Psyllid ID: psy6106

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------
MVMEVTPSPQCVGREFVRQYYTLLNQAPAHLHRVGREFVRQYYTLLNQAPAHLHRFYSENSLFIHGGLDAPNRETKQVVGQEQIHEHIQQLNFRDCHAKIRQVDSQATLGNGVVVQVSGELSNGGQPMRRFTQTFVLAAQSPKKYYVHNDIFRYQDFLVDEEADLSRSDGEDDVDSL
cccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHcccHHHHHccccccccEEEcccccccccccEEccHHHHHHHHHHcccccEEEEEEEEEEEEEccccEEEEEEEEEEccccccccEEEEEEEEEEccccEEEEccEEEEEcccccccccccccccccccccc
ccEEEccccccccHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHccHHHHHHcccccEEEcccccccccEccEEEcHHHHHHHHHHccccccEEEEEEEcccccccccEEEEEEEEEccccccccEEEEEEEEcccccccEEEEccHHEEHcccccccccccccccHHHHccc
mvmevtpspqcvgreFVRQYYTLLNQAPAHLHRVGREFVRQYYTLLNQapahlhrfysenslfihggldapnretkqvVGQEQIHEHIQQLNFRDCHAKIRqvdsqatlgNGVVVQVSgelsnggqpmrRFTQTFVLAAqspkkyyvhndifryqdflvdeeadlsrsdgeddvdsl
mvmevtpspqcvgREFVRQYYTLLNQAPAHLHRVGREFVRQYYTLLNQAPAHLHRFYSENSLFIHGGLDAPNRETKQVVGQEQIHEHIQQLNFRDCHAKIRQVDSQATLGNGVVVQVSGelsnggqpMRRFTQTFVLAAQSPKKYYVHNDIFRYQDFLVDEEadlsrsdgeddvdsl
MVMEVTPSPQCVGREFVRQYYTLLNQAPAHLHRVGREFVRQYYTLLNQAPAHLHRFYSENSLFIHGGLDAPNRETKQVVGQEQIHEHIQQLNFRDCHAKIRQVDSQATLGNGVVVQVSGELSNGGQPMRRFTQTFVLAAQSPKKYYVHNDIFRYQDFLVDEEADLSRSDGEDDVDSL
**********CVGREFVRQYYTLLNQAPAHLHRVGREFVRQYYTLLNQAPAHLHRFYSENSLFIHGGLDAPNRETKQVVGQEQIHEHIQQLNFRDCHAKIRQVDSQATLGNGVVVQVSGELSNGGQPMRRFTQTFVLAAQSPKKYYVHNDIFRYQDFLVD*****************
*******************************HRVGREFVRQYYTLLNQAPAHLHRFYSENSLFIHGGLDAPNRETKQVVGQEQIHEHIQQLNFRDCHAKIRQVDSQATLGNGVVVQVSGELSNGGQPMRRFTQTFVLAAQSPKKYYVHNDIFRYQDFLV******************
********PQCVGREFVRQYYTLLNQAPAHLHRVGREFVRQYYTLLNQAPAHLHRFYSENSLFIHGGLDAPNRETKQVVGQEQIHEHIQQLNFRDCHAKIRQVDSQATLGNGVVVQVSGELSNGGQPMRRFTQTFVLAAQSPKKYYVHNDIFRYQDFLVDEE***************
*VMEVTPSPQCVGREFVRQYYTLLNQAPAHLHRVGREFVRQYYTLLNQAPAHLHRFYSENSLFIHGGLDAPNRETKQVVGQEQIHEHIQQLNFRDCHAKIRQVDSQATLGNGVVVQVSGELSNGGQPMRRFTQTFVLAAQSPKKYYVHNDIFRYQDFL*******************
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVMEVTPSPQCVGREFVRQYYTLLNQAPAHLHRVGREFVRQYYTLLNQAPAHLHRFYSENSLFIHGGLDAPNRETKQVVGQEQIHEHIQQLNFRDCHAKIRQVDSQATLGNGVVVQVSGELSNGGQPMRRFTQTFVLAAQSPKKYYVHNDIFRYQDFLVDEEADLSRSDGEDDVDSL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query177 2.2.26 [Sep-21-2011]
P97379 482 Ras GTPase-activating pro yes N/A 0.694 0.255 0.624 3e-41
Q5R9L3 482 Ras GTPase-activating pro yes N/A 0.694 0.255 0.624 3e-41
Q9UN86 482 Ras GTPase-activating pro yes N/A 0.694 0.255 0.624 3e-41
Q32LC7 465 Ras GTPase-activating pro no N/A 0.694 0.264 0.624 2e-39
Q5RB87 466 Ras GTPase-activating pro no N/A 0.694 0.263 0.624 2e-39
Q13283 466 Ras GTPase-activating pro no N/A 0.694 0.263 0.624 2e-39
P97855 465 Ras GTPase-activating pro no N/A 0.694 0.264 0.624 4e-39
O94260 434 Putative G3BP-like protei yes N/A 0.661 0.269 0.454 2e-23
Q86HW7127 Nuclear transport factor yes N/A 0.627 0.874 0.295 5e-07
Q5ZLH0141 NTF2-related export prote no N/A 0.638 0.801 0.294 1e-06
>sp|P97379|G3BP2_MOUSE Ras GTPase-activating protein-binding protein 2 OS=Mus musculus GN=G3bp2 PE=1 SV=2 Back     alignment and function desciption
 Score =  167 bits (424), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 78/125 (62%), Positives = 94/125 (75%), Gaps = 2/125 (1%)

Query: 34  VGREFVRQYYTLLNQAPAHLHRFYSENSLFIHGGLDAPNRETKQVVGQEQIHEHIQQLNF 93
           VGREFVRQYYTLLN+AP +LHRFY  NS ++HGG+DA  +  + V GQ  IH  +  LNF
Sbjct: 11  VGREFVRQYYTLLNKAPEYLHRFYGRNSSYVHGGVDASGKPQEAVYGQNDIHHKVLSLNF 70

Query: 94  RDCHAKIRQVDSQATLGNGVVVQVSGELSNGGQPMRRFTQTFVLAAQS--PKKYYVHNDI 151
            +CH KIR VD+ ATL +GVVVQV G LSN GQP R+F QTFVLA +   P K+YVHND+
Sbjct: 71  SECHTKIRHVDAHATLSDGVVVQVMGLLSNSGQPERKFMQTFVLAPEGSVPNKFYVHNDM 130

Query: 152 FRYQD 156
           FRY+D
Sbjct: 131 FRYED 135
Probable scaffold protein that may be involved in mRNA transport.
Mus musculus (taxid: 10090)
>sp|Q5R9L3|G3BP2_PONAB Ras GTPase-activating protein-binding protein 2 OS=Pongo abelii GN=G3BP2 PE=2 SV=1 Back     alignment and function description
>sp|Q9UN86|G3BP2_HUMAN Ras GTPase-activating protein-binding protein 2 OS=Homo sapiens GN=G3BP2 PE=1 SV=2 Back     alignment and function description
>sp|Q32LC7|G3BP1_BOVIN Ras GTPase-activating protein-binding protein 1 OS=Bos taurus GN=G3BP PE=2 SV=1 Back     alignment and function description
>sp|Q5RB87|G3BP1_PONAB Ras GTPase-activating protein-binding protein 1 OS=Pongo abelii GN=G3BP1 PE=2 SV=1 Back     alignment and function description
>sp|Q13283|G3BP1_HUMAN Ras GTPase-activating protein-binding protein 1 OS=Homo sapiens GN=G3BP1 PE=1 SV=1 Back     alignment and function description
>sp|P97855|G3BP1_MOUSE Ras GTPase-activating protein-binding protein 1 OS=Mus musculus GN=G3bp1 PE=1 SV=1 Back     alignment and function description
>sp|O94260|G3BP_SCHPO Putative G3BP-like protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=nxt3 PE=1 SV=1 Back     alignment and function description
>sp|Q86HW7|NTF2_DICDI Nuclear transport factor 2 OS=Dictyostelium discoideum GN=nutf2 PE=1 SV=1 Back     alignment and function description
>sp|Q5ZLH0|NXT2_CHICK NTF2-related export protein 2 OS=Gallus gallus GN=NXT2 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query177
357602466 465 hypothetical protein KGM_21411 [Danaus p 0.864 0.329 0.697 2e-61
157110308 757 hypothetical protein AaeL_AAEL005528 [Ae 0.858 0.200 0.672 2e-60
170051648 687 rasputin [Culex quinquefasciatus] gi|167 0.864 0.222 0.676 1e-59
312383845 909 hypothetical protein AND_02863 [Anophele 0.853 0.166 0.649 1e-58
91076984 544 PREDICTED: similar to rasputin CG9412-PB 0.858 0.279 0.693 3e-57
405961406 496 Ras GTPase-activating protein-binding pr 0.870 0.310 0.621 1e-56
345494268 628 PREDICTED: LOW QUALITY PROTEIN: ras GTPa 0.757 0.213 0.740 4e-54
195113433 651 GI22064 [Drosophila mojavensis] gi|19391 0.762 0.207 0.741 6e-54
195036934 675 GH18527 [Drosophila grimshawi] gi|193894 0.757 0.198 0.746 9e-54
193599206 560 PREDICTED: hypothetical protein LOC10016 0.790 0.25 0.689 1e-53
>gi|357602466|gb|EHJ63410.1| hypothetical protein KGM_21411 [Danaus plexippus] Back     alignment and taxonomy information
 Score =  239 bits (611), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 122/175 (69%), Positives = 133/175 (76%), Gaps = 22/175 (12%)

Query: 1   MVMEVTPSPQCVGREFVRQYYTLLNQAPAHLHRVGREFVRQYYTLLNQAPAHLHRFYSEN 60
           MVME +PSP                        VGREFVRQYYTLLN+APAHLHRFY+  
Sbjct: 1   MVMEASPSPSP--------------------QSVGREFVRQYYTLLNKAPAHLHRFYNNY 40

Query: 61  SLFIHGGLDAPNRETKQVVGQEQIHEHIQQLNFRDCHAKIRQVDSQATLGNGVVVQVSGE 120
           S F+HGGLDAPNRET  VVGQ+QIH  IQQLNFRDCHAKI QVD+QATLGNGVVVQV+GE
Sbjct: 41  SSFVHGGLDAPNRETLPVVGQKQIHNRIQQLNFRDCHAKISQVDAQATLGNGVVVQVTGE 100

Query: 121 LSNGGQPMRRFTQTFVLAAQSPKKYYVHNDIFRYQDFLV-DEEADLS-RSDGEDD 173
           LSN G PMRRFTQTFVLAAQSPKKYYVHNDIFRYQD +  DEE + S RSD E++
Sbjct: 101 LSNAGAPMRRFTQTFVLAAQSPKKYYVHNDIFRYQDVVFSDEEGEGSGRSDAEEE 155

Source: Danaus plexippus

Species: Danaus plexippus

Genus: Danaus

Family: Nymphalidae

Order: Lepidoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|157110308|ref|XP_001651045.1| hypothetical protein AaeL_AAEL005528 [Aedes aegypti] gi|108878769|gb|EAT42994.1| AAEL005528-PA [Aedes aegypti] Back     alignment and taxonomy information
>gi|170051648|ref|XP_001861860.1| rasputin [Culex quinquefasciatus] gi|167872816|gb|EDS36199.1| rasputin [Culex quinquefasciatus] Back     alignment and taxonomy information
>gi|312383845|gb|EFR28759.1| hypothetical protein AND_02863 [Anopheles darlingi] Back     alignment and taxonomy information
>gi|91076984|ref|XP_975463.1| PREDICTED: similar to rasputin CG9412-PB [Tribolium castaneum] gi|270001993|gb|EEZ98440.1| hypothetical protein TcasGA2_TC000929 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|405961406|gb|EKC27215.1| Ras GTPase-activating protein-binding protein 2 [Crassostrea gigas] Back     alignment and taxonomy information
>gi|345494268|ref|XP_001605102.2| PREDICTED: LOW QUALITY PROTEIN: ras GTPase-activating protein-binding protein 1-like [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|195113433|ref|XP_002001272.1| GI22064 [Drosophila mojavensis] gi|193917866|gb|EDW16733.1| GI22064 [Drosophila mojavensis] Back     alignment and taxonomy information
>gi|195036934|ref|XP_001989923.1| GH18527 [Drosophila grimshawi] gi|193894119|gb|EDV92985.1| GH18527 [Drosophila grimshawi] Back     alignment and taxonomy information
>gi|193599206|ref|XP_001946593.1| PREDICTED: hypothetical protein LOC100165303 [Acyrthosiphon pisum] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query177
FB|FBgn0015778 690 rin "rasputin" [Drosophila mel 0.807 0.207 0.703 9.2e-52
ZFIN|ZDB-GENE-040426-2698 501 zgc:56304 "zgc:56304" [Danio r 0.853 0.301 0.564 1.5e-42
UNIPROTKB|E1C769 482 G3BP2 "Uncharacterized protein 0.853 0.313 0.564 1.5e-42
ZFIN|ZDB-GENE-030131-7452 477 g3bp1 "GTPase activating prote 0.813 0.301 0.582 1.4e-41
ZFIN|ZDB-GENE-070112-1972 507 g3bp2 "GTPase activating prote 0.853 0.297 0.557 1.7e-41
UNIPROTKB|Q2KJ17 449 G3BP2 "GTPase activating prote 0.853 0.336 0.551 2.8e-41
UNIPROTKB|E2QYY6 449 G3BP2 "Uncharacterized protein 0.853 0.336 0.551 2.8e-41
UNIPROTKB|F6XCI1 490 G3BP2 "Uncharacterized protein 0.853 0.308 0.551 2.8e-41
UNIPROTKB|D6RB17198 G3BP2 "Ras GTPase-activating p 0.853 0.762 0.551 2.8e-41
UNIPROTKB|Q9UN86 482 G3BP2 "Ras GTPase-activating p 0.853 0.313 0.551 2.8e-41
FB|FBgn0015778 rin "rasputin" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 537 (194.1 bits), Expect = 9.2e-52, P = 9.2e-52
 Identities = 107/152 (70%), Positives = 123/152 (80%)

Query:    25 NQAPAHLHRVGREFVRQYYTLLNQAPAHLHRFYSENSLFIHGGLDAPNRETKQVVGQEQI 84
             +Q P+    VGREFVRQYYTLLN+AP HLHRFY+ NS +IHG       E+K VVGQ +I
Sbjct:     8 SQQPSP-QSVGREFVRQYYTLLNKAPNHLHRFYNHNSSYIHG-------ESKLVVGQREI 59

Query:    85 HEHIQQLNFRDCHAKIRQVDSQATLGNGVVVQVSGELSNGGQPMRRFTQTFVLAAQSPKK 144
             H  IQQLNF DCHAKI QVD+QATLGNGVVVQV+GELSN GQPMRRFTQTFVLAAQSPKK
Sbjct:    60 HNRIQQLNFNDCHAKISQVDAQATLGNGVVVQVTGELSNDGQPMRRFTQTFVLAAQSPKK 119

Query:   145 YYVHNDIFRYQDFLVDEEAD-LSRSDGEDDVD 175
             YYVHNDIFRYQD  +++E D  SRS+ +++ D
Sbjct:   120 YYVHNDIFRYQDLYIEDEQDGESRSENDEEHD 151
GO:0017124 "SH3 domain binding" evidence=ISS
GO:0001752 "compound eye photoreceptor fate commitment" evidence=IMP
GO:0007265 "Ras protein signal transduction" evidence=IGI
GO:0005829 "cytosol" evidence=IDA
GO:0016318 "ommatidial rotation" evidence=IMP
GO:0003729 "mRNA binding" evidence=ISS
GO:0003676 "nucleic acid binding" evidence=IEA
GO:0000166 "nucleotide binding" evidence=IEA
GO:0006810 "transport" evidence=IEA
GO:0005811 "lipid particle" evidence=IDA
GO:0071011 "precatalytic spliceosome" evidence=IDA
GO:0071013 "catalytic step 2 spliceosome" evidence=IDA
GO:0000398 "mRNA splicing, via spliceosome" evidence=IC
ZFIN|ZDB-GENE-040426-2698 zgc:56304 "zgc:56304" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|E1C769 G3BP2 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-030131-7452 g3bp1 "GTPase activating protein (SH3 domain) binding protein 1" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-070112-1972 g3bp2 "GTPase activating protein (SH3 domain) binding protein 2" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|Q2KJ17 G3BP2 "GTPase activating protein (SH3 domain) binding protein 2" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|E2QYY6 G3BP2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F6XCI1 G3BP2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|D6RB17 G3BP2 "Ras GTPase-activating protein-binding protein 2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q9UN86 G3BP2 "Ras GTPase-activating protein-binding protein 2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q6BWC0NTF2_DEBHANo assigned EC number0.320.64400.9193yesN/A
Q5R9L3G3BP2_PONABNo assigned EC number0.6240.69490.2551yesN/A
P97379G3BP2_MOUSENo assigned EC number0.6240.69490.2551yesN/A
Q9UN86G3BP2_HUMANNo assigned EC number0.6240.69490.2551yesN/A

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer5.3.3.1LOW CONFIDENCE prediction!
3rd Layer5.3.3LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query177
cd00780119 cd00780, NTF2, Nuclear transport factor 2 (NTF2) d 5e-46
pfam02136116 pfam02136, NTF2, Nuclear transport factor 2 (NTF2) 1e-32
cd00531124 cd00531, NTF2_like, Nuclear transport factor 2 (NT 2e-10
>gnl|CDD|238403 cd00780, NTF2, Nuclear transport factor 2 (NTF2) domain plays an important role in the trafficking of macromolecules, ions and small molecules between the cytoplasm and nucleus Back     alignment and domain information 
 Score =  146 bits (371), Expect = 5e-46
 Identities = 52/123 (42%), Positives = 69/123 (56%), Gaps = 8/123 (6%)

Query: 34  VGREFVRQYYTLLNQAPAHLHRFYSENSLFIHGGLDAPNRETKQVVGQEQIHEHIQQLNF 93
           V + FV+QYY++ +     LHR Y + S+    G        KQV G++ I E +  L F
Sbjct: 5   VAKAFVQQYYSIFDNNREGLHRLYGDTSMLSREG-------MKQVTGRDAIVEKLSSLPF 57

Query: 94  RDCHAKIRQVDSQATLGNGVVVQVSGELSNGGQPMRRFTQTFVLAAQSPKKYYVHNDIFR 153
           +    KI  VDSQ T   GV+V V+G L    QP R+F+QTFVLA Q    Y+V NDIFR
Sbjct: 58  QKTKHKITTVDSQPTPSGGVIVMVTGSLKLDEQPPRKFSQTFVLAPQ-NGGYFVLNDIFR 116

Query: 154 YQD 156
           + D
Sbjct: 117 FVD 119

This bi-directional transport of macromolecules across the nuclear envelope requires many soluble factors that includes GDP-binding protein Ran (RanGDP). RanGDP is required for both import and export of proteins and poly(A) RNA. RanGDP also has been implicated in cell cycle control, specifically in mitotic spindle assembly. In interphase cells, RanGDP is predominately nuclear and thought to be GTP bound, but it is also present in the cytoplasm, probably in the GDP-bound state. NTF2 mediates the nuclear import of RanGDP. NTF2 binds to both RanGDP and FxFG repeat-containing nucleoporins. Length = 119
>gnl|CDD|216894 pfam02136, NTF2, Nuclear transport factor 2 (NTF2) domain Back     alignment and domain information
>gnl|CDD|238296 cd00531, NTF2_like, Nuclear transport factor 2 (NTF2-like) superfamily Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 177
KOG2104|consensus126 100.0
cd00780119 NTF2 Nuclear transport factor 2 (NTF2) domain play 100.0
KOG0116|consensus 419 99.97
PF02136118 NTF2: Nuclear transport factor 2 (NTF2) domain; In 99.96
KOG4353|consensus139 99.95
PF10429166 Mtr2: Nuclear pore RNA shuttling protein Mtr2; Int 99.06
KOG3763|consensus585 99.01
cd00531124 NTF2_like Nuclear transport factor 2 (NTF2-like) s 98.9
TIGR02246128 conserved hypothetical protein. This family consis 97.71
PF15008262 DUF4518: Domain of unknown function (DUF4518) 97.64
PF13474121 SnoaL_3: SnoaL-like domain; PDB: 2GXF_A 3KSP_A 3KE 97.6
PF14534107 DUF4440: Domain of unknown function (DUF4440); PDB 97.4
PF12893116 Lumazine_bd_2: Putative lumazine-binding; PDB: 3BL 96.32
cd00780119 NTF2 Nuclear transport factor 2 (NTF2) domain play 96.27
PF08332128 CaMKII_AD: Calcium/calmodulin dependent protein ki 96.17
PF12680102 SnoaL_2: SnoaL-like domain; PDB: 3F40_A 3RGA_A 3G8 96.16
cd00781122 ketosteroid_isomerase ketosteroid isomerase: Many 95.83
PF13577127 SnoaL_4: SnoaL-like domain; PDB: 3S5C_B 3EJV_A 2RF 94.35
TIGR02096129 conserved hypothetical protein, steroid delta-isom 93.46
PF02136118 NTF2: Nuclear transport factor 2 (NTF2) domain; In 92.46
COG4319137 Ketosteroid isomerase homolog [Function unknown] 89.56
PF11533125 DUF3225: Protein of unknown function (DUF3225); In 86.62
>KOG2104|consensus Back     alignment and domain information 
Probab=100.00  E-value=3e-35  Score=214.93  Aligned_cols=120  Identities=35%  Similarity=0.648  Sum_probs=111.7

Q ss_pred             CCCHHHHHHHHHHHHHHhcCCCchhHHHHHHHHHHHHHHHHhcChhhHhccccCCceEEecCCCCCCcccceecCHHHHH
Q psy6106           6 TPSPQCVGREFVRQYYTLLNQAPAHLHRVGREFVRQYYTLLNQAPAHLHRFYSENSLFIHGGLDAPNRETKQVVGQEQIH   85 (177)
Q Consensus         6 ~~~~~~~~~~fv~~yy~~~~~~~~~~~~va~~Fv~~YY~~l~~~r~~L~~fY~~~S~~~~~g~~~~~~~~~~~~G~~~I~   85 (177)
                      +|.++.||++||||||.                      ++|++|..|..+|.+.|.+||        |++.+.|+++|.
T Consensus         3 d~~~e~v~~~FvqhYY~----------------------~FD~dR~ql~~lY~~~S~LTf--------EGqq~qG~~~Iv   52 (126)
T KOG2104|consen    3 DPVYEAVAKAFVQHYYS----------------------LFDNDRSQLGALYIDTSMLTF--------EGQQIQGKDAIV   52 (126)
T ss_pred             CccHHHHHHHHHHHHHH----------------------HhcCchhHhhhhhcccceeeE--------cchhhcchHHHH
Confidence            45778888888888888                      666899999999999999987        458999999999


Q ss_pred             HHHhhCCCccccEEEeEEeeeeeCCCcEEEEEEeEeeeCCCCCceeEEEEEEEeeCCCcEEEEcceEEee
Q psy6106          86 EHIQQLNFRDCHAKIRQVDSQATLGNGVVVQVSGELSNGGQPMRRFTQTFVLAAQSPKKYYVHNDIFRYQ  155 (177)
Q Consensus        86 ~~l~~lp~~~~~~~I~svD~Q~~~~~~ilI~V~G~v~~~~~~~r~FsqtFvL~~~~~~~y~I~nD~fr~~  155 (177)
                      ++|.+|||.+++|.|+++||||++++||+|+|.|+++.+++++.+|+|.|.|.|+.+|.|++.||+||+-
T Consensus        53 eKl~sLpFqkiqh~IttvD~QPt~~g~ilv~V~G~Lk~dEd~~~~FsQvF~L~~n~~~~~~v~ndiFRLn  122 (126)
T KOG2104|consen   53 EKLTSLPFQKIQHSITTVDSQPTPDGGILVMVVGQLKLDEDPILRFSQVFLLKPNIQGSYYVFNDIFRLN  122 (126)
T ss_pred             HHHhcCChhhhhceeeecccccCCCCcEEEEEeeeeeeccCCccceeeEEEEeEcCCCCEEEEeeeEEEe
Confidence            9999999999999999999999999999999999999999999999999999999779999999999985

>cd00780 NTF2 Nuclear transport factor 2 (NTF2) domain plays an important role in the trafficking of macromolecules, ions and small molecules between the cytoplasm and nucleus Back     alignment and domain information
>KOG0116|consensus Back     alignment and domain information
>PF02136 NTF2: Nuclear transport factor 2 (NTF2) domain; InterPro: IPR002075 Nuclear transport factor 2 (NTF2) is a homodimer which stimulates efficient nuclear import of a cargo protein Back     alignment and domain information
>KOG4353|consensus Back     alignment and domain information
>PF10429 Mtr2: Nuclear pore RNA shuttling protein Mtr2; InterPro: IPR019488 Mtr2 is a monomeric, dual-action, RNA-shuttle protein found in yeasts Back     alignment and domain information
>KOG3763|consensus Back     alignment and domain information
>cd00531 NTF2_like Nuclear transport factor 2 (NTF2-like) superfamily Back     alignment and domain information
>TIGR02246 conserved hypothetical protein Back     alignment and domain information
>PF15008 DUF4518: Domain of unknown function (DUF4518) Back     alignment and domain information
>PF13474 SnoaL_3: SnoaL-like domain; PDB: 2GXF_A 3KSP_A 3KE7_A 3BB9_E 3CNX_A 3F7S_A 3GWR_B Back     alignment and domain information
>PF14534 DUF4440: Domain of unknown function (DUF4440); PDB: 3HX8_A 3SOY_A 3ROB_B 3GZR_A 3B7C_A 3CU3_A 3FSD_A 2R4I_C 1TP6_A Back     alignment and domain information
>PF12893 Lumazine_bd_2: Putative lumazine-binding; PDB: 3BLZ_C 3DUK_F 3FKA_C Back     alignment and domain information
>cd00780 NTF2 Nuclear transport factor 2 (NTF2) domain plays an important role in the trafficking of macromolecules, ions and small molecules between the cytoplasm and nucleus Back     alignment and domain information
>PF08332 CaMKII_AD: Calcium/calmodulin dependent protein kinase II Association; InterPro: IPR013543 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases Back     alignment and domain information
>PF12680 SnoaL_2: SnoaL-like domain; PDB: 3F40_A 3RGA_A 3G8Z_A 3DMC_A 3FH1_A 1TUH_A 3F14_A 3ER7_A 1Z1S_A 3F7X_A Back     alignment and domain information
>cd00781 ketosteroid_isomerase ketosteroid isomerase: Many biological reactions proceed by enzymatic cleavage of a C-H bond adjacent to carbonyl or a carboxyl group, leading to an enol or a enolate intermediate that is subsequently re-protonated at the same or an adjacent carbon Back     alignment and domain information
>PF13577 SnoaL_4: SnoaL-like domain; PDB: 3S5C_B 3EJV_A 2RFR_A 3B8L_F 2CHC_A 3A76_A 3EF8_B Back     alignment and domain information
>TIGR02096 conserved hypothetical protein, steroid delta-isomerase-related Back     alignment and domain information
>PF02136 NTF2: Nuclear transport factor 2 (NTF2) domain; InterPro: IPR002075 Nuclear transport factor 2 (NTF2) is a homodimer which stimulates efficient nuclear import of a cargo protein Back     alignment and domain information
>COG4319 Ketosteroid isomerase homolog [Function unknown] Back     alignment and domain information
>PF11533 DUF3225: Protein of unknown function (DUF3225); InterPro: IPR024507 This family of proteins has no known function Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query177
3ujm_A120 Crystal Structure Of The Ntf2-Like Domain Of The Dr 4e-52
3q90_A140 Crystal Structure Of The Ntf2 Domain Of Ras Gtpase- 9e-41
1zo2_A129 Structure Of Nuclear Transport Factor 2 (Ntf2) From 7e-09
1jkg_A140 Structural Basis For The Recognition Of A Nucleopor 2e-07
1zx2_A147 Crystal Structure Of Yeast Ubp3-Associated Protein 4e-07
2qiy_A154 Yeast Deubiquitinase Ubp3 And Bre5 Cofactor Complex 4e-07
1ask_A127 Nuclear Transport Factor 2 (Ntf2) H66a Mutant Lengt 7e-06
1gy7_A125 N77y Point Mutant Of S.Cerevisiae Ntf2 Length = 125 2e-05
1jb2_A127 Crystal Structure Of Ntf2 M84e Mutant Length = 127 4e-05
1oun_A127 Crystal Structure Of Nuclear Transport Factor 2 (Nt 5e-05
1qma_A126 Nuclear Transport Factor 2 (Ntf2) W7a Mutant Length 5e-05
1gy5_A127 D92n,D94n Double Point Mutant Of Human Nuclear Tran 5e-05
1ar0_A127 Nuclear Transport Factor 2 (Ntf2) E42k Mutant Lengt 6e-05
1jb4_A127 Crystal Structure Of Ntf2 M102e Mutant Length = 127 8e-05
1u5o_A127 Structure Of The D23a Mutant Of The Nuclear Transpo 1e-04
3nv0_B154 Crystal Structure And Mutational Analysis Of The Nx 1e-04
1jb5_A127 Crystal Structure Of Ntf2 M118e Mutant Length = 127 3e-04
>pdb|3UJM|A Chain A, Crystal Structure Of The Ntf2-Like Domain Of The Drosophila Melanogaster Rasputin Protein Length = 120 Back     alignment and structure 
Iteration: 1

 Score =  200 bits (508), Expect = 4e-52,   Method: Compositional matrix adjust.
 Identities = 98/122 (80%), Positives = 105/122 (86%), Gaps = 7/122 (5%)
Query: 34  VGREFVRQYYTLLNQAPAHLHRFYSENSLFIHGGLDAPNRETKQVVGQEQIHEHIQQLNF 93
           VGREFVRQYYTLLN+AP HLHRFY+ NS +IHG       E+K VVGQ +IH  IQQLNF
Sbjct: 6   VGREFVRQYYTLLNKAPNHLHRFYNHNSSYIHG-------ESKLVVGQREIHNRIQQLNF 58
Query: 94  RDCHAKIRQVDSQATLGNGVVVQVSGELSNGGQPMRRFTQTFVLAAQSPKKYYVHNDIFR 153
            DCHAKI QVD+QATLGNGVVVQV+GELSN GQPMRRFTQTFVLAAQSPKKYYVHNDIFR
Sbjct: 59  NDCHAKISQVDAQATLGNGVVVQVTGELSNDGQPMRRFTQTFVLAAQSPKKYYVHNDIFR 118
Query: 154 YQ 155
           YQ
Sbjct: 119 YQ 120
>pdb|3Q90|A Chain A, Crystal Structure Of The Ntf2 Domain Of Ras Gtpase-Activating Protein- Binding Protein 1 Length = 140 Back     alignment and structure
>pdb|1ZO2|A Chain A, Structure Of Nuclear Transport Factor 2 (Ntf2) From Cryptosporidium Parvum Length = 129 Back     alignment and structure
>pdb|1JKG|A Chain A, Structural Basis For The Recognition Of A Nucleoporin Fg- Repeat By The Ntf2-Like Domain Of Tap-P15 Mrna Nuclear Export Factor Length = 140 Back     alignment and structure
>pdb|1ZX2|A Chain A, Crystal Structure Of Yeast Ubp3-Associated Protein Bre5 Length = 147 Back     alignment and structure
>pdb|2QIY|A Chain A, Yeast Deubiquitinase Ubp3 And Bre5 Cofactor Complex Length = 154 Back     alignment and structure
>pdb|1ASK|A Chain A, Nuclear Transport Factor 2 (Ntf2) H66a Mutant Length = 127 Back     alignment and structure
>pdb|1GY7|A Chain A, N77y Point Mutant Of S.Cerevisiae Ntf2 Length = 125 Back     alignment and structure
>pdb|1JB2|A Chain A, Crystal Structure Of Ntf2 M84e Mutant Length = 127 Back     alignment and structure
>pdb|1OUN|A Chain A, Crystal Structure Of Nuclear Transport Factor 2 (Ntf2) Length = 127 Back     alignment and structure
>pdb|1QMA|A Chain A, Nuclear Transport Factor 2 (Ntf2) W7a Mutant Length = 126 Back     alignment and structure
>pdb|1GY5|A Chain A, D92n,D94n Double Point Mutant Of Human Nuclear Transport Factor 2 (Ntf2) Length = 127 Back     alignment and structure
>pdb|1AR0|A Chain A, Nuclear Transport Factor 2 (Ntf2) E42k Mutant Length = 127 Back     alignment and structure
>pdb|1JB4|A Chain A, Crystal Structure Of Ntf2 M102e Mutant Length = 127 Back     alignment and structure
>pdb|1U5O|A Chain A, Structure Of The D23a Mutant Of The Nuclear Transport Carrier Ntf2 Length = 127 Back     alignment and structure
>pdb|3NV0|B Chain B, Crystal Structure And Mutational Analysis Of The Nxf2NXT1 Heterodimeric Complex From Caenorhabditis Elegans At 1.84 A Resolution Length = 154 Back     alignment and structure
>pdb|1JB5|A Chain A, Crystal Structure Of Ntf2 M118e Mutant Length = 127 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query177
3q90_A140 RAS GTPase-activating protein-binding protein 1; s 1e-52
3ujm_A120 Rasputin; NTF2-like fold, RAS signaling, signaling 2e-49
1gy6_A127 Nuclear transport factor 2; 1.6A {Rattus norvegicu 2e-44
1zo2_A129 NTF2, nuclear transport factor 2; structural genom 7e-44
2qiy_A154 UBP3-associated protein BRE5; deubiquitylation, ub 9e-43
1jkg_A140 P15; NTF2-like domain, transport protein; 1.90A {H 2e-41
1gy7_A125 Nuclear transport factor 2; protein transport; 1.6 5e-41
3nv0_B154 NTF2-related export protein; NTF2-like domain, bet 3e-37
1jkg_B250 TAP; NTF2-like domain, transport protein; 1.90A {H 4e-09
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-04
>3q90_A RAS GTPase-activating protein-binding protein 1; structural genomics, structural genomics consortium, SGC, NT (A+B proteins); 1.70A {Homo sapiens} Length = 140 Back     alignment and structure
 Score =  163 bits (415), Expect = 1e-52
 Identities = 78/125 (62%), Positives = 92/125 (73%), Gaps = 2/125 (1%)

Query: 34  VGREFVRQYYTLLNQAPAHLHRFYSENSLFIHGGLDAPNRETKQVVGQEQIHEHIQQLNF 93
           VGREFVRQYYTLLNQAP  LHRFY +NS ++HGGLD+  +    V GQ++IH  +   NF
Sbjct: 12  VGREFVRQYYTLLNQAPDMLHRFYGKNSSYVHGGLDSNGKPADAVYGQKEIHRKVMSQNF 71

Query: 94  RDCHAKIRQVDSQATLGNGVVVQVSGELSNGGQPMRRFTQTFVLAAQS--PKKYYVHNDI 151
            +CH KIR VD+ ATL +GVVVQV G LSN  Q +RRF QTFVLA +     K+YVHNDI
Sbjct: 72  TNCHTKIRHVDAHATLNDGVVVQVMGLLSNNNQALRRFMQTFVLAPEGSVANKFYVHNDI 131

Query: 152 FRYQD 156
           FRYQD
Sbjct: 132 FRYQD 136
>3ujm_A Rasputin; NTF2-like fold, RAS signaling, signaling protein; HET: EPE; 2.74A {Drosophila melanogaster} Length = 120 Back     alignment and structure
>1gy6_A Nuclear transport factor 2; 1.6A {Rattus norvegicus} SCOP: d.17.4.2 PDB: 1a2k_A 1oun_A 1ar0_A 1u5o_A 1ask_A 1gy5_A 1jb5_A 1jb4_A 1jb2_A 1qma_A Length = 127 Back     alignment and structure
>1zo2_A NTF2, nuclear transport factor 2; structural genomics, structural genomics consortium, SGC, transport protein; 1.60A {Cryptosporidium parvum} SCOP: d.17.4.2 Length = 129 Back     alignment and structure
>1jkg_A P15; NTF2-like domain, transport protein; 1.90A {Homo sapiens} SCOP: d.17.4.2 PDB: 1jn5_A Length = 140 Back     alignment and structure
>1gy7_A Nuclear transport factor 2; protein transport; 1.6A {Saccharomyces cerevisiae} SCOP: d.17.4.2 PDB: 1gyb_A Length = 125 Back     alignment and structure
>3nv0_B NTF2-related export protein; NTF2-like domain, beta sheet heterodimer interface, nucleopo binding pocket, water mediated interface; 1.84A {Caenorhabditis elegans} Length = 154 Back     alignment and structure
>1jkg_B TAP; NTF2-like domain, transport protein; 1.90A {Homo sapiens} SCOP: d.17.4.2 PDB: 1jn5_B 1go5_A Length = 250 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query177
3q90_A140 RAS GTPase-activating protein-binding protein 1; s 100.0
1gy6_A127 Nuclear transport factor 2; 1.6A {Rattus norvegicu 100.0
1zo2_A129 NTF2, nuclear transport factor 2; structural genom 100.0
3ujm_A120 Rasputin; NTF2-like fold, RAS signaling, signaling 100.0
1gy7_A125 Nuclear transport factor 2; protein transport; 1.6 100.0
2qiy_A154 UBP3-associated protein BRE5; deubiquitylation, ub 100.0
3nv0_B154 NTF2-related export protein; NTF2-like domain, bet 100.0
1jkg_A140 P15; NTF2-like domain, transport protein; 1.90A {H 100.0
1jkg_B250 TAP; NTF2-like domain, transport protein; 1.90A {H 99.94
1q40_B219 MEX67, mRNA export factor MEX67; NTF2-fold, nuclea 99.93
1of5_A221 MRNA export factor MEX67; nuclear protein, repeat, 99.93
3nv0_A205 Nuclear RNA export factor 2; NTF2-like domain, bet 99.89
1q42_A201 MTR2, mRNA transport regulator MTR2; NTF2-fold, nu 99.72
1of5_B184 MTR2, YKL186C, mRNA transport regulator MTR2; nucl 99.59
4i4k_A143 Uncharacterized protein SGCJ; structural genomics, 98.22
3hx8_A129 MLR2180 protein, putative ketosteroid isomerase; s 97.88
3cu3_A172 Domain of unknown function with A cystatin-like F; 97.86
3gzr_A146 Uncharacterized protein with A NTF2-like fold; str 97.77
3d9r_A135 Ketosteroid isomerase-like protein; YP_049581.1, s 97.76
2gxf_A142 Hypothetical protein YYBH; alpha-beta protein., st 97.65
3h51_A156 Putative calcium/calmodulin dependent protein KIN 97.46
3rob_A139 Uncharacterized conserved protein; structural geno 97.27
3b7c_A122 Uncharacterized protein; NTF-2 like protein, struc 97.2
2ux0_A143 Calcium-calmodulin dependent protein kinase (CAM I 97.18
3f7s_A142 Uncharacterized NTF2-like protein; structural geno 97.13
2rcd_A129 Uncharacterized protein; structural genomics, join 97.04
3gwr_A144 Putative calcium/calmodulin-dependent protein KIN 97.04
2owp_A129 Hypothetical protein BXE_B1374; cystatin-like fold 96.97
3duk_A125 NTF2-like protein of unknown function; structural 96.63
3b8l_A163 Uncharacterized protein; putative aromatic ring hy 96.54
3bb9_A148 Putative orphan protein; structural genomics, join 96.46
2rfr_A155 Uncharacterized protein; structural genomics, join 96.46
2chc_A170 Protein RV3472; hypothetical protein; 1.69A {Mycob 96.3
3soy_A145 NTF2-like superfamily protein; structural genomics 96.22
3fka_A120 Uncharacterized NTF-2 like protein; structural gen 96.08
3jum_A185 Phenazine biosynthesis protein A/B; chirality, dru 96.0
3cnx_A170 Uncharacterized protein; putative dehydratase, NTF 95.93
3dm8_A143 Uncharacterized protein RPA4348; siras, putative i 95.79
1tp6_A128 Hypothetical protein PA1314; structural genomics, 95.61
3a76_A176 Gamma-hexachlorocyclohexane dehydrochlorinase; bar 95.48
3er7_A131 Uncharacterized NTF2-like protein; YP_001812677.1, 95.38
3mg1_A323 OCP, orange carotenoid protein; carotenoid binding 95.33
3dmc_A134 NTF2-like protein; structural genomics, joint cent 95.27
2r4i_A123 Uncharacterized protein; NTF2-like protein, struct 95.2
4h3u_A158 Hypothetical protein; structural genomics, PSI-bio 95.16
3blz_A128 NTF2-like protein of unknown function; structural 94.96
2rgq_A144 Domain of unknown function with A cystatin-like F; 94.73
3ff0_A163 Phenazine biosynthesis protein PHZB 2; cystatin-li 94.69
1jkg_A140 P15; NTF2-like domain, transport protein; 1.90A {H 94.68
3en8_A128 Uncharacterized NTF-2 like protein; YP_553245.1, N 94.59
3gzb_A154 Putative snoal-like polyketide cyclase; YP_0011826 94.25
3nv0_B154 NTF2-related export protein; NTF2-like domain, bet 94.21
3f14_A112 Uncharacterized NTF2-like protein; YP_680363.1, NT 94.21
1ohp_A125 Steroid delta-isomerase; inhibitor; HET: ESR; 1.53 94.19
3f7x_A151 Putative polyketide cyclase; structural genomics, 94.08
3h3h_A122 Uncharacterized snoal-like protein; structural gen 93.95
3fsd_A134 NTF2-like protein of unknown function in nutrient; 93.43
3ebt_A132 Uncharacterized NTF2-like protein; structural geno 93.3
1s5a_A150 Hypothetical protein YESE; structural genomics, PS 93.21
3rga_A283 Epoxide hydrolase; NTF2-like, epoxide-opening cycl 93.15
1oh0_A131 Steroid delta-isomerase; ketosteroid isomerase, KS 93.1
2a15_A139 Hypothetical protein RV0760C; beta-alpha-barrel, s 93.03
1z1s_A163 Hypothetical protein PA3332; beta barrel, conserve 92.9
3dxo_A121 Uncharacterized snoal-like protein; putative isome 92.83
1nww_A149 Limonene-1,2-epoxide hydrolase; HET: MES; 1.20A {R 92.66
3ef8_A150 Putative scyalone dehydratase; YP_496742.1, struct 92.4
3ec9_A140 Uncharacterized NTF2-like protein; structural geno 92.35
2bng_A149 MB2760; epoxide hydrolase, limonene, hydrolase, st 92.01
2k54_A123 Protein ATU0742; protein of unknown function, stru 91.91
3ke7_A134 Putative ketosteroid isomerase; structural genomic 91.56
2f86_B143 Hypothetical protein K11E8.1D; UNC-43, oligomeriza 91.5
3g8z_A148 Protein of unknown function with cystatin-like FO; 91.2
3i0y_A140 Putative polyketide cyclase; cystatin-like fold, s 90.76
3mso_A143 Steroid delta-isomerase; structural genomics, join 90.39
3fh1_A129 Uncharacterized NTF2-like protein; structural geno 89.85
3rga_A 283 Epoxide hydrolase; NTF2-like, epoxide-opening cycl 89.59
3ff2_A117 Uncharacterized cystatin fold protein (YP_497570. 88.98
3g16_A156 Uncharacterized protein with cystatin-like fold; Y 88.79
1tuh_A156 BAL32A, hypothetical protein EGC068; unknown funct 88.66
3f8x_A148 Putative delta-5-3-ketosteroid isomerase; structur 88.54
3fgy_A135 Uncharacterized NTF2-like protein; structural geno 88.53
3hk4_A136 MLR7391 protein; NTF2-like protein, structural gen 88.45
1jkg_B250 TAP; NTF2-like domain, transport protein; 1.90A {H 86.32
3grd_A134 Uncharacterized NTF2-superfamily protein; NP_97724 85.67
3f40_A114 Uncharacterized NTF2-like protein; YP_677363.1, NT 85.33
2gey_A158 ACLR protein; alpha+beta barrel, oxidoreductase; H 85.26
3f8h_A150 Putative polyketide cyclase; structural genomics, 85.03
3ehc_A128 Snoal-like polyketide cyclase; structural genomics 82.44
1of5_A221 MRNA export factor MEX67; nuclear protein, repeat, 82.09
1sjw_A144 Nogalonic acid methyl ester cyclase; anthracycline 81.11
1q40_B219 MEX67, mRNA export factor MEX67; NTF2-fold, nuclea 80.71
2gex_A152 SNOL; alpha+beta barrel, oxidoreductase; 2.50A {St 80.55
3k0z_A159 Putative polyketide cyclase; structural genomics, 80.35
3f9s_A146 Putative polyketide cyclase; structural genomics, 80.21
3kkg_A146 Putative snoal-like polyketide cyclase; structural 80.1
>3q90_A RAS GTPase-activating protein-binding protein 1; structural genomics, structural genomics consortium, SGC, NT (A+B proteins); 1.70A {Homo sapiens} SCOP: d.17.4.0 Back     alignment and structure
Probab=100.00  E-value=1.8e-42  Score=263.75  Aligned_cols=137  Identities=62%  Similarity=1.021  Sum_probs=112.6

Q ss_pred             CccccCCCHHHHHHHHHHHHHHhcCCCchhHHHHHHHHHHHHHHHHhcChhhHhccccCCceEEecCCCCCCcccceecC
Q psy6106           1 MVMEVTPSPQCVGREFVRQYYTLLNQAPAHLHRVGREFVRQYYTLLNQAPAHLHRFYSENSLFIHGGLDAPNRETKQVVG   80 (177)
Q Consensus         1 ~~~~~~~~~~~~~~~fv~~yy~~~~~~~~~~~~va~~Fv~~YY~~l~~~r~~L~~fY~~~S~~~~~g~~~~~~~~~~~~G   80 (177)
                      |||| +|+++.||++||+|||+                      +|+++|+.|++||+++|.++|.+.+........+.|
T Consensus         2 ~~~~-~p~~~~vg~~Fv~~YY~----------------------~ld~~r~~L~~~Y~~~S~l~~~~~~~ng~~~~~~~G   58 (140)
T 3q90_A            2 MVME-KPSPLLVGREFVRQYYT----------------------LLNQAPDMLHRFYGKNSSYVHGGLDSNGKPADAVYG   58 (140)
T ss_dssp             -------CHHHHHHHHHHHHHH----------------------HHHHCGGGGGGGEEEEEEEC----------CCCEEH
T ss_pred             Cccc-CCCHHHHHHHHHHHHHH----------------------HHhcCHHHHHhhcccCceEEEEccCCCCceeecccC
Confidence            8999 99999999999999999                      777899999999999999999664321122247899


Q ss_pred             HHHHHHHHhhCCCccccEEEeEEeeeeeCCCcEEEEEEeEeeeCCCCCceeEEEEEEEeeC--CCcEEEEcceEEeeccc
Q psy6106          81 QEQIHEHIQQLNFRDCHAKIRQVDSQATLGNGVVVQVSGELSNGGQPMRRFTQTFVLAAQS--PKKYYVHNDIFRYQDFL  158 (177)
Q Consensus        81 ~~~I~~~l~~lp~~~~~~~I~svD~Q~~~~~~ilI~V~G~v~~~~~~~r~FsqtFvL~~~~--~~~y~I~nD~fr~~d~~  158 (177)
                      +++|.++|.+||+++++|+|.++||||++++||+|+|+|.++.+++++|+|+|+|+|+|.+  +++|+|.||||||+|+.
T Consensus        59 ~~~I~~~l~~Lp~~~~~~~I~tvD~Qps~~~gilI~V~G~l~~~~~~~~~F~QtF~L~p~~~~~~~y~V~nDifR~~de~  138 (140)
T 3q90_A           59 QKEIHRKVMSQNFTNCHTKIRHVDAHATLNDGVVVQVMGLLSNNNQALRRFMQTFVLAPEGSVANKFYVHNDIFRYQDEV  138 (140)
T ss_dssp             HHHHHHHHHHTCCCSCEEEEEEEEEEECGGGCEEEEEEEEEECTTCCCEEEEEEEEEEECSSSTTCEEEEEEEEEEGGGC
T ss_pred             HHHHHHHHHhCCCccceEEEEeEEEEEeCCCCEEEEEEEEEecCCCCccEEEEEEEEeecCCCCCCEEEEEEEeEeehhh
Confidence            9999999999999889999999999999999999999999999988899999999999985  58999999999999987


Q ss_pred             CC
Q psy6106         159 VD  160 (177)
Q Consensus       159 ~~  160 (177)
                      ++
T Consensus       139 ~~  140 (140)
T 3q90_A          139 FG  140 (140)
T ss_dssp             --
T ss_pred             cC
Confidence            64
>1gy6_A Nuclear transport factor 2; 1.6A {Rattus norvegicus} SCOP: d.17.4.2 PDB: 1a2k_A 1oun_A 1ar0_A 1u5o_A 1ask_A 1gy5_A 1jb5_A 1jb4_A 1jb2_A 1qma_A Back     alignment and structure
>1zo2_A NTF2, nuclear transport factor 2; structural genomics, structural genomics consortium, SGC, transport protein; 1.60A {Cryptosporidium parvum} SCOP: d.17.4.2 Back     alignment and structure
>3ujm_A Rasputin; NTF2-like fold, RAS signaling, signaling protein; HET: EPE; 2.74A {Drosophila melanogaster} Back     alignment and structure
>1gy7_A Nuclear transport factor 2; protein transport; 1.6A {Saccharomyces cerevisiae} SCOP: d.17.4.2 PDB: 1gyb_A Back     alignment and structure
>2qiy_A UBP3-associated protein BRE5; deubiquitylation, ubiquitin-specific processing proteases(UB NTF2, protein-protein recognition; 1.69A {Saccharomyces cerevisiae} SCOP: d.17.4.2 PDB: 1zx2_A Back     alignment and structure
>3nv0_B NTF2-related export protein; NTF2-like domain, beta sheet heterodimer interface, nucleopo binding pocket, water mediated interface; 1.84A {Caenorhabditis elegans} Back     alignment and structure
>1jkg_A P15; NTF2-like domain, transport protein; 1.90A {Homo sapiens} SCOP: d.17.4.2 PDB: 1jn5_A Back     alignment and structure
>1jkg_B TAP; NTF2-like domain, transport protein; 1.90A {Homo sapiens} SCOP: d.17.4.2 PDB: 1jn5_B 1go5_A Back     alignment and structure
>1q40_B MEX67, mRNA export factor MEX67; NTF2-fold, nuclear export, translation; 1.95A {Candida albicans} SCOP: d.17.4.2 Back     alignment and structure
>1of5_A MRNA export factor MEX67; nuclear protein, repeat, leucine- rich repeat, nuclear transport; 2.8A {Saccharomyces cerevisiae} SCOP: d.17.4.2 Back     alignment and structure
>3nv0_A Nuclear RNA export factor 2; NTF2-like domain, beta sheet heterodimer interface, nucleopo binding pocket, water mediated interface; 1.84A {Caenorhabditis elegans} Back     alignment and structure
>1q42_A MTR2, mRNA transport regulator MTR2; NTF2-fold, nuclear export, translation; 1.75A {Candida albicans} SCOP: d.17.4.2 PDB: 1q40_A Back     alignment and structure
>1of5_B MTR2, YKL186C, mRNA transport regulator MTR2; nuclear protein, repeat, leucine- rich repeat, nuclear transport; 2.8A {Saccharomyces cerevisiae} SCOP: d.17.4.2 Back     alignment and structure
>4i4k_A Uncharacterized protein SGCJ; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: CIT PG4 1PE; 1.70A {Streptomyces globisporus} Back     alignment and structure
>3hx8_A MLR2180 protein, putative ketosteroid isomerase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative; HET: MSE UNL PG4; 1.45A {Mesorhizobium loti} Back     alignment and structure
>3cu3_A Domain of unknown function with A cystatin-like F; structural genomics, joint center for structural genomics, J protein structure initiative; 2.00A {Nostoc punctiforme} SCOP: d.17.4.28 Back     alignment and structure
>3gzr_A Uncharacterized protein with A NTF2-like fold; structural genomics, joint center for struct genomics, JCSG, protein structure initiative; HET: MSE GOL; 1.40A {Caulobacter vibrioides} Back     alignment and structure
>3d9r_A Ketosteroid isomerase-like protein; YP_049581.1, structural joint center for structural genomics, JCSG, protein structu initiative; HET: MSE; 2.40A {Pectobacterium atrosepticum} SCOP: d.17.4.27 Back     alignment and structure
>2gxf_A Hypothetical protein YYBH; alpha-beta protein., structural genomics, PSI, protein structure initiative; HET: MES; 3.10A {Bacillus subtilis} SCOP: d.17.4.22 Back     alignment and structure
>3h51_A Putative calcium/calmodulin dependent protein KIN association domain; NP_636218.1; HET: MSE PG4; 1.70A {Xanthomonas campestris PV} Back     alignment and structure
>3rob_A Uncharacterized conserved protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomics; 1.48A {Planctomyces limnophilus} Back     alignment and structure
>3b7c_A Uncharacterized protein; NTF-2 like protein, structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.70A {Shewanella oneidensis} SCOP: d.17.4.16 Back     alignment and structure
>2ux0_A Calcium-calmodulin dependent protein kinase (CAM II gamma; transferase, oligomerisation DOM serine- threonine kinase, ATP-binding; 2.46A {Homo sapiens} SCOP: d.17.4.7 PDB: 2w2c_A 1hkx_A* Back     alignment and structure
>3f7s_A Uncharacterized NTF2-like protein; structural genomics, joint center for STR genomics, JCSG, protein structure initiative, PSI-2; 2.11A {Pseudomonas putida KT2440} Back     alignment and structure
>2rcd_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE; 2.32A {Pectobacterium atrosepticum SCRI1043} SCOP: d.17.4.18 Back     alignment and structure
>3gwr_A Putative calcium/calmodulin-dependent protein KIN II association domain; YP_315894.1; HET: MSE PG4; 2.01A {Thiobacillus denitrificans atcc 25259} Back     alignment and structure
>2owp_A Hypothetical protein BXE_B1374; cystatin-like fold, DUF3225 family protein, structural genom joint center for structural genomics, JCSG; 2.00A {Burkholderia xenovorans} SCOP: d.17.4.18 Back     alignment and structure
>3duk_A NTF2-like protein of unknown function; structural genomics, joint center for STR genomics, JCSG, protein structure initiative; HET: MSE; 2.20A {Methylobacillus flagellatus KT} SCOP: d.17.4.0 Back     alignment and structure
>3b8l_A Uncharacterized protein; putative aromatic ring hydroxylase, structural genomics, JOI for structural genomics, JCSG; HET: MSE; 1.75A {Novosphingobium aromaticivorans} SCOP: d.17.4.28 Back     alignment and structure
>3bb9_A Putative orphan protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE; 1.80A {Shewanella frigidimarina} SCOP: d.17.4.16 Back     alignment and structure
>2rfr_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 1.16A {Novosphingobium aromaticivorans} SCOP: d.17.4.28 Back     alignment and structure
>2chc_A Protein RV3472; hypothetical protein; 1.69A {Mycobacterium tuberculosis} SCOP: d.17.4.25 Back     alignment and structure
>3soy_A NTF2-like superfamily protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; 2.00A {Salmonella enterica subsp} Back     alignment and structure
>3fka_A Uncharacterized NTF-2 like protein; structural genomics, joint center for STR genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.69A {Silicibacter pomeroyi dss-3} Back     alignment and structure
>3jum_A Phenazine biosynthesis protein A/B; chirality, drug design, medicinal CH inhibitor, biosynthetic protein; HET: AOD; 1.45A {Burkholderia SP} PDB: 3b4o_A* 3b4p_A* 3dzl_A* 3ex9_A 3cnm_A* 3jun_A* 3juo_A* 3jup_A* 3juq_A* Back     alignment and structure
>3cnx_A Uncharacterized protein; putative dehydratase, NTF2-like protein, structural genomics center for structural genomics, JCSG; HET: MSE PGE PG6; 2.10A {Streptomyces avermitilis} SCOP: d.17.4.17 Back     alignment and structure
>3dm8_A Uncharacterized protein RPA4348; siras, putative isomerase, structural genomics, PSI-2, prote structure initiative; HET: CE9; 1.80A {Rhodopseudomonas palustris} SCOP: d.17.4.20 Back     alignment and structure
>1tp6_A Hypothetical protein PA1314; structural genomics, alpha-beta sandwich, PSI, protein structure initiative; 1.50A {Pseudomonas aeruginosa PAO1} SCOP: d.17.4.12 Back     alignment and structure
>3a76_A Gamma-hexachlorocyclohexane dehydrochlorinase; barrel fold, lyase, detoxification; HET: SPD; 2.25A {Sphingomonas paucimobilis} Back     alignment and structure
>3er7_A Uncharacterized NTF2-like protein; YP_001812677.1, NTF2-like protein of unknown function, struc genomics; HET: MSE; 1.50A {Exiguobacterium sibiricum 255-15} SCOP: d.17.4.24 Back     alignment and structure
>3mg1_A OCP, orange carotenoid protein; carotenoid binding protein, echinone, phycobilisome; HET: ECH; 1.65A {Synechocystis SP} PDB: 3mg2_A* 3mg3_A* 1m98_A* Back     alignment and structure
>3dmc_A NTF2-like protein; structural genomics, joint center for STR genomics, JCSG, protein structure initiative, PSI-2, unknow function; 1.65A {Anabaena variabilis atcc 29413} SCOP: d.17.4.10 Back     alignment and structure
>2r4i_A Uncharacterized protein; NTF2-like protein, structural genomics, joint center for STR genomics, JCSG; HET: MSE CIT; 1.60A {Cytophaga hutchinsonii atcc 33406} SCOP: d.17.4.15 Back     alignment and structure
>4h3u_A Hypothetical protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MSE; 1.15A {Catenulispora acidiphila} Back     alignment and structure
>3blz_A NTF2-like protein of unknown function; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 1.75A {Shewanella baltica} SCOP: d.17.4.14 Back     alignment and structure
>2rgq_A Domain of unknown function with A cystatin-like F; structural genomics, joint center for structural genomics, J protein structure initiative; HET: MSE; 1.80A {Nostoc punctiforme} SCOP: d.17.4.25 Back     alignment and structure
>3ff0_A Phenazine biosynthesis protein PHZB 2; cystatin-like fold, antibiotic biosynthesis, virulence, STRU genomics; 1.90A {Pseudomonas aeruginosa} Back     alignment and structure
>1jkg_A P15; NTF2-like domain, transport protein; 1.90A {Homo sapiens} SCOP: d.17.4.2 PDB: 1jn5_A Back     alignment and structure
>3en8_A Uncharacterized NTF-2 like protein; YP_553245.1, NTF-2 like protein of unknown function, structu genomics; HET: MSE PG4; 1.85A {Burkholderia xenovorans LB400} SCOP: d.17.4.20 Back     alignment and structure
>3gzb_A Putative snoal-like polyketide cyclase; YP_001182657.1, STRU genomics, joint center for structural genomics, JCSG; HET: MSE; 1.44A {Shewanella putrefaciens} PDB: 3lza_A* Back     alignment and structure
>3nv0_B NTF2-related export protein; NTF2-like domain, beta sheet heterodimer interface, nucleopo binding pocket, water mediated interface; 1.84A {Caenorhabditis elegans} Back     alignment and structure
>3f14_A Uncharacterized NTF2-like protein; YP_680363.1, NTF2-like protein of unknown function, structur genomics; HET: MSE TRS PGE; 1.45A {Cytophaga hutchinsonii atcc 33406} Back     alignment and structure
>1ohp_A Steroid delta-isomerase; inhibitor; HET: ESR; 1.53A {Pseudomonas testosteroni} SCOP: d.17.4.3 PDB: 1qjg_A* 8cho_A* 1ohs_A* 1ocv_A 1isk_A 3nuv_A* 1ogz_A* 3nhx_A* 3m8c_A* 3nxj_A* 3myt_A* 3mki_A 3mhe_A 1buq_A* 3nbr_A* 3t8u_A 3ov4_A* 3nm2_A Back     alignment and structure
>3f7x_A Putative polyketide cyclase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE UNL; 1.24A {Pseudomonas putida KT2440} Back     alignment and structure
>3h3h_A Uncharacterized snoal-like protein; structural genomics, joint center for structural genomics, J protein structure initiative; HET: MSE UNL MES; 1.60A {Burkholderia thailandensis E264} Back     alignment and structure
>3fsd_A NTF2-like protein of unknown function in nutrient; YP_427473.1, NTF2-like protein of unknown function in nutrie uptake; HET: UNL; 1.70A {Rhodospirillum rubrum atcc 11170} SCOP: d.17.4.0 Back     alignment and structure
>3ebt_A Uncharacterized NTF2-like protein; structural genomics, joint center for structural genomics, J protein structure initiative; 1.30A {Burkholderia pseudomallei K96243} SCOP: d.17.4.9 Back     alignment and structure
>1s5a_A Hypothetical protein YESE; structural genomics, PSI, protein STRU initiative, midwest center for structural genomics, MCSG, U function; 1.70A {Bacillus subtilis} SCOP: d.17.4.10 Back     alignment and structure
>3rga_A Epoxide hydrolase; NTF2-like, epoxide-opening cyclic ether formation, isomerase; HET: LSB ILD; 1.59A {Streptomyces lasaliensis} Back     alignment and structure
>1oh0_A Steroid delta-isomerase; ketosteroid isomerase, KSI, equilenin, PI, LBHB; HET: EQU; 1.1A {Pseudomonas putida} SCOP: d.17.4.3 PDB: 1e3v_A* 1opy_A 1dmq_A 1dmm_A 1ea2_A 3cpo_A 1e3r_A* 1ogx_A 2inx_A 2pzv_A 1c7h_A 1dmn_A 1k41_A 1oho_A* 3fzw_A* 1cqs_A* 1w00_A 1e97_A 1w6y_A* 3ipt_A* ... Back     alignment and structure
>2a15_A Hypothetical protein RV0760C; beta-alpha-barrel, structural genomics, PSI, protein structure initiative; 1.68A {Mycobacterium tuberculosis} SCOP: d.17.4.3 PDB: 2z76_A* 2z77_A* 2z7a_A Back     alignment and structure
>1z1s_A Hypothetical protein PA3332; beta barrel, conserved hypothetical protein, structural genomics, PSI, protein structure initiative; HET: PGE; 1.49A {Pseudomonas aeruginosa PAO1} SCOP: d.17.4.10 Back     alignment and structure
>3dxo_A Uncharacterized snoal-like protein; putative isomerase of the snoal-like family; HET: MSE PGE; 2.70A {Agrobacterium tumefaciens str} SCOP: d.17.4.19 Back     alignment and structure
>1nww_A Limonene-1,2-epoxide hydrolase; HET: MES; 1.20A {Rhodococcus erythropolis} SCOP: d.17.4.8 PDB: 1nu3_A* Back     alignment and structure
>3ef8_A Putative scyalone dehydratase; YP_496742.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE PGE PG4; 1.50A {Novosphingobium aromaticivorans DSM12444} SCOP: d.17.4.28 Back     alignment and structure
>3ec9_A Uncharacterized NTF2-like protein; structural genomics, joint center for STR genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.60A {Burkholderia thailandensis E264} SCOP: d.17.4.10 Back     alignment and structure
>2bng_A MB2760; epoxide hydrolase, limonene, hydrolase, structural proteomics in europe, spine, structural genomics; 2.5A {Mycobacterium tuberculosis} SCOP: d.17.4.8 Back     alignment and structure
>2k54_A Protein ATU0742; protein of unknown function, structural genomics, PSI-2, Pro structure initiative; NMR {Agrobacterium tumefaciens str} SCOP: d.17.4.29 Back     alignment and structure
>3ke7_A Putative ketosteroid isomerase; structural genomics, joint C structural genomics, JCSG, protein structure initiative; HET: MSE BCN; 1.45A {Parabacteroides distasonis atcc 8503} Back     alignment and structure
>2f86_B Hypothetical protein K11E8.1D; UNC-43, oligomerization domain, transferase; 2.64A {Caenorhabditis elegans} SCOP: d.17.4.7 Back     alignment and structure
>3g8z_A Protein of unknown function with cystatin-like FO; NP_639274.1, snoal-like polyketide cyclase; HET: MSE; 1.90A {Xanthomonas campestris PV} Back     alignment and structure
>3i0y_A Putative polyketide cyclase; cystatin-like fold, structural genomics, joint center for ST genomics, JCSG, protein structure initiative; HET: MSE UNL; 1.50A {Xanthomonas campestris PV} Back     alignment and structure
>3mso_A Steroid delta-isomerase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE; 2.57A {Pseudomonas aeruginosa} Back     alignment and structure
>3fh1_A Uncharacterized NTF2-like protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE; 1.60A {Mesorhizobium loti} Back     alignment and structure
>3rga_A Epoxide hydrolase; NTF2-like, epoxide-opening cyclic ether formation, isomerase; HET: LSB ILD; 1.59A {Streptomyces lasaliensis} Back     alignment and structure
>3ff2_A Uncharacterized cystatin fold protein (YP_497570. NTF2 superfamily; structural genomics; 1.90A {Novosphingobium aromaticivorans dsm 12ORGANISM_TAXID} Back     alignment and structure
>3g16_A Uncharacterized protein with cystatin-like fold; YP_001022489.1, protein of unknown function with cystatin-LI structural genomics; HET: MSE; 1.45A {Methylibium petroleiphilum PM1} Back     alignment and structure
>1tuh_A BAL32A, hypothetical protein EGC068; unknown function; 1.85A {Uncultured bacterium} SCOP: d.17.4.11 Back     alignment and structure
>3f8x_A Putative delta-5-3-ketosteroid isomerase; structural genomics, joint center for structural genomics; HET: MSE; 1.55A {Pectobacterium atrosepticum SCRI1043} Back     alignment and structure
>3fgy_A Uncharacterized NTF2-like protein; structural genomics, joint center for STR genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.59A {Burkholderia xenovorans LB400} SCOP: d.17.4.0 Back     alignment and structure
>3hk4_A MLR7391 protein; NTF2-like protein, structural genomics, joint center for STR genomics, JCSG, protein structure initiative, PSI-2, lyase; HET: MSE; 1.96A {Mesorhizobium loti} Back     alignment and structure
>1jkg_B TAP; NTF2-like domain, transport protein; 1.90A {Homo sapiens} SCOP: d.17.4.2 PDB: 1jn5_B 1go5_A Back     alignment and structure
>3grd_A Uncharacterized NTF2-superfamily protein; NP_977240.1, NTF2-superfamily protein with unknown function, structural genomics; HET: MSE; 1.25A {Bacillus cereus atcc 10987} SCOP: d.17.4.0 Back     alignment and structure
>3f40_A Uncharacterized NTF2-like protein; YP_677363.1, NTF2-like protein of unknown function, structural genomics; HET: MSE; 1.27A {Cytophaga hutchinsonii atcc 33406} Back     alignment and structure
>2gey_A ACLR protein; alpha+beta barrel, oxidoreductase; HET: PG4; 1.80A {Streptomyces galilaeus} SCOP: d.17.4.9 Back     alignment and structure
>3f8h_A Putative polyketide cyclase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, unknown function; HET: MSE; 2.00A {Silicibacter SP} Back     alignment and structure
>3ehc_A Snoal-like polyketide cyclase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 2.12A {Agrobacterium tumefaciens str} Back     alignment and structure
>1of5_A MRNA export factor MEX67; nuclear protein, repeat, leucine- rich repeat, nuclear transport; 2.8A {Saccharomyces cerevisiae} SCOP: d.17.4.2 Back     alignment and structure
>1sjw_A Nogalonic acid methyl ester cyclase; anthracyclines, nogalamycin, snoal, aldol condensation, LYAS structural genomics; HET: NGV; 1.35A {Streptomyces nogalater} SCOP: d.17.4.9 Back     alignment and structure
>1q40_B MEX67, mRNA export factor MEX67; NTF2-fold, nuclear export, translation; 1.95A {Candida albicans} SCOP: d.17.4.2 Back     alignment and structure
>2gex_A SNOL; alpha+beta barrel, oxidoreductase; 2.50A {Streptomyces nogalater} SCOP: d.17.4.9 Back     alignment and structure
>3k0z_A Putative polyketide cyclase; structural genomics, joint CENT structural genomics, JCSG, protein structure initiative, PS lipoprotein; HET: NHE; 1.91A {Bacillus cereus} Back     alignment and structure
>3f9s_A Putative polyketide cyclase; structural genomics, joint center for structural genomics, J protein structure initiative; 1.76A {Acidithiobacillus ferrooxidans atcc 23} Back     alignment and structure
>3kkg_A Putative snoal-like polyketide cyclase; structural genomics, center for structural genomics, JCSG, protein structure INI PSI-2, lyase; HET: MSE PGE; 1.40A {Jannaschia SP} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 177
d1zo2a1117 d.17.4.2 (A:10-126) Nuclear transport factor-2 (NT 1e-45
d1gy6a_125 d.17.4.2 (A:) Nuclear transport factor-2 (NTF2) {R 2e-41
d1jkga_139 d.17.4.2 (A:) NTF2-related export protein 1 (p15) 4e-40
d1gy7a_121 d.17.4.2 (A:) Nuclear transport factor-2 (NTF2) {B 5e-39
d2qiya1139 d.17.4.2 (A:3-141) UBP3-associated protein BRE5 {B 1e-37
d1jkgb_186 d.17.4.2 (B:) NTF2-like domain of Tip associating 0.001
>d1zo2a1 d.17.4.2 (A:10-126) Nuclear transport factor-2 (NTF2) {Cryptosporidium parvum [TaxId: 5807]} Length = 117 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Cystatin-like
superfamily: NTF2-like
family: NTF2-like
domain: Nuclear transport factor-2 (NTF2)
species: Cryptosporidium parvum [TaxId: 5807]

 Score =  144 bits (364), Expect = 1e-45
 Identities = 32/120 (26%), Positives = 50/120 (41%), Gaps = 8/120 (6%)

Query: 34  VGREFVRQYYTLLNQAPAHLHRFYSENSLFIHGGLDAPNRETKQVVGQEQIHEHIQQLNF 93
           +G++FV+ YY         L   Y   S+              Q  GQ  I      LNF
Sbjct: 4   IGKQFVQHYYQTFQTNRPALGGLYGPQSMLTWED--------TQFQGQANIVNKFNSLNF 55

Query: 94  RDCHAKIRQVDSQATLGNGVVVQVSGELSNGGQPMRRFTQTFVLAAQSPKKYYVHNDIFR 153
           +    +I +VD Q +  NG +V V+G++        +F+Q F L       + + ND+FR
Sbjct: 56  QRVQFEITRVDCQPSPNNGSIVFVTGDVRIDDGQPLKFSQVFNLMPSGNGGFMIFNDLFR 115
>d1gy6a_ d.17.4.2 (A:) Nuclear transport factor-2 (NTF2) {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 125 Back     information, alignment and structure
>d1jkga_ d.17.4.2 (A:) NTF2-related export protein 1 (p15) {Human (Homo sapiens) [TaxId: 9606]} Length = 139 Back     information, alignment and structure
>d1gy7a_ d.17.4.2 (A:) Nuclear transport factor-2 (NTF2) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 121 Back     information, alignment and structure
>d2qiya1 d.17.4.2 (A:3-141) UBP3-associated protein BRE5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 139 Back     information, alignment and structure
>d1jkgb_ d.17.4.2 (B:) NTF2-like domain of Tip associating protein, TAP {Human (Homo sapiens) [TaxId: 9606]} Length = 186 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query177
d1gy6a_125 Nuclear transport factor-2 (NTF2) {Rat (Rattus nor 100.0
d1zo2a1117 Nuclear transport factor-2 (NTF2) {Cryptosporidium 100.0
d1jkga_139 NTF2-related export protein 1 (p15) {Human (Homo s 100.0
d1gy7a_121 Nuclear transport factor-2 (NTF2) {Baker's yeast ( 100.0
d2qiya1139 UBP3-associated protein BRE5 {Baker's yeast (Sacch 99.98
d1q40b_205 NTF2-like domain of mRNA export factor MEX67 {Yeas 99.84
d1jkgb_186 NTF2-like domain of Tip associating protein, TAP { 99.83
d1of5a_221 NTF2-like domain of mRNA export factor MEX67 {Bake 99.81
d1of5b_165 mRNA transport regulator MTR2 {Baker's yeast (Sacc 99.62
d1q42a_174 mRNA transport regulator MTR2 {Yeast (Candida albi 98.56
d2owpa1128 Hypothetical protein BxeB1374 {Burkholderia xenovo 97.88
d2rcda1127 Uncharacterized protein ECA3500 {Pectobacterium at 97.87
d3cu3a1162 Uncharacterized protein NpunR1993 {Nostoc punctifo 97.72
d3d9ra1132 Uncharacterized protein ECA1476 {Pectobacterium at 97.68
d3b7ca1121 Uncharacterized protein SO0125 {Shewanella oneiden 97.6
d2gxfa1128 Hypothetical protein YybH {Bacillus subtilis [TaxI 97.49
d3bb9a1121 Uncharacterized protein Sfri1973 {Shewanella frigi 97.48
d2f86b1129 Association domain of calcium/calmodulin-dependent 97.15
d3en8a1127 Uncharacterized protein BxeB2092 {Burkholderia xen 97.11
d1m98a2142 Orange carotenoid protein, C-terminal domain {Cyan 97.1
d3dmca1133 Uncharacterized protein Ava2261 {Anabaena variabil 96.98
d2ux0a1135 Association domain of calcium/calmodulin-dependent 96.91
d1z1sa1129 Uncharacterized protein PA3332 {Pseudomonas aerugi 96.51
d3dm8a1135 Uncharacterized protein Rpa4348 {Rhodopseudomonas 96.41
d1zo2a1117 Nuclear transport factor-2 (NTF2) {Cryptosporidium 96.41
d1gy7a_121 Nuclear transport factor-2 (NTF2) {Baker's yeast ( 96.27
d2r4ia1122 Uncharacterized protein CHU142 {Cytophaga hutchins 96.26
d1s5aa_139 Hypothetical protein YesE {Bacillus subtilis [TaxI 96.25
d3cnxa1153 Uncharacterized protein SAV4671 {Streptomyces aver 96.14
d2bnga1132 Uncharacterized protein Mb2760 {Mycobacterium tube 96.1
d1oh0a_125 Delta-5-3-ketosteroid isomerase, steroid delta-iso 96.06
d2rgqa1133 Uncharacterized protein NpunR3134 {Nostoc punctifo 95.88
d2qiya1139 UBP3-associated protein BRE5 {Baker's yeast (Sacch 95.88
d3ebta1131 Uncharacterized protein BPSS0132 {Burkholderia pse 95.88
d2a15a1132 Hypothetical protein Rv0760c {Mycobacterium tuberc 95.79
d1ohpa1125 Delta-5-3-ketosteroid isomerase, steroid delta-iso 95.31
d1tuha_131 Hypothetical protein egc068 from a soil-derived mo 94.96
d3blza1124 Uncharacterized protein Sbal0622 {Shewanella balti 94.94
d3b8la1144 Uncharacterized protein Saro3538 {Novosphingobium 94.69
d3ec9a1130 Uncharacterized protein BTHI0051 {Burkholderia tha 94.54
d1nwwa_145 Limonene-1,2-epoxide hydrolase {Rhodococcus erythr 94.28
d1jkga_139 NTF2-related export protein 1 (p15) {Human (Homo s 94.12
d2rfra1153 Uncharacterized protein Saro3722 {Novosphingobium 93.9
d2chca1167 Uncharacterized protein Rv3472 {Mycobacterium tube 93.6
d2k54a1123 Uncharacterized protein Atu0742 {Agrobacterium tum 92.19
d3dxoa1117 Uncharacterized protein Atu0744 {Agrobacterium tum 89.38
d3ef8a1149 Uncharacterized protein Saro1465 {Novosphingobium 88.68
d2gexa1138 Nogalamycin biosynthesis protein SnoL {Streptomyce 88.01
d2geya1144 Putative hydroxylase AclR {Streptomyces galilaeus 86.59
d3er7a1118 Uncharacterized protein Exig0174 {Exiguobacterium 80.76
>d1gy6a_ d.17.4.2 (A:) Nuclear transport factor-2 (NTF2) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Cystatin-like
superfamily: NTF2-like
family: NTF2-like
domain: Nuclear transport factor-2 (NTF2)
species: Rat (Rattus norvegicus) [TaxId: 10116]

Probab=100.00  E-value=2.7e-38  Score=234.66  Aligned_cols=123  Identities=26%  Similarity=0.460  Sum_probs=113.9

Q ss_pred             CCCHHHHHHHHHHHHHHhcCCCchhHHHHHHHHHHHHHHHHhcChhhHhccccCCceEEecCCCCCCcccceecCHHHHH
Q psy6106           6 TPSPQCVGREFVRQYYTLLNQAPAHLHRVGREFVRQYYTLLNQAPAHLHRFYSENSLFIHGGLDAPNRETKQVVGQEQIH   85 (177)
Q Consensus         6 ~~~~~~~~~~fv~~yy~~~~~~~~~~~~va~~Fv~~YY~~l~~~r~~L~~fY~~~S~~~~~g~~~~~~~~~~~~G~~~I~   85 (177)
                      +|+++.||++||+|||+                      +|+++|+.|++||+++|.|+|+|        ..+.|+++|.
T Consensus         2 ~p~~e~ig~~Fv~~YY~----------------------~l~~~r~~L~~~Y~~~S~l~~~g--------~~~~G~~~I~   51 (125)
T d1gy6a_           2 KPIWEQIGSSFIQHYYQ----------------------LFDNDRTQLGAIYIDASCLTWEG--------QQFQGKAAIV   51 (125)
T ss_dssp             CCHHHHHHHHHHHHHHH----------------------HHHHHGGGGGGGEEEEEEEEETT--------EEEESHHHHH
T ss_pred             CCCHHHHHHHHHHHHHH----------------------HHhCCHHHHHHHcCCCcEEEECC--------ccccCHHHHH
Confidence            68888888888888887                      77789999999999999999977        7899999999


Q ss_pred             HHHhhCCCccccEEEeEEeeeeeCCCcEEEEEEeEeeeCCCCCceeEEEEEEEeeCCCcEEEEcceEEeecccC
Q psy6106          86 EHIQQLNFRDCHAKIRQVDSQATLGNGVVVQVSGELSNGGQPMRRFTQTFVLAAQSPKKYYVHNDIFRYQDFLV  159 (177)
Q Consensus        86 ~~l~~lp~~~~~~~I~svD~Q~~~~~~ilI~V~G~v~~~~~~~r~FsqtFvL~~~~~~~y~I~nD~fr~~d~~~  159 (177)
                      ++|++||+++++|+|.++||||+++++|+|+|+|.++.+++++|+|+|+|+|++. +++|+|.||+|||+....
T Consensus        52 ~~l~~lp~~~~~~~i~~~D~Q~~~~~~ili~V~G~~~~~~~~~~~F~qtF~L~~~-~~~y~I~NDiFR~v~~~~  124 (125)
T d1gy6a_          52 EKLSSLPFQKIQHSITAQDHQPTPDSCIISMVVGQLKADEDPIMGFHQMFLLKNI-NDAWVCTNDMFRLALHNF  124 (125)
T ss_dssp             HHHHHCSCSCEEEEEEEEEEEECTTSCEEEEEEEEEEETTSCCEEEEEEEEEEEE-TTEEEEEEEEEEECCCCC
T ss_pred             HHHHcCCCcccEEEEeEEEEEEcCCCCEEEEEEEEEEECCCCCcceEEEEEEecc-CCEEEEEeeEEEEEeccC
Confidence            9999999988999999999999999999999999999999889999999999998 589999999999987654
>d1zo2a1 d.17.4.2 (A:10-126) Nuclear transport factor-2 (NTF2) {Cryptosporidium parvum [TaxId: 5807]} Back     information, alignment and structure
>d1jkga_ d.17.4.2 (A:) NTF2-related export protein 1 (p15) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gy7a_ d.17.4.2 (A:) Nuclear transport factor-2 (NTF2) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2qiya1 d.17.4.2 (A:3-141) UBP3-associated protein BRE5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1q40b_ d.17.4.2 (B:) NTF2-like domain of mRNA export factor MEX67 {Yeast (Candida albicans) [TaxId: 5476]} Back     information, alignment and structure
>d1jkgb_ d.17.4.2 (B:) NTF2-like domain of Tip associating protein, TAP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1of5a_ d.17.4.2 (A:) NTF2-like domain of mRNA export factor MEX67 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1of5b_ d.17.4.2 (B:) mRNA transport regulator MTR2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1q42a_ d.17.4.2 (A:) mRNA transport regulator MTR2 {Yeast (Candida albicans) [TaxId: 5476]} Back     information, alignment and structure
>d2owpa1 d.17.4.18 (A:1-128) Hypothetical protein BxeB1374 {Burkholderia xenovorans [TaxId: 36873]} Back     information, alignment and structure
>d2rcda1 d.17.4.18 (A:1-127) Uncharacterized protein ECA3500 {Pectobacterium atrosepticum [TaxId: 29471]} Back     information, alignment and structure
>d3cu3a1 d.17.4.28 (A:9-170) Uncharacterized protein NpunR1993 {Nostoc punctiforme [TaxId: 272131]} Back     information, alignment and structure
>d3d9ra1 d.17.4.27 (A:3-134) Uncharacterized protein ECA1476 {Pectobacterium atrosepticum [TaxId: 29471]} Back     information, alignment and structure
>d3b7ca1 d.17.4.16 (A:1-121) Uncharacterized protein SO0125 {Shewanella oneidensis [TaxId: 70863]} Back     information, alignment and structure
>d2gxfa1 d.17.4.22 (A:1-128) Hypothetical protein YybH {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d3bb9a1 d.17.4.16 (A:27-147) Uncharacterized protein Sfri1973 {Shewanella frigidimarina [TaxId: 56812]} Back     information, alignment and structure
>d2f86b1 d.17.4.7 (B:343-471) Association domain of calcium/calmodulin-dependent protein kinase type II alpha subunit, CAMK2A {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d3en8a1 d.17.4.20 (A:1-127) Uncharacterized protein BxeB2092 {Burkholderia xenovorans [TaxId: 36873]} Back     information, alignment and structure
>d1m98a2 d.17.4.6 (A:176-317) Orange carotenoid protein, C-terminal domain {Cyanobacteria (Arthrospira maxima) [TaxId: 129910]} Back     information, alignment and structure
>d3dmca1 d.17.4.10 (A:1-133) Uncharacterized protein Ava2261 {Anabaena variabilis [TaxId: 1172]} Back     information, alignment and structure
>d2ux0a1 d.17.4.7 (A:387-521) Association domain of calcium/calmodulin-dependent protein kinase type II alpha subunit, CAMK2A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z1sa1 d.17.4.10 (A:1-129) Uncharacterized protein PA3332 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d3dm8a1 d.17.4.20 (A:1-135) Uncharacterized protein Rpa4348 {Rhodopseudomonas palustris [TaxId: 1076]} Back     information, alignment and structure
>d1zo2a1 d.17.4.2 (A:10-126) Nuclear transport factor-2 (NTF2) {Cryptosporidium parvum [TaxId: 5807]} Back     information, alignment and structure
>d1gy7a_ d.17.4.2 (A:) Nuclear transport factor-2 (NTF2) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2r4ia1 d.17.4.15 (A:1-122) Uncharacterized protein CHU142 {Cytophaga hutchinsonii [TaxId: 985]} Back     information, alignment and structure
>d1s5aa_ d.17.4.10 (A:) Hypothetical protein YesE {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d3cnxa1 d.17.4.17 (A:5-157) Uncharacterized protein SAV4671 {Streptomyces avermitilis [TaxId: 33903]} Back     information, alignment and structure
>d2bnga1 d.17.4.8 (A:13-144) Uncharacterized protein Mb2760 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1oh0a_ d.17.4.3 (A:) Delta-5-3-ketosteroid isomerase, steroid delta-isomerase, KSI {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d2rgqa1 d.17.4.25 (A:1-133) Uncharacterized protein NpunR3134 {Nostoc punctiforme [TaxId: 272131]} Back     information, alignment and structure
>d2qiya1 d.17.4.2 (A:3-141) UBP3-associated protein BRE5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d3ebta1 d.17.4.9 (A:1-131) Uncharacterized protein BPSS0132 {Burkholderia pseudomallei [TaxId: 28450]} Back     information, alignment and structure
>d2a15a1 d.17.4.3 (A:5-136) Hypothetical protein Rv0760c {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1ohpa1 d.17.4.3 (A:1-125) Delta-5-3-ketosteroid isomerase, steroid delta-isomerase, KSI {Comamonas testosteroni, also known as Pseudomonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d1tuha_ d.17.4.11 (A:) Hypothetical protein egc068 from a soil-derived mobile gene cassette {uncultured organism [TaxId: 155900]} Back     information, alignment and structure
>d3blza1 d.17.4.14 (A:3-126) Uncharacterized protein Sbal0622 {Shewanella baltica [TaxId: 62322]} Back     information, alignment and structure
>d3b8la1 d.17.4.28 (A:1-144) Uncharacterized protein Saro3538 {Novosphingobium aromaticivorans [TaxId: 48935]} Back     information, alignment and structure
>d3ec9a1 d.17.4.10 (A:10-139) Uncharacterized protein BTHI0051 {Burkholderia thailandensis [TaxId: 57975]} Back     information, alignment and structure
>d1nwwa_ d.17.4.8 (A:) Limonene-1,2-epoxide hydrolase {Rhodococcus erythropolis [TaxId: 1833]} Back     information, alignment and structure
>d1jkga_ d.17.4.2 (A:) NTF2-related export protein 1 (p15) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2rfra1 d.17.4.28 (A:1-153) Uncharacterized protein Saro3722 {Novosphingobium aromaticivorans [TaxId: 48935]} Back     information, alignment and structure
>d2chca1 d.17.4.25 (A:1-167) Uncharacterized protein Rv3472 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2k54a1 d.17.4.29 (A:1-123) Uncharacterized protein Atu0742 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d3dxoa1 d.17.4.19 (A:1-117) Uncharacterized protein Atu0744 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d3ef8a1 d.17.4.28 (A:1-149) Uncharacterized protein Saro1465 {Novosphingobium aromaticivorans [TaxId: 48935]} Back     information, alignment and structure
>d2gexa1 d.17.4.9 (A:2-139) Nogalamycin biosynthesis protein SnoL {Streptomyces nogalater [TaxId: 38314]} Back     information, alignment and structure
>d2geya1 d.17.4.9 (A:2-145) Putative hydroxylase AclR {Streptomyces galilaeus [TaxId: 33899]} Back     information, alignment and structure
>d3er7a1 d.17.4.24 (A:5-122) Uncharacterized protein Exig0174 {Exiguobacterium sibiricum 255-15 [TaxId: 262543]} Back     information, alignment and structure