Diaphorina citri psyllid: psy6110


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170----
MVMEVTPSPQCVGREFVRQYYTLLNQAPAHLHRFYSENSLFIHGGLDAPNRETKQVVGQEQIHEHIQQLNFRDCHAKIRQVPVTQQFPTVKQVEESLPPVTQPPSPPADPTPPSPPKEDEWKWNEQTPVEAPRSPSPPPPPSNEPKTYANLLKGSHSHSTTSSYQKPLSPLDIS
ccccccccHHHHHHHHHHHHHHHHHcccHHHHHccccccEEEEcccccccccccEEEcHHHHHHHHHcccccccEEEEEEEcccccccEEEEEEEEEccccccccccccccccccccccccECccccccccccccccccccccccccccccccccccccccccccccccccccc
******P***CVGREFVRQYYTLLNQAPAHLHRFYSENSLFIHGGLDAPNRETKQVVGQEQIHEHIQQLNFRDCHAKIRQVPVTQQFPTVKQVEESLPPVTQPPSPPADPTPPSPPKEDEWKWNE*************************************************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVMEVTPSPQCVGREFVRQYYTLLNQAPAHLHRFYSENSLFIHGGLDAPNRETKQVVGQEQIHEHIQQLNFRDCHAKIRQVPVTQQFPTVKQVEESLPPVTQPPSPPADPTPPSPPKEDEWKWNEQTPVEAPRSPSPPPPPSNEPKTYANLLKGSHSHSTTSSYQKPLSPLDIS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Ras GTPase-activating protein-binding protein 2 Probable scaffold protein that may be involved in mRNA transport.confidentQ5R9L3
Ras GTPase-activating protein-binding protein 2 Probable scaffold protein that may be involved in mRNA transport.confidentP97379
Ras GTPase-activating protein-binding protein 2 Probable scaffold protein that may be involved in mRNA transport.confidentQ9UN86

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0010494 [CC]cytoplasmic stress granuleprobableGO:0005737, GO:0035770, GO:0043232, GO:0044464, GO:0043229, GO:0005623, GO:0030529, GO:0005575, GO:0044444, GO:0043228, GO:0044424, GO:0032991, GO:0005622, GO:0043226
GO:0071011 [CC]precatalytic spliceosomeprobableGO:0005575, GO:0032991, GO:0043231, GO:0005634, GO:0044464, GO:0005623, GO:0030529, GO:0044446, GO:0043229, GO:0044428, GO:0044422, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0005681
GO:0071013 [CC]catalytic step 2 spliceosomeprobableGO:0005575, GO:0032991, GO:0043231, GO:0005634, GO:0044464, GO:0005623, GO:0030529, GO:0044446, GO:0043229, GO:0044428, GO:0044422, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0005681
GO:0003729 [MF]mRNA bindingprobableGO:0097159, GO:0003674, GO:0005488, GO:0003676, GO:1901363, GO:0003723
GO:0005811 [CC]lipid particleprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0007264 [BP]small GTPase mediated signal transductionprobableGO:0044700, GO:0051716, GO:0050896, GO:0009987, GO:0050794, GO:0008150, GO:0065007, GO:0044763, GO:0007165, GO:0023052, GO:0007154, GO:0035556, GO:0050789, GO:0044699

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3Q90, chain A
Confidence level:very confident
Coverage over the Query: 8-42,53-102,120-133
View the alignment between query and template
View the model in PyMOL