Diaphorina citri psyllid: psy607


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------13
MQAIAHEIFGNTLKYSWRDFLIQSYEIPYPNWHQLMNMAQMATPTATLVETRGLRPFKSSEEYLYAMKEDLAEWLNNLYVELHMNVANFMDRLDTGVTLCRGKSTFFKSSIKEQRRSYCPEIADGEDRR
cHHHHHHHHHcccccHHHHHHHHHcccccccHHHHHccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHccHHHccccHHHHHHHHHHHHHHcccccccccccc
***IAHEIFGNTLKYSWRDFLIQSYEIPYPNWHQLMNMAQMATPTATLVETRGLRPFKSSEEYLYAMKEDLAEWLNNLYVELHMNVANFMDRLDTGVTLCRGKSTFFKSSIKE****************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MQAIAHEIFGNTLKYSWRDFLIQSYEIPYPNWHQLMNMAQMATPTATLVETRGLRPFKSSEEYLYAMKEDLAEWLNNLYVELHMNVANFMDRLDTGVTLCRGKSTFFKSSIKEQRRSYCPEIADGEDRR

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
GAS2-like protein 2 Seems to be involved in the cross-linking of microtubules and microfilaments.confidentQ5SSG4

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005881 [CC]cytoplasmic microtubuleprobableGO:0005737, GO:0043234, GO:0015630, GO:0032991, GO:0005575, GO:0043232, GO:0005856, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0044446, GO:0044444, GO:0044430, GO:0044424, GO:0043228, GO:0005874, GO:0043226, GO:0044422
GO:0015629 [CC]actin cytoskeletonprobableGO:0005856, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0043228, GO:0044424, GO:0043226
GO:0045746 [BP]negative regulation of Notch signaling pathwayprobableGO:0009968, GO:0009966, GO:0048585, GO:0023051, GO:0048583, GO:0050794, GO:0008150, GO:0023057, GO:0065007, GO:0010648, GO:0008593, GO:0048519, GO:0010646, GO:0050789, GO:0048523
GO:0030713 [BP]ovarian follicle cell stalk formationprobableGO:0048610, GO:0030154, GO:0048468, GO:0019953, GO:0007292, GO:0009653, GO:0044699, GO:0000904, GO:0000902, GO:0048869, GO:0071840, GO:0030707, GO:0016043, GO:0032989, GO:0007276, GO:0048477, GO:0032502, GO:0032501, GO:0048609, GO:0032504, GO:0009987, GO:0044767, GO:0022414, GO:0008150, GO:0022412, GO:0000003, GO:0044702, GO:0003006, GO:0048856, GO:0044763
GO:0051726 [BP]regulation of cell cycleprobableGO:0008150, GO:0065007, GO:0050789, GO:0050794

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3I6X, chain A
Confidence level:confident
Coverage over the Query: 48-112
View the alignment between query and template
View the model in PyMOL