Diaphorina citri psyllid: psy6101


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-
MTVYATPRSQHAKPPSQAQSACEQHTNLMKPDLSKVQSQPLDRSRGGGRGCRLGDFRHWLSNSGMNEDLLKQYDQLINLPSNDWDIYYWATGVRPIPLQFNNEVMKLLQDHTKNKDRQARLRQPDLYETLLTLQHLGIKFYGSFGIRSRALLLDRRYCWLSHFDLCHGILISSDSNLSWNVDLEQQSPVYENVEEEPVLTSLVFCGSQIVKNSVRSMSKEIFPPSQEPEIPAYQERVGEPLELRKARLLYQSRKRGMLENGLLLSTFAAKYLDTMNEDLLKQYDQLINLPSNDWDIYYWATGVRPIPLQFNNEVMKLLQDHTKNKDRQARLRQPDLYETVS
ccccccccccccccccccccccccccccccccHHHHHHHHHHHccccccHHHHHHHHHHHHcccccHHHHHHHHHHHcccccccHHHHHHccccccccccHHHHHHHHHHHHHcccccccccccccHHHHHHHHHcccEEcccccccHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHcccccccHHHHHHHHHHHHcccccHHHHHHHHHHHcccccccHHHHHHccccccccccHHHHHHHHHHHHHcccccccccccccccccc
************************************QSQPLDRSRGGGRGCRLGDFRHWLSNSGMNEDLLKQYDQLINLPSNDWDIYYWATGVRPIPLQFNNEVMKLLQDHTK********RQPDLYETLLTLQHLGIKFYGSFGIRSRALLLDRRYCWLSHFDLCHGILISSDSNLSWNVDLEQQSPVYENVEEEPVLTSLVFCGSQIVK***********************************RLLYQSRKRGMLENGLLLSTFAAKYLDTMNEDLLKQYDQLINLPSNDWDIYYWATGVRPIPLQFNNEVMKLLQDHTK******************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTVYATPRSQHAKPPSQAQSACEQHTNLMKPDLSKVQSQPLDRSRGGGRGCRLGDFRHWLSNSGMNEDLLKQYDQLINLPSNDWDIYYWATGVRPIPLQFNNEVMKLLQDHTKNKDRQARLRQPDLYETLLTLQHLGIKFYGSFGIRSRALLLDRRYCWLSHFDLCHGILISSDSNLSWNVDLEQQSPVYENVEEEPVLTSLVFCGSQIVKNSVRSMSKEIFPPSQEPEIPAYQERVGEPLELRKARLLYQSRKRGMLENGLLLSTFAAKYLDTMNEDLLKQYDQLINLPSNDWDIYYWATGVRPIPLQFNNEVMKLLQDHTKNKDRQARLRQPDLYETVS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Succinate dehydrogenase assembly factor 2, mitochondrial Required for insertion of FAD cofactor into SDHA, the catalytic subunit of succinate dehydrogenase (SDH). SDH is involved in complex II of the mitochondrial electron transport chain and is responsible for transferring electrons from succinate to ubiquinone (coenzyme Q). In is unclear whether it participates in the chemistry of FAD attachment (enzymatic function) or acts as a chaperone that maintains SDHA in a conformation that is susceptible to autocatalytic FAD attachment.confidentQ3ZBC2
Succinate dehydrogenase assembly factor 2, mitochondrial Required for insertion of FAD cofactor into SDHA, the catalytic subunit of succinate dehydrogenase (SDH). SDH is involved in complex II of the mitochondrial electron transport chain and is responsible for transferring electrons from succinate to ubiquinone (coenzyme Q). In is unclear whether it participates in the chemistry of FAD attachment (enzymatic function) or acts as a chaperone that maintains SDHA in a conformation that is susceptible to autocatalytic FAD attachment.confidentQ9NX18
Succinate dehydrogenase assembly factor 2, mitochondrial Required for insertion of FAD cofactor into SDH1, the catalytic subunit of succinate dehydrogenase (SDH). SDH is involved in complex II of the mitochondrial electron transport chain and is responsible for transferring electrons from succinate to ubiquinone (coenzyme Q). In is unclear whether it participates in the chemistry of FAD attachment (enzymatic function) or acts as a chaperone that maintains SDH1 in a conformation that is susceptible to autocatalytic FAD attachment. Involved in sporulation. Required for the full activation of the early meiotic inducer IME1.confidentQ08230

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005730 [CC]nucleolusprobableGO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0005739 [CC]mitochondrionprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0006121 [BP]mitochondrial electron transport, succinate to ubiquinoneprobableGO:0044710, GO:0015980, GO:0006793, GO:0016310, GO:0009987, GO:0044237, GO:0006796, GO:0022900, GO:0045333, GO:0008152, GO:0022904, GO:0008150, GO:0006091, GO:0042775, GO:0042773, GO:0055114, GO:0006119
GO:0018293 [BP]protein-FAD linkageprobableGO:0044267, GO:0044260, GO:0044238, GO:0019538, GO:0009987, GO:0018065, GO:0006464, GO:0043170, GO:0071704, GO:0043412, GO:0036211, GO:0008150, GO:0044237, GO:0008152

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2LM4, chain A
Confidence level:very confident
Coverage over the Query: 234-328
View the alignment between query and template
View the model in PyMOL
Template: 2LM4, chain A
Confidence level:very confident
Coverage over the Query: 29-119
View the alignment between query and template
View the model in PyMOL