Diaphorina citri psyllid: psy610

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------13
MCPLFFCPQHANNVRRYAEEHMAKRQAQGKDVHSIAISVLNLPPVKHLPGAKPGTFFARDNVSNFIGWSRRGLGVFECLLFETDDLIMRKNEKHVILCLLEIISGEKFEISKTPPKKLNTYTILPSLV
cccCEEcHHHHcHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccHHHHHHHHHHHHHHccccccEEccccccccccccccHHHHHHHHHHHHccccccccccccccccccccccc
MCPLFFCPQHANNVRRYAEEHM*********VHSIAISVLNLPPVKHLPGAKPGTFFARDNVSNFIGWSRRGLGVFECLLFETDDLIMRKNEKHVILCLLEIISGEKFEISKTPPKKLNTYTILPSLV
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MCPLFFCPQHANNVRRYAEEHMAKRQAQGKDVHSIAISVLNLPPVKHLPGAKPGTFFARDNVSNFIGWSRRGLGVFECLLFETDDLIMRKNEKHVILCLLEIISGEKFEISKTPPKKLNTYTILPSLV

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0097067 [BP]cellular response to thyroid hormone stimulusprobableGO:0071495, GO:0009719, GO:0051716, GO:0097066, GO:0009725, GO:0050896, GO:0009987, GO:0071310, GO:0008150, GO:0032870, GO:0044763, GO:0070887, GO:0042221, GO:0010033, GO:0044699
GO:0045647 [BP]negative regulation of erythrocyte differentiationprobableGO:0051093, GO:0050793, GO:0045646, GO:0045595, GO:0032844, GO:0050789, GO:0045596, GO:0045638, GO:0065007, GO:0002682, GO:0008150, GO:0051239, GO:0048519, GO:2000026, GO:0050794, GO:0045637, GO:0048523
GO:0003779 [MF]actin bindingprobableGO:0003674, GO:0005488, GO:0005515, GO:0008092
GO:0008017 [MF]microtubule bindingprobableGO:0015631, GO:0003674, GO:0005488, GO:0005515, GO:0008092
GO:0005881 [CC]cytoplasmic microtubuleprobableGO:0005737, GO:0043234, GO:0015630, GO:0032991, GO:0005575, GO:0043232, GO:0005856, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0044446, GO:0044444, GO:0044430, GO:0044424, GO:0043228, GO:0005874, GO:0043226, GO:0044422
GO:0008093 [MF]cytoskeletal adaptor activityprobableGO:0030674, GO:0008092, GO:0003674, GO:0005488, GO:0005515, GO:0060090
GO:0030308 [BP]negative regulation of cell growthprobableGO:0045926, GO:0040008, GO:0051128, GO:0008150, GO:0001558, GO:0065007, GO:0048519, GO:0050794, GO:0050789, GO:0048523
GO:0051726 [BP]regulation of cell cycleprobableGO:0008150, GO:0065007, GO:0050789, GO:0050794
GO:0010629 [BP]negative regulation of gene expressionprobableGO:0009892, GO:0019222, GO:0060255, GO:0050789, GO:0008150, GO:0065007, GO:0048519, GO:0010605, GO:0010468
GO:0000226 [BP]microtubule cytoskeleton organizationprobableGO:0006996, GO:0007017, GO:0007010, GO:0009987, GO:0016043, GO:0044763, GO:0071840, GO:0008150, GO:0044699
GO:0015629 [CC]actin cytoskeletonprobableGO:0005856, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0043228, GO:0044424, GO:0043226
GO:0046966 [MF]thyroid hormone receptor bindingprobableGO:0008134, GO:0035257, GO:0003674, GO:0005488, GO:0005515, GO:0051427, GO:0005102

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1WYM, chain A
Confidence level:very confident
Coverage over the Query: 3-18,29-33,44-117
View the alignment between query and template
View the model in PyMOL