Diaphorina citri psyllid: psy6080

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240

MSLRFPQKANRRPIGQIVCTAGLKNIKKPPNYDHIVMPERPRLKFVDKVPTFIYNHKTPRTTKRLDLLRGPEEIHNYLIHKQYGLVALSGGRMNYRHFETIRFAMMRKLDVKKMFAVWRVDPPWLPVTKKGLGSRMGGGKGSIDHYVTPVKTGRIIIEVGGKCSYEEVLPYLRSCASKMPFKCMPCNEDILREMKEKEEREARDNINPYTFEYMIKNNIGNCRQWISTHVDYKYFGKYFG

ccccccccccccccccEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEccccEEEEccccccccccHHHHHHHHHHcccccccccEEEEEccccccccccccccccccccccccEEEEEEcccEEEEEEcccccHHHHHHHHHHHHHccccccEEEEHHHHHHHHHHHHHHHHccccccHHHHHHHHHHccccccccccccccccccccc

*************IGQIVCTAGLKNIKKPPNYDHIVMPERPRLKFVDKVPTFIYNHK******RLDLLRGPEEIHNYLIHKQYGLVALSGGRMNYRHFETIRFAMMRKLDVKKMFAVWRVDPPWLPVTKKGL*******KGSIDHYVTPVKTGRIIIEVGGKCSYEEVLPYLRSCASKMPFKCMPCNEDIL*************NINPYTFEYMIKNNIGNCRQWISTHVDYKYFGKYFG

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
39S ribosomal protein L16, mitochondrial	Component of the large subunit of mitochondrial ribosome.	confident	Q9NX20
39S ribosomal protein L16, mitochondrial	Component of the large subunit of mitochondrial ribosome.	confident	Q5M818
39S ribosomal protein L16, mitochondrial	Component of the large subunit of mitochondrial ribosome.	confident	Q99N93

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0002119 [BP]	nematode larval development	probable	GO:0032502, GO:0032501, GO:0044707, GO:0009791, GO:0002164, GO:0008150, GO:0007275, GO:0044699
GO:0009792 [BP]	embryo development ending in birth or egg hatching	probable	GO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0044767, GO:0009790, GO:0008150, GO:0007275, GO:0044699
GO:0040010 [BP]	positive regulation of growth rate	probable	GO:0045927, GO:0040008, GO:0040009, GO:0065007, GO:0048518, GO:0008150, GO:0050789
GO:0040007 [BP]	growth	probable	GO:0008150
GO:0003735 [MF]	structural constituent of ribosome	probable	GO:0003674, GO:0005198
GO:0019843 [MF]	rRNA binding	probable	GO:0097159, GO:0003674, GO:0005488, GO:0003676, GO:1901363, GO:0003723
GO:0005762 [CC]	mitochondrial large ribosomal subunit	probable	GO:0015934, GO:0031974, GO:0043229, GO:0043228, GO:0043227, GO:0043226, GO:0005737, GO:0044446, GO:0005739, GO:0030529, GO:0005759, GO:0005761, GO:0000315, GO:0000313, GO:0044391, GO:0043231, GO:0032991, GO:0005840, GO:0043232, GO:0043233, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0070013, GO:0044444, GO:0044429, GO:0044424, GO:0044422
GO:0006412 [BP]	translation	probable	GO:0071704, GO:0044267, GO:0008152, GO:0044260, GO:0044238, GO:0019538, GO:0009987, GO:0009058, GO:0044237, GO:0043170, GO:0044249, GO:0010467, GO:0009059, GO:0008150, GO:0034645, GO:1901576

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2FTC, chain I
Confidence level:very confident
Coverage over the Query: 67-184
View the alignment between query and template
View the model in PyMOL

Template: 2ZJR, chain J
Confidence level:very confident
Coverage over the Query: 54-191
View the alignment between query and template
View the model in PyMOL

Template: 3J0L, chain J
Confidence level:very confident
Coverage over the Query: 30-190
View the alignment between query and template
View the model in PyMOL