1 d.79.3.1 (A:1-100) Eukaryotic ribosomal protein L30 (L30e) {Archaeon Thermococcus celer [TaxId: 2264]} Length = 100 Back     information, alignment and structure
>d1t0kb_ d.79.3.1 (B:) Eukaryotic ribosomal protein L30 (L30e) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 97 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query370
d2alea1126 Small nuclear ribonucleoprotein-associated protein 99.62
d2fc3a1124 Ribosomal protein L7ae {Aeropyrum pernix [TaxId: 5 99.61
d1xbia1115 Ribosomal protein L7ae {Archaeon Methanococcus jan 99.54
d2ozba1125 Spliceosomal 15.5kd protein {Human (Homo sapiens) 99.48
d1rlga_113 Ribosomal protein L7ae {Archaeon Archaeoglobus ful 99.45
d2aifa1115 Ribosomal protein L7ae {Cryptosporidium parvum [Ta 99.43
d1vqof1119 Ribosomal protein L7ae {Archaeon Haloarcula marism 99.37
d2bo1a1100 Eukaryotic ribosomal protein L30 (L30e) {Archaeon 98.5
d1w3ex198 Eukaryotic ribosomal protein L30 (L30e) {Archaeon 98.5
d1t0kb_97 Eukaryotic ribosomal protein L30 (L30e) {Baker's y 98.4
d2alea1126 Small nuclear ribonucleoprotein-associated protein 98.37
d2aifa1115 Ribosomal protein L7ae {Cryptosporidium parvum [Ta 98.08
d1xbia1115 Ribosomal protein L7ae {Archaeon Methanococcus jan 97.96
d2fc3a1124 Ribosomal protein L7ae {Aeropyrum pernix [TaxId: 5 97.96
d2ozba1125 Spliceosomal 15.5kd protein {Human (Homo sapiens) 97.87
d1vqof1119 Ribosomal protein L7ae {Archaeon Haloarcula marism 97.75
d1rlga_113 Ribosomal protein L7ae {Archaeon Archaeoglobus ful 97.7
d2bo1a1100 Eukaryotic ribosomal protein L30 (L30e) {Archaeon 95.04
d1w3ex198 Eukaryotic ribosomal protein L30 (L30e) {Archaeon 94.36
d1t0kb_97 Eukaryotic ribosomal protein L30 (L30e) {Baker's y 94.09
d1wo8a1126 Methylglyoxal synthase, MgsA {Thermus thermophilus 91.62
d1b93a_148 Methylglyoxal synthase, MgsA {Escherichia coli [Ta 84.16
>d2alea1 d.79.3.1 (A:1-126) Small nuclear ribonucleoprotein-associated protein 1, Snu13p {Saccharomyces cerevisiae [TaxId: 4932]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Bacillus chorismate mutase-like
superfamily: L30e-like
family: L30e/L7ae ribosomal proteins
domain: Small nuclear ribonucleoprotein-associated protein 1, Snu13p
species: Saccharomyces cerevisiae [TaxId: 4932]

Probab=99.62  E-value=8.3e-17  Score=135.61  Aligned_cols=86  Identities=28%  Similarity=0.460  Sum_probs=72.2

Q ss_pred             hhcCcCcHHHHHHHHHHHHHHHHcCCCCCCCCCCcccccchhHHHHHHhcCcceEEEEeccCCchhHHHhHHHHhhhcCC
Q psy6066         228 EKYRPESWEAKKQRLKARAEKKIAKKEDTPTKKPNQIKQGTNTVTRLVVKKKASLVIIAHDVDPIELVLFLPALCRKMGI  307 (370)
Q Consensus       228 pky~pes~~~Kk~rL~~~a~~~~~~k~~~~~kkp~~Lk~GineVtklIekkkA~LVVIA~DVdPiElV~~LPaLCek~~V  307 (370)
                      |.+.|...++-.++++.-.+...         +...|++|+|+|+++|++|+++|||||.|++|.+++.|||.||+++||
T Consensus         6 ~~a~P~a~~~l~~~i~~ll~~a~---------~~~~l~~G~~ev~K~i~~g~a~lVviA~D~~p~~~~~~l~~lc~~~~I   76 (126)
T d2alea1           6 PKAFPLADAALTQQILDVVQQAA---------NLRQLKKGANEATKTLNRGISEFIIMAADCEPIEILLHLPLLCEDKNV   76 (126)
T ss_dssp             TTCCSBCCHHHHHHHHHHHHHHH---------HTTCEEESHHHHHHHHHHTCEEEEEEETTCSSGGGGTHHHHHHHHHTC
T ss_pred             CccCCCCCHHHHHHHHHHHHHHH---------HcCCcccCHHHHHHHHHcCCCeEEEEeCCCChHHHHHHHHHHHhccCC
Confidence            56788888887776666444311         124588999999999999999999999999999999999999999999


Q ss_pred             cEEEEccc-cHHHHHH
Q psy6066         308 PYCIVDSS-DKANLAK  322 (370)
Q Consensus       308 PY~iV~Se-Dkg~lak  322 (370)
                      ||+||+++ ++|.+.+
T Consensus        77 p~~~v~sk~~LG~a~G   92 (126)
T d2alea1          77 PYVFVPSRVALGRACG   92 (126)
T ss_dssp             CEEEESCHHHHHHHTT
T ss_pred             CEEEECchhHHHHHhC
Confidence            99999984 7887765
>d2fc3a1 d.79.3.1 (A:4-127) Ribosomal protein L7ae {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1xbia1 d.79.3.1 (A:2-116) Ribosomal protein L7ae {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2ozba1 d.79.3.1 (A:4-128) Spliceosomal 15.5kd protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rlga_ d.79.3.1 (A:) Ribosomal protein L7ae {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2aifa1 d.79.3.1 (A:16-130) Ribosomal protein L7ae {Cryptosporidium parvum [TaxId: 5807]} Back     information, alignment and structure
>d1vqof1 d.79.3.1 (F:1-119) Ribosomal protein L7ae {Archaeon Haloarcula marismortui [TaxId: 2238]} Back     information, alignment and structure
>d2bo1a1 d.79.3.1 (A:1-100) Eukaryotic ribosomal protein L30 (L30e) {Archaeon Thermococcus celer [TaxId: 2264]} Back     information, alignment and structure
>d1w3ex1 d.79.3.1 (X:1-98) Eukaryotic ribosomal protein L30 (L30e) {Archaeon Thermococcus celer [TaxId: 2264]} Back     information, alignment and structure
>d1t0kb_ d.79.3.1 (B:) Eukaryotic ribosomal protein L30 (L30e) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2alea1 d.79.3.1 (A:1-126) Small nuclear ribonucleoprotein-associated protein 1, Snu13p {Saccharomyces cerevisiae [TaxId: 4932]} Back     information, alignment and structure
>d2aifa1 d.79.3.1 (A:16-130) Ribosomal protein L7ae {Cryptosporidium parvum [TaxId: 5807]} Back     information, alignment and structure
>d1xbia1 d.79.3.1 (A:2-116) Ribosomal protein L7ae {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2fc3a1 d.79.3.1 (A:4-127) Ribosomal protein L7ae {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d2ozba1 d.79.3.1 (A:4-128) Spliceosomal 15.5kd protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vqof1 d.79.3.1 (F:1-119) Ribosomal protein L7ae {Archaeon Haloarcula marismortui [TaxId: 2238]} Back     information, alignment and structure
>d1rlga_ d.79.3.1 (A:) Ribosomal protein L7ae {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2bo1a1 d.79.3.1 (A:1-100) Eukaryotic ribosomal protein L30 (L30e) {Archaeon Thermococcus celer [TaxId: 2264]} Back     information, alignment and structure
>d1w3ex1 d.79.3.1 (X:1-98) Eukaryotic ribosomal protein L30 (L30e) {Archaeon Thermococcus celer [TaxId: 2264]} Back     information, alignment and structure
>d1t0kb_ d.79.3.1 (B:) Eukaryotic ribosomal protein L30 (L30e) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wo8a1 c.24.1.2 (A:1-126) Methylglyoxal synthase, MgsA {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1b93a_ c.24.1.2 (A:) Methylglyoxal synthase, MgsA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure