Diaphorina citri psyllid: psy6081


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220------
MESTQEGSSVKSTPGRQDSKPYSFASLVSLPQEVNGQKIPFDSSKPNPNGMEFDNLYLDMNGIIHPCTHPEDKPAPKDEDEMMVAIFECIDRLFRIVRPRKLLYMAIDGVAPRAKMNQPLTVYSVLYDRGNYSTWQLMRSRRFRASKETAEKIAEVARIREKLLADGCILPPEKEKGSHFDSNCITPGTPFMACLSACLHYYIHDRLNNDPGWKGIKVILSDANVP
ccccccccccccccccccccccccccccccccccccEEccccccccccccccccCEEECcccccccccccccccccccHHHHHHHHHHHHHHHHHHccccEEEEEEECcccccccccccccHHHHHcccccccHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHcccccccccEEEEcccccc
*********************************VNGQKIPFDSSKPNPNGMEFDNLYLDMNGIIHPCTHPEDKPAPKDEDEMMVAIFECIDRLFRIVRPRKLLYMAIDGVAPRAKMNQPLTVYSVLYDRGNYSTWQLMRSRRFRA***TAEKIAEVARIREKLLADGCILPP*****SHFDSNCITPGTPFMACLSACLHYYIHDRLNNDPGWKGIKVILSDANV*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MESTQEGSSVKSTPGRQDSKPYSFASLVSLPQEVNGQKIPFDSSKPNPNGMEFDNLYLDMNGIIHPCTHPEDKPAPKDEDEMMVAIFECIDRLFRIVRPRKLLYMAIDGVAPRAKMNQPLTVYSVLYDRGNYSTWQLMRSRRFRASKETAEKIAEVARIREKLLADGCILPPEKEKGSHFDSNCITPGTPFMACLSACLHYYIHDRLNNDPGWKGIKVILSDANVP

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
5'-3' exoribonuclease 2 homolog Possesses 5'->3' exoribonuclease activity. May promote the termination of transcription by RNA polymerase II.confidentQ9VM71
5'-3' exoribonuclease 2 Possesses 5'->3' exoribonuclease activity. May promote the termination of transcription by RNA polymerase II. During transcription termination, cleavage at the polyadenylation site liberates a 5' fragment which is subsequently processed to form the mature mRNA and a 3' fragment which remains attached to the elongating polymerase. The processive degradation of this 3' fragment by this protein may promote termination of transcription.confidentQ5R4L5
5'-3' exoribonuclease 2 Possesses 5'->3' exoribonuclease activity. Required for the processing of nuclear mRNA and rRNA precursors. May promote termination of transcription by RNA polymerase II.confidentQ8TFZ1

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3FQD, chain A
Confidence level:very confident
Coverage over the Query: 17-119,139-226
View the alignment between query and template
View the model in PyMOL