Diaphorina citri psyllid: psy6087


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------17
MNFNTIVQWSNPSGSLLTRNLADLVKKEHFILDSEYLTTLLVVVPRNQVTEWVQNYEKLTAMIVPRSSQLVSQDQDFALYTVTLFKKVQDEFRHHAREKKFIVREFVYNEEELRNQVTEWVQNYEKLTAMIVPRSSQLVSQDQDFALYTVTLFKKVQDEFRHHAREKN
cccccHHHHHcccccccccccccccccccccccccccEEEEEEEccccHHHHHHHHHHHcccccccccccEECcccEEEEEEEEEcHHHHHHHHHHHHcccEEEEEEEcHHHHHHHHHHHHHHHHHHHccccccccccccccccEEEEEEEEEHHHHHHHHHHHHHcc
*****IVQWS*PSGSLLTRNLADLVKKEHFILDSEYLTTLLVVVPRNQVTEWVQNYEKLTAMIVPRSSQLVSQDQDFALYTVTLFKKVQDEFRHHAREKKFIVREFVYNEEELRNQVTEWVQNYEKLTAMIVPRSSQLVSQDQDFALYTVTLFKKVQDEFRHHA****
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNFNTIVQWSNPSGSLLTRNLADLVKKEHFILDSEYLTTLLVVVPRNQVTEWVQNYEKLTAMIVPRSSQLVSQDQDFALYTVTLFKKVQDEFRHHAREKKFIVREFVYNxxxxxxxxxxxxxxxxxxxxxIVPRSSQLVSQDQDFALYTVTLFKKVQDEFRHHAREKN

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
V-type proton ATPase subunit C 1 Subunit of the peripheral V1 complex of vacuolar ATPase. Subunit C is necessary for the assembly of the catalytic sector of the enzyme and is likely to have a specific function in its catalytic activity. V-ATPase is responsible for acidifying a variety of intracellular compartments in eukaryotic cells.confidentP21283
V-type proton ATPase subunit C 1 Subunit of the peripheral V1 complex of vacuolar ATPase. Subunit C is necessary for the assembly of the catalytic sector of the enzyme and is likely to have a specific function in its catalytic activity. V-ATPase is responsible for acidifying a variety of intracellular compartments in eukaryotic cells.confidentP21282
V-type proton ATPase subunit C 1 Subunit of the peripheral V1 complex of vacuolar ATPase. Subunit C is necessary for the assembly of the catalytic sector of the enzyme and is likely to have a specific function in its catalytic activity. V-ATPase is responsible for acidifying a variety of intracellular compartments in eukaryotic cells.confidentQ9Z1G3

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0015992 [BP]proton transportprobableGO:0006818, GO:0006812, GO:0006811, GO:0006810, GO:0051179, GO:0044765, GO:0008150, GO:0051234, GO:0015672, GO:0044699
GO:0045177 [CC]apical part of cellprobableGO:0005575, GO:0044464, GO:0005623
GO:0008553 [MF]hydrogen-exporting ATPase activity, phosphorylative mechanismprobableGO:0003674, GO:0016887, GO:0042625, GO:0042626, GO:0016820, GO:0042623, GO:0015077, GO:0015399, GO:0022804, GO:0016787, GO:0005215, GO:0008324, GO:0017111, GO:0003824, GO:0022891, GO:0022890, GO:0016818, GO:0022892, GO:0043492, GO:0016817, GO:0019829, GO:0015075, GO:0016462, GO:0022857, GO:0015078, GO:0015662, GO:0015405
GO:0007275 [BP]multicellular organismal developmentprobableGO:0032502, GO:0032501, GO:0008150, GO:0044699, GO:0044707
GO:0016469 [CC]proton-transporting two-sector ATPase complexprobableGO:0043234, GO:0044425, GO:0016020, GO:0032991, GO:0005575
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0006200 [BP]ATP catabolic processprobableGO:0046434, GO:0009141, GO:0009143, GO:0009144, GO:0009146, GO:0009166, GO:0009164, GO:0006807, GO:0044237, GO:0072521, GO:0072523, GO:0046130, GO:0009259, GO:1901360, GO:1901361, GO:0046700, GO:0006139, GO:1901575, GO:0006195, GO:0042278, GO:0071704, GO:0009199, GO:0006152, GO:0046483, GO:0044281, GO:0009207, GO:0009205, GO:0009987, GO:0009203, GO:0044238, GO:0046034, GO:0009154, GO:0006725, GO:0044710, GO:0009150, GO:0009261, GO:0019637, GO:0009117, GO:0009116, GO:0008152, GO:0034655, GO:0009119, GO:0046128, GO:0009056, GO:0055086, GO:0042454, GO:0044248, GO:1901564, GO:0044270, GO:1901136, GO:1901135, GO:0034641, GO:0019693, GO:0006163, GO:1901657, GO:0006796, GO:1901292, GO:0006793, GO:0019439, GO:0008150, GO:0006753, GO:1901658, GO:1901565
GO:0050794 [BP]regulation of cellular processprobableGO:0008150, GO:0065007, GO:0050789
GO:0034220 [BP]ion transmembrane transportprobableGO:0009987, GO:0006811, GO:0006810, GO:0051179, GO:0044765, GO:0044763, GO:0008150, GO:0051234, GO:0055085, GO:0044699
GO:0031410 [CC]cytoplasmic vesicleprobableGO:0005737, GO:0031982, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043226
GO:0005886 [CC]plasma membraneprobableGO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1U7L, chain A
Confidence level:very confident
Coverage over the Query: 2-120
View the alignment between query and template
View the model in PyMOL
Template: 1U7L, chain A
Confidence level:very confident
Coverage over the Query: 114-168
View the alignment between query and template
View the model in PyMOL