Diaphorina citri psyllid: psy6103


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-----
MAEMKHESDDMQCGNHQNSNSKVHEADACLVLANKYCQDPDAEDAANIMRVISIKNYSDDIRVIIQLMQYHNKAYLLNIPSWDWKQGDDVICLAELKLGFIAQSCLAPGFSTMMANLFAMRSFKT
cccccccccccccccccccccccccccEEEEEcccccccccHHHHHHHHHHHHHHHccccccEEEEEcccccHHHHccccccccccccCEEEHHHHHHHHHHHHcccccHHHHHHHHHHcccccc
*************GNHQNSNSKVHEADACLVLANKYCQDPDAEDAANIMRVISIKNYSDDIRVIIQLMQYHNKAYLLNIPSWDWKQGDDVICLAELKLGFIAQSCLAPGFSTMMANLFAMR****
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAEMKHESDDMQCGNHQNSNSKVHEADACLVLANKYCQDPDAEDAANIMRVISIKNYSDDIRVIIQLMQYHNKAYLLNIPSWDWKQGDDVICLAELKLGFIAQSCLAPGFSTMMANLFAMRSFKT

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Calcium-activated potassium channel slowpoke Potassium channel activated by both membrane depolarization or increase in cytosolic Ca(2+) that mediates export of K(+). Its activation dampens the excitatory events that elevate the cytosolic Ca(2+) concentration and/or depolarize the cell membrane. It therefore contributes to repolarization of the membrane potential. Kinetics are determined by alternative splicing, phosphorylation status and its combination interaction with Slob and 14-3-3-zeta. While the interaction with Slob1 alone increases its activity, its interaction with both Slob1 and 14-3-3-zeta decreases its activity.very confidentQ03720
Calcium-activated potassium channel subunit alpha-1 Potassium channel activated by both membrane depolarization or increase in cytosolic Ca(2+) that mediates export of K(+). It is also activated by the concentration of cytosolic Mg(2+). Its activation dampens the excitatory events that elevate the cytosolic Ca(2+) concentration and/or depolarize the cell membrane. It therefore contributes to repolarization of the membrane potential. Plays a key role in controlling excitability in a number of systems, such as regulation of the contraction of smooth muscle, the tuning of hair cells in the cochlea, regulation of transmitter release, and innate immunity. In smooth muscles, its activation by high level of Ca(2+), caused by ryanodine receptors in the sarcoplasmic reticulum, regulates the membrane potential. In cochlea cells, its number and kinetic properties partly determine the characteristic frequency of each hair cell and thereby helps to establish a tonotopic map. Highly sensitive to both iberiotoxin (IbTx) and charybdotoxin (CTX).confidentQ8AYS8
Calcium-activated potassium channel subunit alpha-1 Potassium channel activated by both membrane depolarization or increase in cytosolic Ca(2+) that mediates export of K(+). It is also activated by the concentration of cytosolic Mg(2+). Its activation dampens the excitatory events that elevate the cytosolic Ca(2+) concentration and/or depolarize the cell membrane. It therefore contributes to repolarization of the membrane potential. Plays a key role in controlling excitability in a number of systems, such as regulation of the contraction of smooth muscle, the tuning of hair cells in the cochlea, regulation of transmitter release, and innate immunity. In smooth muscles, its activation by high level of Ca(2+), caused by ryanodine receptors in the sarcoplasmic reticulum, regulates the membrane potential. In cochlea cells, its number and kinetic properties partly determine the characteristic frequency of each hair cell and thereby helps to establish a tonotopic map. Kinetics of KCNMA1 channels are determined by alternative splicing, phosphorylation status and its combination with modulating beta subunits. Highly sensitive to both iberiotoxin (IbTx) and charybdotoxin (CTX).confidentQ62976

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0043025 [CC]neuronal cell bodyconfidentGO:0005575, GO:0097458, GO:0044297, GO:0005623, GO:0044464
GO:0016020 [CC]membraneconfidentGO:0005575
GO:0005515 [MF]protein bindingconfidentGO:0003674, GO:0005488
GO:0045202 [CC]synapseconfidentGO:0005575
GO:0042221 [BP]response to chemical stimulusconfidentGO:0050896, GO:0008150
GO:0044444 [CC]cytoplasmic partconfidentGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424
GO:0043005 [CC]neuron projectionconfidentGO:0005575, GO:0097458, GO:0042995, GO:0044464, GO:0005623
GO:0001666 [BP]response to hypoxiaprobableGO:0009628, GO:0036293, GO:0050896, GO:0006950, GO:0008150, GO:0070482
GO:0003779 [MF]actin bindingprobableGO:0003674, GO:0005488, GO:0005515, GO:0008092
GO:0009268 [BP]response to pHprobableGO:0009628, GO:0050896, GO:0008150
GO:0016324 [CC]apical plasma membraneprobableGO:0045177, GO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0071944, GO:0005886, GO:0044425, GO:0044459
GO:0045211 [CC]postsynaptic membraneprobableGO:0097060, GO:0044456, GO:0016020, GO:0005575, GO:0045202
GO:0006970 [BP]response to osmotic stressprobableGO:0009628, GO:0006950, GO:0008150, GO:0050896
GO:0043065 [BP]positive regulation of apoptotic processprobableGO:0050794, GO:0050789, GO:0048518, GO:0043067, GO:0065007, GO:0010942, GO:0008150, GO:0010941, GO:0042981, GO:0043068, GO:0048522
GO:0008076 [CC]voltage-gated potassium channel complexprobableGO:0043234, GO:0032991, GO:0044459, GO:0016021, GO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0034702, GO:0034705, GO:0071944, GO:0034703, GO:0005887, GO:0005886, GO:0044425, GO:0031226, GO:0031224
GO:0005901 [CC]caveolaprobableGO:0045121, GO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0071944, GO:0005886, GO:0044425, GO:0044459
GO:0042312 [BP]regulation of vasodilationprobableGO:0008150, GO:0065007, GO:0051239, GO:0044057, GO:0050789
GO:0055120 [CC]striated muscle dense bodyprobableGO:0005737, GO:0043232, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044424, GO:0044444, GO:0043228, GO:0043292, GO:0043226, GO:0044422, GO:0044449
GO:0048787 [CC]presynaptic active zone membraneprobableGO:0097060, GO:0048786, GO:0042734, GO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0097458, GO:0044456, GO:0045202
GO:0042493 [BP]response to drugprobableGO:0042221, GO:0050896, GO:0008150
GO:0031430 [CC]M bandprobableGO:0005737, GO:0005575, GO:0043232, GO:0031672, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0030016, GO:0030017, GO:0044444, GO:0043228, GO:0043292, GO:0044424, GO:0043226, GO:0044422, GO:0044449
GO:0007268 [BP]synaptic transmissionprobableGO:0044700, GO:0019226, GO:0032501, GO:0044707, GO:0035637, GO:0050877, GO:0009987, GO:0008150, GO:0044763, GO:0023052, GO:0007267, GO:0007154, GO:0044699, GO:0003008
GO:0043627 [BP]response to estrogen stimulusprobableGO:0009719, GO:0033993, GO:0050896, GO:0008150, GO:0048545, GO:0009725, GO:0042221, GO:0010033, GO:0014070
GO:0043195 [CC]terminal boutonprobableGO:0044306, GO:0043679, GO:0044463, GO:0044464, GO:0005623, GO:0030424, GO:0005575, GO:0097458, GO:0044456, GO:0045202, GO:0043005, GO:0033267, GO:0042995
GO:0005783 [CC]endoplasmic reticulumprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0060083 [BP]smooth muscle contraction involved in micturitionprobableGO:0032501, GO:0044707, GO:0007588, GO:0014832, GO:0006939, GO:0006936, GO:0003012, GO:0060073, GO:0003014, GO:0014848, GO:0008150, GO:0044699, GO:0003008
GO:0045794 [BP]negative regulation of cell volumeprobableGO:0019725, GO:0006884, GO:0009987, GO:0042592, GO:0065007, GO:0044763, GO:0008150, GO:0065008, GO:0044699
GO:0042803 [MF]protein homodimerization activityprobableGO:0046983, GO:0003674, GO:0005515, GO:0042802, GO:0005488
GO:0051289 [BP]protein homotetramerizationprobableGO:0051259, GO:0022607, GO:0071822, GO:0070271, GO:0043933, GO:0006461, GO:0051260, GO:0051262, GO:0065003, GO:0044085, GO:0008150, GO:0016043, GO:0071840
GO:0030425 [CC]dendriteprobableGO:0044464, GO:0005623, GO:0005575, GO:0097458, GO:0043005, GO:0042995
GO:0031960 [BP]response to corticosteroid stimulusprobableGO:0009719, GO:0033993, GO:0050896, GO:0008150, GO:0048545, GO:0009725, GO:0042221, GO:0010033, GO:0014070
GO:0051592 [BP]response to calcium ionprobableGO:0042221, GO:0050896, GO:0010035, GO:0008150, GO:0010038
GO:0048471 [CC]perinuclear region of cytoplasmprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0005249 [MF]voltage-gated potassium channel activityprobableGO:0005267, GO:0005261, GO:0003674, GO:0015077, GO:0022843, GO:0022803, GO:0046873, GO:0005215, GO:0005216, GO:0008324, GO:0022891, GO:0022890, GO:0022892, GO:0005244, GO:0015075, GO:0022832, GO:0022857, GO:0015267, GO:0022836, GO:0022839, GO:0022838, GO:0015079
GO:0030007 [BP]cellular potassium ion homeostasisprobableGO:0019725, GO:0008150, GO:0006875, GO:0050801, GO:0009987, GO:0006873, GO:0048878, GO:0042592, GO:0030004, GO:0065007, GO:0055075, GO:0055067, GO:0030003, GO:0055065, GO:0055080, GO:0044763, GO:0055082, GO:0065008, GO:0044699
GO:0007596 [BP]blood coagulationprobableGO:0032501, GO:0007599, GO:0044707, GO:0050878, GO:0050896, GO:0009611, GO:0042060, GO:0006950, GO:0050817, GO:0008150, GO:0065007, GO:0065008, GO:0044699
GO:0000166 [MF]nucleotide bindingprobableGO:0097159, GO:0036094, GO:0003674, GO:0005488, GO:1901363, GO:1901265
GO:0009897 [CC]external side of plasma membraneprobableGO:0009986, GO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0071944, GO:0005886, GO:0044425, GO:0044459
GO:0007628 [BP]adult walking behaviorprobableGO:0007626, GO:0032501, GO:0044707, GO:0030534, GO:0044708, GO:0050896, GO:0007610, GO:0008150, GO:0008344, GO:0044699
GO:0048149 [BP]behavioral response to ethanolprobableGO:1901700, GO:0030534, GO:0032501, GO:0044707, GO:0044708, GO:0050896, GO:0007610, GO:0045471, GO:0008150, GO:0042221, GO:0097305, GO:0010033, GO:0044699
GO:0046928 [BP]regulation of neurotransmitter secretionprobableGO:0032879, GO:0051046, GO:0060341, GO:0010646, GO:0051049, GO:0050794, GO:0008150, GO:0031644, GO:0044057, GO:0065007, GO:0051239, GO:0023051, GO:0051588, GO:0051969, GO:0050804, GO:0050789
GO:0040011 [BP]locomotionprobableGO:0008150
GO:0060072 [MF]large conductance calcium-activated potassium channel activityprobableGO:0022891, GO:0022890, GO:0005267, GO:0022892, GO:0005261, GO:0005215, GO:0005216, GO:0008324, GO:0022857, GO:0005227, GO:0015075, GO:0046873, GO:0015077, GO:0015267, GO:0003674, GO:0022836, GO:0022803, GO:0022839, GO:0022838, GO:0015079, GO:0015269
GO:0071805 [BP]potassium ion transmembrane transportprobableGO:0006810, GO:0071804, GO:0006813, GO:0006812, GO:0006811, GO:0009987, GO:0015672, GO:0008150, GO:0034220, GO:0044765, GO:0044763, GO:0030001, GO:0051179, GO:0051234, GO:0055085, GO:0044699
GO:0032403 [MF]protein complex bindingprobableGO:0003674, GO:0005488, GO:0005515
GO:0042491 [BP]auditory receptor cell differentiationprobableGO:0044707, GO:0030154, GO:0032501, GO:0060113, GO:0008544, GO:0007275, GO:0044699, GO:0035315, GO:0048869, GO:0008150, GO:0048513, GO:0043583, GO:0030855, GO:0032502, GO:0009987, GO:0030182, GO:0060429, GO:0048699, GO:0009888, GO:0044767, GO:0044763, GO:0022008, GO:0048839, GO:0007399, GO:0007423, GO:0009913, GO:0048856, GO:0042490, GO:0048731
GO:0045475 [BP]locomotor rhythmprobableGO:0007626, GO:0007623, GO:0007622, GO:0044708, GO:0050896, GO:0007610, GO:0048511, GO:0048512, GO:0008150, GO:0044699
GO:0043050 [BP]pharyngeal pumpingprobableGO:0007631, GO:0050896, GO:0008150, GO:0042755, GO:0007610
GO:0019228 [BP]regulation of action potential in neuronprobableGO:0042391, GO:0019226, GO:0035637, GO:0050801, GO:0042592, GO:0023052, GO:0001508, GO:0044699, GO:0065007, GO:0065008, GO:0019725, GO:0032501, GO:0050877, GO:0009987, GO:0006873, GO:0008150, GO:0007154, GO:0055082, GO:0003008, GO:0044700, GO:0044707, GO:0048878, GO:0044763
GO:0048469 [BP]cell maturationprobableGO:0032502, GO:0048856, GO:0048869, GO:0030154, GO:0048468, GO:0044767, GO:0044763, GO:0008150, GO:0009987, GO:0010259, GO:0044699
GO:0060087 [BP]relaxation of vascular smooth muscleprobableGO:0006940, GO:0003012, GO:0003013, GO:0003018, GO:0042311, GO:0045986, GO:0044557, GO:0050789, GO:0044699, GO:0050880, GO:0044057, GO:0051241, GO:0090066, GO:0065007, GO:0048519, GO:0065008, GO:0035150, GO:0045932, GO:0006937, GO:0008015, GO:0032501, GO:0008150, GO:0090257, GO:0051239, GO:0003008, GO:0044707, GO:0090075
GO:0046872 [MF]metal ion bindingprobableGO:0043169, GO:0003674, GO:0005488, GO:0043167
GO:0007605 [BP]sensory perception of soundprobableGO:0032501, GO:0044707, GO:0050954, GO:0007600, GO:0008150, GO:0050877, GO:0044699, GO:0003008
GO:0050885 [BP]neuromuscular process controlling balanceprobableGO:0032501, GO:0044707, GO:0050877, GO:0008150, GO:0050905, GO:0044699, GO:0003008
GO:0034765 [BP]regulation of ion transmembrane transportprobableGO:0051049, GO:0050794, GO:0065007, GO:0034762, GO:0008150, GO:0032879, GO:0050789, GO:0043269
GO:0046541 [BP]saliva secretionprobableGO:0051234, GO:0046903, GO:0032501, GO:0022600, GO:0050878, GO:0044707, GO:0007589, GO:0007586, GO:0006810, GO:0044765, GO:0032941, GO:0008150, GO:0065007, GO:0065008, GO:0051179, GO:0044699, GO:0003008
GO:0034465 [BP]response to carbon monoxideprobableGO:1901700, GO:0042221, GO:0050896, GO:0008150, GO:0010033
GO:0032344 [BP]regulation of aldosterone metabolic processprobableGO:0080090, GO:0019222, GO:0019216, GO:0019218, GO:0032350, GO:0031323, GO:0010565, GO:0050794, GO:0065007, GO:0008150, GO:0050789
GO:0060082 [BP]eye blink reflexprobableGO:0008150, GO:0050896, GO:0060004, GO:0009605
GO:0045214 [BP]sarcomere organizationprobableGO:0022607, GO:0031032, GO:0030154, GO:0048468, GO:0030036, GO:0010927, GO:0051146, GO:0061061, GO:0009653, GO:0044699, GO:0048869, GO:0016043, GO:0032989, GO:0071840, GO:0048646, GO:0032502, GO:0055001, GO:0055002, GO:0030029, GO:0030239, GO:0009987, GO:0044767, GO:0044763, GO:0070925, GO:0006996, GO:0007010, GO:0048856, GO:0044085, GO:0008150, GO:0042692

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3MT5, chain A
Confidence level:very confident
Coverage over the Query: 10-123
View the alignment between query and template
View the model in PyMOL