Diaphorina citri psyllid: psy6067

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580----

MWLSNFLDALSRKKSSYSEDAYDDGSGSREKLARVLGLTDLTLLGIGATLGVGVYVLAGSVAKNQAGPSVVISFIIAALASALSGLCYVEFASRISKSGSAYNYTYLSIGEFAAYIIGWNLELFIEVQAFCIEFSRIREAAALFRLLKQLESGGGETSTLTTDRYSFLSTYPDFIAAGIVMLMSALISWGVSESTRLNSVFTFLNLGTVVVIVGSGLFKMNPRNWAIRKEDIPRTVRHGGTGGFAPFGLNGIIVGAAKCFFGFVGFDCIATTGEESKNPKRDIPLSILLSLFIVFVCYLAIAIVLTLIIPYYEQDAEAPFPHIFDSLGWPVMKWLVTVGSLFALLTAMFGALFPLPRILYAMSLDGLLYDCFSYVSPRTKTPVLSSLLTGALTAVLSAVFKLDQLVDMLSIGTLLAYTIVALSVLILRYSEDGADTPIKGTSCAEKETKSSSFAEKDINAKNFSVNALPEETLDPNSQSALTGGPVPTSDCTSALQYATFTLLGLVYTVVFVCLARQNQNRARLKFKVPWVPLVPCLSIFMNIYLMINLDISTWVRFVIWLVIGFGIYFTYGISHSKQKLTKLA

ccHHHHHHHHHccccccccccccccccccccccccccHHHHHHHccccEEcccEEEEHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHEEEEEccEEECccccccccccccccccccccccccccccHHHccccEEEEEEEccccHHHcccccccccccccHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHcccccccccccccccccccHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHEEEEECccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHEEEEEcccccccccccccccHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHccccccccccccc

*W**N**DALSR*******************LARVLGLTDLTLLGIGATLGVGVYVLAGSVAKNQAGPSVVISFIIAALASALSGLCYVEFASRISKSGSAYNYTYLSIGEFAAYIIGWNLELFIEVQAFCIEFSRIREAAALFRLLKQLESGGGETSTLTTDRYSFLSTYPDFIAAGIVMLMSALISWGVSESTRLNSVFTFLNLGTVVVIVGSGLFKMNPRNWAIRKEDIPRTVRHGGTGGFAPFGLNGIIVGAAKCFFGFVGFDCIATTGEESKNPKRDIPLSILLSLFIVFVCYLAIAIVLTLIIPYYEQDAEAPFPHIFDSLGWPVMKWLVTVGSLFALLTAMFGALFPLPRILYAMSLDGLLYDCFSYVSPRTKTPVLSSLLTGALTAVLSAVFKLDQLVDMLSIGTLLAYTIVALSVLILRYSE********************SFAEKDINAKNFSVNALPEETLDPNSQSALTGGPVPTSDCTSALQYATFTLLGLVYTVVFVCLARQNQNRARLKFKVPWVPLVPCLSIFMNIYLMINLDISTWVRFVIWLVIGFGIYFTYGIS**********

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHxxxxxHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHxxxxxxxxHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxx

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Low affinity cationic amino acid transporter 2	Low-affinity, high capacity permease involved in the transport of the cationic amino acids (arginine, lysine and ornithine). Plays a regulatory role in classical or alternative activation of macrophages.	confident	P18581
Low affinity cationic amino acid transporter 2	Low-affinity, high capacity permease involved in the transport of the cationic amino acids (arginine, lysine and ornithine). Plays a regulatory role in classical or alternative activation of macrophages.	confident	P52569
Cationic amino acid transporter 4, vacuolar	Permease involved in the transport of the cationic amino acids.	confident	Q8W4K3

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0006865 [BP]	amino acid transport	confident	GO:0044765, GO:0015849, GO:0006811, GO:0006810, GO:0015711, GO:0071705, GO:0006820, GO:0008150, GO:0071702, GO:0051234, GO:0051179, GO:0044699, GO:0046942
GO:0015822 [BP]	ornithine transport	probable	GO:0006810, GO:0006820, GO:0071702, GO:0006812, GO:0006811, GO:0006865, GO:0015711, GO:0071705, GO:0044765, GO:0008150, GO:0015849, GO:0051234, GO:0051179, GO:0044699, GO:0046942
GO:0000064 [MF]	L-ornithine transmembrane transporter activity	probable	GO:0022891, GO:0022892, GO:0005342, GO:0008514, GO:0005215, GO:0008509, GO:0008324, GO:0015075, GO:0022857, GO:0003674, GO:0015179, GO:0015171, GO:0046943
GO:0015807 [BP]	L-amino acid transport	probable	GO:0006810, GO:0044765, GO:0015849, GO:0006811, GO:0006865, GO:0015711, GO:0071705, GO:0006820, GO:0008150, GO:0071702, GO:0051234, GO:0051179, GO:0044699, GO:0046942
GO:0005886 [CC]	plasma membrane	probable	GO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623
GO:0015326 [MF]	cationic amino acid transmembrane transporter activity	probable	GO:0022891, GO:0022892, GO:0005342, GO:0008514, GO:0005215, GO:0008509, GO:0008324, GO:0015075, GO:0022857, GO:0003674, GO:0015171, GO:0046943
GO:0006629 [BP]	lipid metabolic process	probable	GO:0044238, GO:0044710, GO:0008150, GO:0008152, GO:0071704
GO:0003333 [BP]	amino acid transmembrane transport	probable	GO:0006810, GO:0006820, GO:0015849, GO:0006811, GO:0006865, GO:0015711, GO:0051179, GO:0071705, GO:0034220, GO:0044765, GO:0044763, GO:0071702, GO:0008150, GO:0009987, GO:0051234, GO:0055085, GO:0044699, GO:0046942
GO:0015819 [BP]	lysine transport	probable	GO:0006810, GO:0006820, GO:0071702, GO:0006812, GO:0006811, GO:0006865, GO:0015711, GO:0071705, GO:0044765, GO:0008150, GO:0015802, GO:0015849, GO:0051234, GO:0051179, GO:0044699, GO:0046942
GO:0015189 [MF]	L-lysine transmembrane transporter activity	probable	GO:0022891, GO:0022892, GO:0005342, GO:0008514, GO:0005215, GO:0008509, GO:0008324, GO:0015075, GO:0022857, GO:0003674, GO:0015179, GO:0015174, GO:0015171, GO:0046943
GO:0019915 [BP]	lipid storage	probable	GO:0008150, GO:0033036, GO:0010876, GO:0051179
GO:0016021 [CC]	integral to membrane	probable	GO:0005575, GO:0044425, GO:0016020, GO:0031224
GO:0006807 [BP]	nitrogen compound metabolic process	probable	GO:0008150, GO:0008152
GO:0009705 [CC]	plant-type vacuole membrane	probable	GO:0005737, GO:0005575, GO:0000325, GO:0031090, GO:0005773, GO:0016020, GO:0044464, GO:0043229, GO:0005623, GO:0005774, GO:0044446, GO:0044444, GO:0044437, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0044237 [BP]	cellular metabolic process	probable	GO:0009987, GO:0008150, GO:0008152
GO:0032006 [BP]	regulation of TOR signaling cascade	probable	GO:0009966, GO:0048583, GO:0050794, GO:0065007, GO:0023051, GO:0008150, GO:0010646, GO:0050789
GO:0040007 [BP]	growth	probable	GO:0008150
GO:0015809 [BP]	arginine transport	probable	GO:0006810, GO:0006820, GO:0071702, GO:0006812, GO:0006811, GO:0006865, GO:0015711, GO:0071705, GO:0044765, GO:0008150, GO:0015802, GO:0015849, GO:0051234, GO:0051179, GO:0044699, GO:0046942
GO:0005289 [MF]	high affinity arginine transmembrane transporter activity	probable	GO:0022891, GO:0022892, GO:0005342, GO:0008514, GO:0005215, GO:0008509, GO:0008324, GO:0005287, GO:0015075, GO:0022857, GO:0003674, GO:0015174, GO:0015181, GO:0015171, GO:0046943

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3GIA, chain A
Confidence level:very confident
Coverage over the Query: 32-155,167-227,243-432
View the alignment between query and template
View the model in PyMOL

Template: 3L1L, chain A
Confidence level:very confident
Coverage over the Query: 33-228,252-432,521-579
View the alignment between query and template
View the model in PyMOL