Diaphorina citri psyllid: psy6071

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-----
MSHSNFNEQTAYKVAEELLTKTSGPGQLNHSSPLVNQYYKPEFLRLVPPLHLIWLNLVDPSEHKIAYDSTMCVSNSAGVEAKKLMTRAFKSALTLQQQQHLLAELQHDSKLVYHIGLTPAKLPDLVENNPLIAIEVLLKLIQSNHITEYFSVLVNMEMSLHSMEVVNSVLVNMEMSLHSMEVVNR
cccccccHHHHHHHHHHHHcccccccccccccccccccccccccccccccEEEEcccccccccccccccccccccccHHHHHHHHHHHHHccccHHHHHHHHHHHHcccccHHHccccccccHHHHHccHHHHHHHHHHHHccccHHHHHHHHHHccccHHHHHHHHHHHHcccccHHHHHHHcc
**********AYKVAE*****************LVNQYYKPEFLRLVPPLHLIWLNLVDPSEHKIAYDSTMCVSNSAGVEAKKLMTRAFKSALTLQQQQHLLAELQHDSKLVYHIGLTPAKLPDLVENNPLIAIEVLLKLIQSNHITEYFSVLVNMEMSLHSMEVVNSVLVNMEMSLHSMEVVNR
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSHSNFNEQTAYKVAEELLTKTSGPGQLNHSSPLVNQYYKPEFLRLVPPLHLIWLNLVDPSEHKIAYDSTMCVSNSAGVEAKKLMTRAFKSALTLQQQQHLLAELQHDSKLVYHIGLTPAKLPDLVENNPLIAIEVLLKLIQSNHITEYFSVLVNMEMSLHSMEVVNSVLVNMEMSLHSMEVVNR

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
UPF0760 protein C2orf29 homolog confidentQ9CWN7
UPF0760 protein C2orf29 confidentQ9UKZ1
UPF0760 protein C2orf29 homolog confidentB0BNA9

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0030014 [CC]CCR4-NOT complexprobableGO:0043234, GO:0032991, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1ZOQ, chain C
Confidence level:probable
Coverage over the Query: 82-112
View the alignment between query and template
View the model in PyMOL