Diaphorina citri psyllid: psy6106


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------
MVMEVTPSPQCVGREFVRQYYTLLNQAPAHLHRVGREFVRQYYTLLNQAPAHLHRFYSENSLFIHGGLDAPNRETKQVVGQEQIHEHIQQLNFRDCHAKIRQVDSQATLGNGVVVQVSGELSNGGQPMRRFTQTFVLAAQSPKKYYVHNDIFRYQDFLVDEEADLSRSDGEDDVDSL
cccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHccccHHHHccccccccEECcccccccccccEEccHHHHHHHHHHcccccEEEEEEEEEEEECccccEEEEEEEEECccccccccEEEEEEEEECccccEEEEccEEEEEcccccccccccccccccccccc
**********CVGREFVRQYYTLLNQAPAHLHRVGREFVRQYYTLLNQAPAHLHRFYSENSLFIHGGLDAPNRETKQVVGQEQIHEHIQQLNFRDCHAKIRQVDSQATLGNGVVVQVSGELSNGGQPMRRFTQTFVLAAQSPKKYYVHNDIFRYQDFLV******************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVMEVTPSPQCVGREFVRQYYTLLNQAPAHLHRVGREFVRQYYTLLNQAPAHLHRFYSENSLFIHGGLDAPNRETKQVVGQEQIHEHIQQLNFRDCHAKIRQVDSQATLGNGVVVQVSGELSNGGQPMRRFTQTFVLAAQSPKKYYVHNDIFRYQDFLVDEEADLSRSDGEDDVDSL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Ras GTPase-activating protein-binding protein 2 Probable scaffold protein that may be involved in mRNA transport.confidentQ5R9L3
Ras GTPase-activating protein-binding protein 2 Probable scaffold protein that may be involved in mRNA transport.confidentP97379
Ras GTPase-activating protein-binding protein 2 Probable scaffold protein that may be involved in mRNA transport.confidentQ9UN86

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0071011 [CC]precatalytic spliceosomeprobableGO:0005575, GO:0032991, GO:0043231, GO:0005634, GO:0044464, GO:0005623, GO:0030529, GO:0044446, GO:0043229, GO:0044428, GO:0044422, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0005681
GO:0071013 [CC]catalytic step 2 spliceosomeprobableGO:0005575, GO:0032991, GO:0043231, GO:0005634, GO:0044464, GO:0005623, GO:0030529, GO:0044446, GO:0043229, GO:0044428, GO:0044422, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0005681
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0005811 [CC]lipid particleprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0001752 [BP]compound eye photoreceptor fate commitmentprobableGO:0046552, GO:0048749, GO:0044707, GO:0030154, GO:0009653, GO:0042706, GO:0044699, GO:0001745, GO:0048869, GO:0007275, GO:0048513, GO:0032502, GO:0009887, GO:0032501, GO:0048663, GO:0030182, GO:0048592, GO:0009987, GO:0044767, GO:0001654, GO:0048731, GO:0001754, GO:0022008, GO:0001751, GO:0048699, GO:0045165, GO:0007399, GO:0007423, GO:0048856, GO:0044763, GO:0046530, GO:0008150
GO:0006886 [BP]intracellular protein transportprobableGO:0033036, GO:0034613, GO:0046907, GO:0070727, GO:0006810, GO:0045184, GO:0008104, GO:0044763, GO:0044699, GO:0071702, GO:0015031, GO:0008150, GO:0009987, GO:0051234, GO:0051179, GO:0051649, GO:0051641
GO:0044765 [BP]single-organism transportprobableGO:0051234, GO:0006810, GO:0008150, GO:0051179, GO:0044699
GO:0010494 [CC]cytoplasmic stress granuleprobableGO:0005737, GO:0035770, GO:0043232, GO:0044464, GO:0043229, GO:0005623, GO:0030529, GO:0005575, GO:0044444, GO:0043228, GO:0044424, GO:0032991, GO:0005622, GO:0043226
GO:0005515 [MF]protein bindingprobableGO:0003674, GO:0005488
GO:0007265 [BP]Ras protein signal transductionprobableGO:0044700, GO:0051716, GO:0050896, GO:0009987, GO:0050794, GO:0008150, GO:0065007, GO:0044763, GO:0007165, GO:0023052, GO:0007154, GO:0035556, GO:0007264, GO:0050789, GO:0044699
GO:0009966 [BP]regulation of signal transductionprobableGO:0048583, GO:0050794, GO:0065007, GO:0023051, GO:0008150, GO:0010646, GO:0050789
GO:0005635 [CC]nuclear envelopeprobableGO:0005575, GO:0005623, GO:0005634, GO:0044464, GO:0031967, GO:0031975, GO:0044446, GO:0043229, GO:0044428, GO:0012505, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0016482 [BP]cytoplasmic transportprobableGO:0009987, GO:0046907, GO:0006810, GO:0044763, GO:0051649, GO:0008150, GO:0051234, GO:0051179, GO:0044699, GO:0051641
GO:0006913 [BP]nucleocytoplasmic transportprobableGO:0051169, GO:0009987, GO:0046907, GO:0006810, GO:0044763, GO:0051649, GO:0008150, GO:0051234, GO:0051179, GO:0044699, GO:0051641
GO:0016318 [BP]ommatidial rotationprobableGO:0048749, GO:0060429, GO:0007163, GO:0007164, GO:0009653, GO:0007275, GO:0044699, GO:0007389, GO:0001745, GO:0008150, GO:0048513, GO:0048729, GO:0032502, GO:0009887, GO:0032501, GO:0002009, GO:0042067, GO:0048592, GO:0009987, GO:0009888, GO:0044767, GO:0001738, GO:0001654, GO:0048731, GO:0001736, GO:0007423, GO:0044707, GO:0048856, GO:0044763
GO:0003729 [MF]mRNA bindingprobableGO:0097159, GO:0003674, GO:0005488, GO:0003676, GO:1901363, GO:0003723

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3UJM, chain A
Confidence level:very confident
Coverage over the Query: 10-22,45-155
View the alignment between query and template
View the model in PyMOL
Template: 2QIY, chain A
Confidence level:very confident
Coverage over the Query: 32-157
View the alignment between query and template
View the model in PyMOL