Psyllid ID: psy6110


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170----
MVMEVTPSPQCVGREFVRQYYTLLNQAPAHLHRFYSENSLFIHGGLDAPNRETKQVVGQEQIHEHIQQLNFRDCHAKIRQVPVTQQFPTVKQVEESLPPVTQPPSPPADPTPPSPPKEDEWKWNEQTPVEAPRSPSPPPPPSNEPKTYANLLKGSHSHSTTSSYQKPLSPLDIS
ccccccccHHHHHHHHHHHHHHHHHccHHHHHHccccccEEEEcccccccccccEEEcHHHHHHHHHcccccccEEEEEEEcccccccEEEEEEEEEccccccccccccccccccccccccEEccccccccccccccccccccccccccccccccccccccccccccccccccc
ccccccccHHHHHHHHHHHHHHHHHcccHHHHEEEccccEEEEcccccccccccEEEcHHHHHHHHHHccccccEEEEEEEEccccccEEEEEEEEEcccccccccccccccccccccccEEcccccccccccccccccccccccccccccccEEccccccEEEcccccccccc
mvmevtpspqcvgreFVRQYYTLLNqapahlhrfysenslfihggldapnretkqvVGQEQIHEHIQQLnfrdchakirqvpvtqqfptvkqveeslppvtqppsppadptppsppkedewkwneqtpveaprspspppppsnepktyanllkgshshsttssyqkplspldis
mvmevtpspqcvgREFVRQYYTLLNQAPAHLHRFYSENSLFIHGGLDAPNRETKQVVGQEQIHEHIQQLNFRDCHAKIRQVPVTQQFPTVKQVEESLPPVTQPPSPPADPTPPSPPKEDEWKWNEQTPVEAprspspppppsnEPKTYANLLKGShshsttssyqkplspldis
MVMEVTPSPQCVGREFVRQYYTLLNQAPAHLHRFYSENSLFIHGGLDAPNRETKQVVGQEQIHEHIQQLNFRDCHAKIRQVPVTQQFPTVKQVEESLppvtqppsppadptppsppKEDEWKWNEQTPVEAprspspppppsNEPKTYANLLKGSHSHSTTSSYQKPLSPLDIS
**********CVGREFVRQYYTLLNQAPAHLHRFYSENSLFIHGGLDAPNRETKQVVGQEQIHEHIQQLNFRDCHAKIRQVPVTQQF***************************************************************************************
******P***CVGREFVRQYYTLLNQAPAHLHRFYSENSLFIHGG*****RETKQVVGQEQIHEHIQQLNFRDCHAKIRQVPVTQQFPTVKQVEESLPPVTQPPSPPADPTPPSPPKEDEWKWNE*************************************************
********PQCVGREFVRQYYTLLNQAPAHLHRFYSENSLFIHGGLDAPNRETKQVVGQEQIHEHIQQLNFRDCHAKIRQVPVTQQFPTVKQ****************************WKWNE******************EPKTYANLLK*********************
*****TPSPQCVGREFVRQYYTLLNQAPAHLHRFYSENSLFIHGGLDAPNRETKQVVGQEQIHEHIQQLNFRDCHAKIRQVPVTQQFPTVKQVEESLPPVTQPPSPPADPTPPSPPKEDEWKWNEQTP************************K*S******SSYQ**LS*****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVMEVTPSPQCVGREFVRQYYTLLNQAPAHLHRFYSENSLFIHGGLDAPNRETKQVVGQEQIHEHIQQLNFRDCHAKIRQVPVTQQFPTVKQVEESLPPVTQPPSPPADPTPPSPPKEDEWKWNEQTPVEAPRSPSPPPPPSNEPKTYANLLKGSHSHSTTSSYQKPLSPLDIS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query174 2.2.26 [Sep-21-2011]
P97379 482 Ras GTPase-activating pro yes N/A 0.459 0.165 0.604 2e-23
Q5R9L3 482 Ras GTPase-activating pro yes N/A 0.459 0.165 0.604 3e-23
Q9UN86 482 Ras GTPase-activating pro yes N/A 0.459 0.165 0.604 3e-23
Q32LC7 465 Ras GTPase-activating pro no N/A 0.459 0.172 0.604 5e-23
Q13283 466 Ras GTPase-activating pro no N/A 0.459 0.171 0.604 6e-23
Q5RB87 466 Ras GTPase-activating pro no N/A 0.459 0.171 0.604 6e-23
P97855 465 Ras GTPase-activating pro no N/A 0.459 0.172 0.604 1e-22
O94260 434 Putative G3BP-like protei yes N/A 0.385 0.154 0.385 1e-07
>sp|P97379|G3BP2_MOUSE Ras GTPase-activating protein-binding protein 2 OS=Mus musculus GN=G3bp2 PE=1 SV=2 Back     alignment and function desciption
 Score =  108 bits (269), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 49/81 (60%), Positives = 58/81 (71%), Gaps = 1/81 (1%)

Query: 1  MVMEVTPSPQCVGREFVRQYYTLLNQAPAHLHRFYSENSLFIHGGLDAPNRETKQVVGQE 60
          MVME  PSP  VGREFVRQYYTLLN+AP +LHRFY  NS ++HGG+DA  +  + V GQ 
Sbjct: 1  MVME-KPSPLLVGREFVRQYYTLLNKAPEYLHRFYGRNSSYVHGGVDASGKPQEAVYGQN 59

Query: 61 QIHEHIQQLNFRDCHAKIRQV 81
           IH  +  LNF +CH KIR V
Sbjct: 60 DIHHKVLSLNFSECHTKIRHV 80




Probable scaffold protein that may be involved in mRNA transport.
Mus musculus (taxid: 10090)
>sp|Q5R9L3|G3BP2_PONAB Ras GTPase-activating protein-binding protein 2 OS=Pongo abelii GN=G3BP2 PE=2 SV=1 Back     alignment and function description
>sp|Q9UN86|G3BP2_HUMAN Ras GTPase-activating protein-binding protein 2 OS=Homo sapiens GN=G3BP2 PE=1 SV=2 Back     alignment and function description
>sp|Q32LC7|G3BP1_BOVIN Ras GTPase-activating protein-binding protein 1 OS=Bos taurus GN=G3BP PE=2 SV=1 Back     alignment and function description
>sp|Q13283|G3BP1_HUMAN Ras GTPase-activating protein-binding protein 1 OS=Homo sapiens GN=G3BP1 PE=1 SV=1 Back     alignment and function description
>sp|Q5RB87|G3BP1_PONAB Ras GTPase-activating protein-binding protein 1 OS=Pongo abelii GN=G3BP1 PE=2 SV=1 Back     alignment and function description
>sp|P97855|G3BP1_MOUSE Ras GTPase-activating protein-binding protein 1 OS=Mus musculus GN=G3bp1 PE=1 SV=1 Back     alignment and function description
>sp|O94260|G3BP_SCHPO Putative G3BP-like protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=nxt3 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query174
357602466 465 hypothetical protein KGM_21411 [Danaus p 0.465 0.174 0.795 9e-32
157110308 757 hypothetical protein AaeL_AAEL005528 [Ae 0.591 0.136 0.638 5e-31
170051648 687 rasputin [Culex quinquefasciatus] gi|167 0.591 0.149 0.638 1e-30
312383845 909 hypothetical protein AND_02863 [Anophele 0.591 0.113 0.619 3e-30
405961406 496 Ras GTPase-activating protein-binding pr 0.459 0.161 0.740 1e-28
91076984 544 PREDICTED: similar to rasputin CG9412-PB 0.591 0.189 0.685 3e-27
345494268 628 PREDICTED: LOW QUALITY PROTEIN: ras GTPa 0.459 0.127 0.703 5e-27
443685184 504 hypothetical protein CAPTEDRAFT_179128 [ 0.586 0.202 0.609 2e-26
383851131 614 PREDICTED: uncharacterized protein LOC10 0.586 0.166 0.657 4e-26
350396369 621 PREDICTED: hypothetical protein LOC10074 0.586 0.164 0.657 4e-26
>gi|357602466|gb|EHJ63410.1| hypothetical protein KGM_21411 [Danaus plexippus] Back     alignment and taxonomy information
 Score =  141 bits (356), Expect = 9e-32,   Method: Compositional matrix adjust.
 Identities = 66/83 (79%), Positives = 71/83 (85%), Gaps = 2/83 (2%)

Query: 1  MVMEVTPSP--QCVGREFVRQYYTLLNQAPAHLHRFYSENSLFIHGGLDAPNRETKQVVG 58
          MVME +PSP  Q VGREFVRQYYTLLN+APAHLHRFY+  S F+HGGLDAPNRET  VVG
Sbjct: 1  MVMEASPSPSPQSVGREFVRQYYTLLNKAPAHLHRFYNNYSSFVHGGLDAPNRETLPVVG 60

Query: 59 QEQIHEHIQQLNFRDCHAKIRQV 81
          Q+QIH  IQQLNFRDCHAKI QV
Sbjct: 61 QKQIHNRIQQLNFRDCHAKISQV 83




Source: Danaus plexippus

Species: Danaus plexippus

Genus: Danaus

Family: Nymphalidae

Order: Lepidoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|157110308|ref|XP_001651045.1| hypothetical protein AaeL_AAEL005528 [Aedes aegypti] gi|108878769|gb|EAT42994.1| AAEL005528-PA [Aedes aegypti] Back     alignment and taxonomy information
>gi|170051648|ref|XP_001861860.1| rasputin [Culex quinquefasciatus] gi|167872816|gb|EDS36199.1| rasputin [Culex quinquefasciatus] Back     alignment and taxonomy information
>gi|312383845|gb|EFR28759.1| hypothetical protein AND_02863 [Anopheles darlingi] Back     alignment and taxonomy information
>gi|405961406|gb|EKC27215.1| Ras GTPase-activating protein-binding protein 2 [Crassostrea gigas] Back     alignment and taxonomy information
>gi|91076984|ref|XP_975463.1| PREDICTED: similar to rasputin CG9412-PB [Tribolium castaneum] gi|270001993|gb|EEZ98440.1| hypothetical protein TcasGA2_TC000929 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|345494268|ref|XP_001605102.2| PREDICTED: LOW QUALITY PROTEIN: ras GTPase-activating protein-binding protein 1-like [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|443685184|gb|ELT88883.1| hypothetical protein CAPTEDRAFT_179128 [Capitella teleta] Back     alignment and taxonomy information
>gi|383851131|ref|XP_003701093.1| PREDICTED: uncharacterized protein LOC100876463 [Megachile rotundata] Back     alignment and taxonomy information
>gi|350396369|ref|XP_003484531.1| PREDICTED: hypothetical protein LOC100747231 [Bombus impatiens] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query174
FB|FBgn0015778 690 rin "rasputin" [Drosophila mel 0.425 0.107 0.670 1.7e-26
UNIPROTKB|Q5ZMN1 472 G3BP1 "Uncharacterized protein 0.459 0.169 0.629 3.4e-23
ZFIN|ZDB-GENE-030131-7452 477 g3bp1 "GTPase activating prote 0.459 0.167 0.629 4.6e-23
UNIPROTKB|D6RAC7141 G3BP2 "Ras GTPase-activating p 0.459 0.567 0.604 1.3e-22
UNIPROTKB|D6RB17198 G3BP2 "Ras GTPase-activating p 0.459 0.404 0.604 1.3e-22
UNIPROTKB|D6RBR0102 G3BP2 "Ras GTPase-activating p 0.459 0.784 0.604 1.3e-22
UNIPROTKB|D6RBW8116 G3BP2 "Ras GTPase-activating p 0.459 0.689 0.604 1.3e-22
UNIPROTKB|D6RE13111 G3BP2 "Ras GTPase-activating p 0.459 0.720 0.604 1.3e-22
UNIPROTKB|D6REX899 G3BP2 "Ras GTPase-activating p 0.459 0.808 0.604 1.3e-22
UNIPROTKB|D6RGJ4125 G3BP2 "Ras GTPase-activating p 0.459 0.64 0.604 1.3e-22
FB|FBgn0015778 rin "rasputin" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 274 (101.5 bits), Expect = 1.7e-26, Sum P(2) = 1.7e-26
 Identities = 57/85 (67%), Positives = 63/85 (74%)

Query:     1 MVMEVT----PSPQCVGREFVRQYYTLLNQAPAHLHRFYSENSLFIHGGLDAPNRETKQV 56
             MVM+ T    PSPQ VGREFVRQYYTLLN+AP HLHRFY+ NS +IHG       E+K V
Sbjct:     1 MVMDATQSQQPSPQSVGREFVRQYYTLLNKAPNHLHRFYNHNSSYIHG-------ESKLV 53

Query:    57 VGQEQIHEHIQQLNFRDCHAKIRQV 81
             VGQ +IH  IQQLNF DCHAKI QV
Sbjct:    54 VGQREIHNRIQQLNFNDCHAKISQV 78


GO:0017124 "SH3 domain binding" evidence=ISS
GO:0001752 "compound eye photoreceptor fate commitment" evidence=IMP
GO:0007265 "Ras protein signal transduction" evidence=IGI
GO:0005829 "cytosol" evidence=IDA
GO:0016318 "ommatidial rotation" evidence=IMP
GO:0003729 "mRNA binding" evidence=ISS
GO:0003676 "nucleic acid binding" evidence=IEA
GO:0000166 "nucleotide binding" evidence=IEA
GO:0006810 "transport" evidence=IEA
GO:0005811 "lipid particle" evidence=IDA
GO:0071011 "precatalytic spliceosome" evidence=IDA
GO:0071013 "catalytic step 2 spliceosome" evidence=IDA
GO:0000398 "mRNA splicing, via spliceosome" evidence=IC
UNIPROTKB|Q5ZMN1 G3BP1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-030131-7452 g3bp1 "GTPase activating protein (SH3 domain) binding protein 1" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|D6RAC7 G3BP2 "Ras GTPase-activating protein-binding protein 2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|D6RB17 G3BP2 "Ras GTPase-activating protein-binding protein 2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|D6RBR0 G3BP2 "Ras GTPase-activating protein-binding protein 2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|D6RBW8 G3BP2 "Ras GTPase-activating protein-binding protein 2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|D6RE13 G3BP2 "Ras GTPase-activating protein-binding protein 2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|D6REX8 G3BP2 "Ras GTPase-activating protein-binding protein 2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|D6RGJ4 G3BP2 "Ras GTPase-activating protein-binding protein 2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q5R9L3G3BP2_PONABNo assigned EC number0.60490.45970.1659yesN/A
P97379G3BP2_MOUSENo assigned EC number0.60490.45970.1659yesN/A
Q9UN86G3BP2_HUMANNo assigned EC number0.60490.45970.1659yesN/A

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer5.3.3.1LOW CONFIDENCE prediction!
3rd Layer5.3.3LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query174
cd00780119 cd00780, NTF2, Nuclear transport factor 2 (NTF2) d 6e-22
pfam02136116 pfam02136, NTF2, Nuclear transport factor 2 (NTF2) 5e-14
cd00531124 cd00531, NTF2_like, Nuclear transport factor 2 (NT 5e-10
PLN02226 463 PLN02226, PLN02226, 2-oxoglutarate dehydrogenase E 2e-04
PRK14950 585 PRK14950, PRK14950, DNA polymerase III subunits ga 2e-04
PHA03247 3151 PHA03247, PHA03247, large tegument protein UL36; P 3e-04
PRK14950 585 PRK14950, PRK14950, DNA polymerase III subunits ga 0.001
PLN02744 539 PLN02744, PLN02744, dihydrolipoyllysine-residue ac 0.003
>gnl|CDD|238403 cd00780, NTF2, Nuclear transport factor 2 (NTF2) domain plays an important role in the trafficking of macromolecules, ions and small molecules between the cytoplasm and nucleus Back     alignment and domain information
 Score = 85.0 bits (211), Expect = 6e-22
 Identities = 24/74 (32%), Positives = 36/74 (48%), Gaps = 7/74 (9%)

Query: 8  SPQCVGREFVRQYYTLLNQAPAHLHRFYSENSLFIHGGLDAPNRETKQVVGQEQIHEHIQ 67
          S + V + FV+QYY++ +     LHR Y + S+    G        KQV G++ I E + 
Sbjct: 1  SAEDVAKAFVQQYYSIFDNNREGLHRLYGDTSMLSREG-------MKQVTGRDAIVEKLS 53

Query: 68 QLNFRDCHAKIRQV 81
           L F+    KI  V
Sbjct: 54 SLPFQKTKHKITTV 67


This bi-directional transport of macromolecules across the nuclear envelope requires many soluble factors that includes GDP-binding protein Ran (RanGDP). RanGDP is required for both import and export of proteins and poly(A) RNA. RanGDP also has been implicated in cell cycle control, specifically in mitotic spindle assembly. In interphase cells, RanGDP is predominately nuclear and thought to be GTP bound, but it is also present in the cytoplasm, probably in the GDP-bound state. NTF2 mediates the nuclear import of RanGDP. NTF2 binds to both RanGDP and FxFG repeat-containing nucleoporins. Length = 119

>gnl|CDD|216894 pfam02136, NTF2, Nuclear transport factor 2 (NTF2) domain Back     alignment and domain information
>gnl|CDD|238296 cd00531, NTF2_like, Nuclear transport factor 2 (NTF2-like) superfamily Back     alignment and domain information
>gnl|CDD|177871 PLN02226, PLN02226, 2-oxoglutarate dehydrogenase E2 component Back     alignment and domain information
>gnl|CDD|237864 PRK14950, PRK14950, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional Back     alignment and domain information
>gnl|CDD|237864 PRK14950, PRK14950, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|215397 PLN02744, PLN02744, dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 174
KOG2104|consensus126 99.93
KOG0116|consensus 419 99.92
cd00780119 NTF2 Nuclear transport factor 2 (NTF2) domain play 99.92
PF02136118 NTF2: Nuclear transport factor 2 (NTF2) domain; In 99.79
KOG4353|consensus139 99.78
PF10429166 Mtr2: Nuclear pore RNA shuttling protein Mtr2; Int 98.34
cd00531124 NTF2_like Nuclear transport factor 2 (NTF2-like) s 97.78
KOG3763|consensus585 96.13
PF13474121 SnoaL_3: SnoaL-like domain; PDB: 2GXF_A 3KSP_A 3KE 96.07
PF15008262 DUF4518: Domain of unknown function (DUF4518) 95.74
TIGR02246128 conserved hypothetical protein. This family consis 94.42
PF12680102 SnoaL_2: SnoaL-like domain; PDB: 3F40_A 3RGA_A 3G8 93.99
TIGR02096129 conserved hypothetical protein, steroid delta-isom 90.87
cd00781122 ketosteroid_isomerase ketosteroid isomerase: Many 90.79
PF14534107 DUF4440: Domain of unknown function (DUF4440); PDB 88.43
>KOG2104|consensus Back     alignment and domain information
Probab=99.93  E-value=5.5e-26  Score=175.71  Aligned_cols=90  Identities=24%  Similarity=0.429  Sum_probs=85.0

Q ss_pred             CCCHHHHHHHHHHHHHHhhccCchhHhhccccCCceeecCCCCCCcCccccccHHHHHHHHHhCCCCcccEEEeeecccc
Q psy6110           6 TPSPQCVGREFVRQYYTLLNQAPAHLHRFYSENSLFIHGGLDAPNRETKQVVGQEQIHEHIQQLNFRDCHAKIRQVPVTQ   85 (174)
Q Consensus         6 ~ps~~~VG~~FV~qYYt~L~~~p~~L~rFY~~~S~lv~gg~d~~t~eg~~~~G~e~I~eki~sL~f~~~k~~I~SiDaQp   85 (174)
                      ++.++.||.+||++||.+||.+|.+|..||.+.|+|        ||||++++|.++|.||+.+|||++|++.|+++||||
T Consensus         3 d~~~e~v~~~FvqhYY~~FD~dR~ql~~lY~~~S~L--------TfEGqq~qG~~~IveKl~sLpFqkiqh~IttvD~QP   74 (126)
T KOG2104|consen    3 DPVYEAVAKAFVQHYYSLFDNDRSQLGALYIDTSML--------TFEGQQIQGKDAIVEKLTSLPFQKIQHSITTVDSQP   74 (126)
T ss_pred             CccHHHHHHHHHHHHHHHhcCchhHhhhhhccccee--------eEcchhhcchHHHHHHHhcCChhhhhceeeeccccc
Confidence            347799999999999999999999999999999997        569999999999999999999999999999999999


Q ss_pred             CC--CcEEEEEeeecCCCCC
Q psy6110          86 QF--PTVKQVEESLPPVTQP  103 (174)
Q Consensus        86 S~--GILI~VtG~ls~~~~p  103 (174)
                      +.  ||||+|+|+|+.++++
T Consensus        75 t~~g~ilv~V~G~Lk~dEd~   94 (126)
T KOG2104|consen   75 TPDGGILVMVVGQLKLDEDP   94 (126)
T ss_pred             CCCCcEEEEEeeeeeeccCC
Confidence            99  7999999999999664



>KOG0116|consensus Back     alignment and domain information
>cd00780 NTF2 Nuclear transport factor 2 (NTF2) domain plays an important role in the trafficking of macromolecules, ions and small molecules between the cytoplasm and nucleus Back     alignment and domain information
>PF02136 NTF2: Nuclear transport factor 2 (NTF2) domain; InterPro: IPR002075 Nuclear transport factor 2 (NTF2) is a homodimer which stimulates efficient nuclear import of a cargo protein Back     alignment and domain information
>KOG4353|consensus Back     alignment and domain information
>PF10429 Mtr2: Nuclear pore RNA shuttling protein Mtr2; InterPro: IPR019488 Mtr2 is a monomeric, dual-action, RNA-shuttle protein found in yeasts Back     alignment and domain information
>cd00531 NTF2_like Nuclear transport factor 2 (NTF2-like) superfamily Back     alignment and domain information
>KOG3763|consensus Back     alignment and domain information
>PF13474 SnoaL_3: SnoaL-like domain; PDB: 2GXF_A 3KSP_A 3KE7_A 3BB9_E 3CNX_A 3F7S_A 3GWR_B Back     alignment and domain information
>PF15008 DUF4518: Domain of unknown function (DUF4518) Back     alignment and domain information
>TIGR02246 conserved hypothetical protein Back     alignment and domain information
>PF12680 SnoaL_2: SnoaL-like domain; PDB: 3F40_A 3RGA_A 3G8Z_A 3DMC_A 3FH1_A 1TUH_A 3F14_A 3ER7_A 1Z1S_A 3F7X_A Back     alignment and domain information
>TIGR02096 conserved hypothetical protein, steroid delta-isomerase-related Back     alignment and domain information
>cd00781 ketosteroid_isomerase ketosteroid isomerase: Many biological reactions proceed by enzymatic cleavage of a C-H bond adjacent to carbonyl or a carboxyl group, leading to an enol or a enolate intermediate that is subsequently re-protonated at the same or an adjacent carbon Back     alignment and domain information
>PF14534 DUF4440: Domain of unknown function (DUF4440); PDB: 3HX8_A 3SOY_A 3ROB_B 3GZR_A 3B7C_A 3CU3_A 3FSD_A 2R4I_C 1TP6_A Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query174
3q90_A140 Crystal Structure Of The Ntf2 Domain Of Ras Gtpase- 9e-24
3ujm_A120 Crystal Structure Of The Ntf2-Like Domain Of The Dr 2e-22
>pdb|3Q90|A Chain A, Crystal Structure Of The Ntf2 Domain Of Ras Gtpase-Activating Protein- Binding Protein 1 Length = 140 Back     alignment and structure

Iteration: 1

Score = 105 bits (263), Expect = 9e-24, Method: Compositional matrix adjust. Identities = 49/81 (60%), Positives = 58/81 (71%), Gaps = 1/81 (1%) Query: 1 MVMEVTPSPQCVGREFVRQYYTLLNQAPAHLHRFYSENSLFIHGGLDAPNRETKQVVGQE 60 MVME PSP VGREFVRQYYTLLNQAP LHRFY +NS ++HGGLD+ + V GQ+ Sbjct: 2 MVME-KPSPLLVGREFVRQYYTLLNQAPDMLHRFYGKNSSYVHGGLDSNGKPADAVYGQK 60 Query: 61 QIHEHIQQLNFRDCHAKIRQV 81 +IH + NF +CH KIR V Sbjct: 61 EIHRKVMSQNFTNCHTKIRHV 81
>pdb|3UJM|A Chain A, Crystal Structure Of The Ntf2-Like Domain Of The Drosophila Melanogaster Rasputin Protein Length = 120 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query174
3q90_A140 RAS GTPase-activating protein-binding protein 1; s 1e-28
3ujm_A120 Rasputin; NTF2-like fold, RAS signaling, signaling 6e-22
1gy7_A125 Nuclear transport factor 2; protein transport; 1.6 1e-21
1zo2_A129 NTF2, nuclear transport factor 2; structural genom 1e-21
2qiy_A154 UBP3-associated protein BRE5; deubiquitylation, ub 2e-21
1gy6_A127 Nuclear transport factor 2; 1.6A {Rattus norvegicu 2e-21
1jkg_A140 P15; NTF2-like domain, transport protein; 1.90A {H 4e-18
3nv0_B154 NTF2-related export protein; NTF2-like domain, bet 7e-14
>3q90_A RAS GTPase-activating protein-binding protein 1; structural genomics, structural genomics consortium, SGC, NT (A+B proteins); 1.70A {Homo sapiens} Length = 140 Back     alignment and structure
 Score =  102 bits (256), Expect = 1e-28
 Identities = 49/81 (60%), Positives = 58/81 (71%), Gaps = 1/81 (1%)

Query: 1  MVMEVTPSPQCVGREFVRQYYTLLNQAPAHLHRFYSENSLFIHGGLDAPNRETKQVVGQE 60
          MVME  PSP  VGREFVRQYYTLLNQAP  LHRFY +NS ++HGGLD+  +    V GQ+
Sbjct: 2  MVME-KPSPLLVGREFVRQYYTLLNQAPDMLHRFYGKNSSYVHGGLDSNGKPADAVYGQK 60

Query: 61 QIHEHIQQLNFRDCHAKIRQV 81
          +IH  +   NF +CH KIR V
Sbjct: 61 EIHRKVMSQNFTNCHTKIRHV 81


>3ujm_A Rasputin; NTF2-like fold, RAS signaling, signaling protein; HET: EPE; 2.74A {Drosophila melanogaster} Length = 120 Back     alignment and structure
>1gy7_A Nuclear transport factor 2; protein transport; 1.6A {Saccharomyces cerevisiae} SCOP: d.17.4.2 PDB: 1gyb_A Length = 125 Back     alignment and structure
>1zo2_A NTF2, nuclear transport factor 2; structural genomics, structural genomics consortium, SGC, transport protein; 1.60A {Cryptosporidium parvum} SCOP: d.17.4.2 Length = 129 Back     alignment and structure
>2qiy_A UBP3-associated protein BRE5; deubiquitylation, ubiquitin-specific processing proteases(UB NTF2, protein-protein recognition; 1.69A {Saccharomyces cerevisiae} SCOP: d.17.4.2 PDB: 1zx2_A Length = 154 Back     alignment and structure
>1gy6_A Nuclear transport factor 2; 1.6A {Rattus norvegicus} SCOP: d.17.4.2 PDB: 1a2k_A 1oun_A 1ar0_A 1u5o_A 1ask_A 1gy5_A 1jb5_A 1jb4_A 1jb2_A 1qma_A Length = 127 Back     alignment and structure
>1jkg_A P15; NTF2-like domain, transport protein; 1.90A {Homo sapiens} SCOP: d.17.4.2 PDB: 1jn5_A Length = 140 Back     alignment and structure
>3nv0_B NTF2-related export protein; NTF2-like domain, beta sheet heterodimer interface, nucleopo binding pocket, water mediated interface; 1.84A {Caenorhabditis elegans} Length = 154 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query174
3q90_A140 RAS GTPase-activating protein-binding protein 1; s 99.97
3ujm_A120 Rasputin; NTF2-like fold, RAS signaling, signaling 99.96
1gy6_A127 Nuclear transport factor 2; 1.6A {Rattus norvegicu 99.96
1zo2_A129 NTF2, nuclear transport factor 2; structural genom 99.95
1gy7_A125 Nuclear transport factor 2; protein transport; 1.6 99.95
2qiy_A154 UBP3-associated protein BRE5; deubiquitylation, ub 99.93
1jkg_A140 P15; NTF2-like domain, transport protein; 1.90A {H 99.92
3nv0_B154 NTF2-related export protein; NTF2-like domain, bet 99.9
1jkg_B250 TAP; NTF2-like domain, transport protein; 1.90A {H 99.67
1q40_B219 MEX67, mRNA export factor MEX67; NTF2-fold, nuclea 99.67
1of5_A221 MRNA export factor MEX67; nuclear protein, repeat, 99.67
1q42_A201 MTR2, mRNA transport regulator MTR2; NTF2-fold, nu 99.43
3nv0_A205 Nuclear RNA export factor 2; NTF2-like domain, bet 99.22
1of5_B184 MTR2, YKL186C, mRNA transport regulator MTR2; nucl 99.07
3gwr_A144 Putative calcium/calmodulin-dependent protein KIN 94.52
3dm8_A143 Uncharacterized protein RPA4348; siras, putative i 93.42
4h3u_A158 Hypothetical protein; structural genomics, PSI-bio 92.95
3cu3_A172 Domain of unknown function with A cystatin-like F; 92.75
3dxo_A121 Uncharacterized snoal-like protein; putative isome 92.27
3gzb_A154 Putative snoal-like polyketide cyclase; YP_0011826 92.0
2gxf_A142 Hypothetical protein YYBH; alpha-beta protein., st 91.51
3h51_A156 Putative calcium/calmodulin dependent protein KIN 91.41
3hx8_A129 MLR2180 protein, putative ketosteroid isomerase; s 91.1
3h3h_A122 Uncharacterized snoal-like protein; structural gen 91.09
3er7_A131 Uncharacterized NTF2-like protein; YP_001812677.1, 89.84
2rcd_A129 Uncharacterized protein; structural genomics, join 89.46
4i4k_A143 Uncharacterized protein SGCJ; structural genomics, 88.04
3ehc_A128 Snoal-like polyketide cyclase; structural genomics 87.84
3k0z_A159 Putative polyketide cyclase; structural genomics, 87.66
1ohp_A125 Steroid delta-isomerase; inhibitor; HET: ESR; 1.53 87.35
1nww_A149 Limonene-1,2-epoxide hydrolase; HET: MES; 1.20A {R 86.46
3en8_A128 Uncharacterized NTF-2 like protein; YP_553245.1, N 86.26
3d9r_A135 Ketosteroid isomerase-like protein; YP_049581.1, s 86.06
3fh1_A129 Uncharacterized NTF2-like protein; structural geno 86.06
3f9s_A146 Putative polyketide cyclase; structural genomics, 85.92
1oh0_A131 Steroid delta-isomerase; ketosteroid isomerase, KS 85.44
2owp_A129 Hypothetical protein BXE_B1374; cystatin-like fold 85.32
3mg1_A323 OCP, orange carotenoid protein; carotenoid binding 85.02
2gey_A158 ACLR protein; alpha+beta barrel, oxidoreductase; H 84.69
2gex_A152 SNOL; alpha+beta barrel, oxidoreductase; 2.50A {St 83.6
3bb9_A148 Putative orphan protein; structural genomics, join 82.98
1sjw_A144 Nogalonic acid methyl ester cyclase; anthracycline 82.79
3g16_A156 Uncharacterized protein with cystatin-like fold; Y 82.76
3ff2_A117 Uncharacterized cystatin fold protein (YP_497570. 82.4
3soy_A145 NTF2-like superfamily protein; structural genomics 82.35
3ec9_A140 Uncharacterized NTF2-like protein; structural geno 82.22
2f99_A153 Aklanonic acid methyl ester cyclase, AKNH; anthrac 82.21
2a15_A139 Hypothetical protein RV0760C; beta-alpha-barrel, s 81.64
3fgy_A135 Uncharacterized NTF2-like protein; structural geno 81.37
2bng_A149 MB2760; epoxide hydrolase, limonene, hydrolase, st 81.36
3jum_A185 Phenazine biosynthesis protein A/B; chirality, dru 80.66
>3q90_A RAS GTPase-activating protein-binding protein 1; structural genomics, structural genomics consortium, SGC, NT (A+B proteins); 1.70A {Homo sapiens} SCOP: d.17.4.0 Back     alignment and structure
Probab=99.97  E-value=8.7e-33  Score=215.11  Aligned_cols=115  Identities=51%  Similarity=0.782  Sum_probs=92.7

Q ss_pred             CCCCCCCCHHHHHHHHHHHHHHhhccCchhHhhccccCCceeecCCCCCCcCccccccHHHHHHHHHhCCCCcccEEEee
Q psy6110           1 MVMEVTPSPQCVGREFVRQYYTLLNQAPAHLHRFYSENSLFIHGGLDAPNRETKQVVGQEQIHEHIQQLNFRDCHAKIRQ   80 (174)
Q Consensus         1 ~~m~~~ps~~~VG~~FV~qYYt~L~~~p~~L~rFY~~~S~lv~gg~d~~t~eg~~~~G~e~I~eki~sL~f~~~k~~I~S   80 (174)
                      |||| +|++++||++||+|||++|+++|+.|++||+++|+|+|++.|+++.....+.|+++|.++|++|||++|+|+|.+
T Consensus         2 ~~~~-~p~~~~vg~~Fv~~YY~~ld~~r~~L~~~Y~~~S~l~~~~~~~ng~~~~~~~G~~~I~~~l~~Lp~~~~~~~I~t   80 (140)
T 3q90_A            2 MVME-KPSPLLVGREFVRQYYTLLNQAPDMLHRFYGKNSSYVHGGLDSNGKPADAVYGQKEIHRKVMSQNFTNCHTKIRH   80 (140)
T ss_dssp             -------CHHHHHHHHHHHHHHHHHHCGGGGGGGEEEEEEEC----------CCCEEHHHHHHHHHHHTCCCSCEEEEEE
T ss_pred             Cccc-CCCHHHHHHHHHHHHHHHHhcCHHHHHhhcccCceEEEEccCCCCceeecccCHHHHHHHHHhCCCccceEEEEe
Confidence            9999 999999999999999999999999999999999999997654221122378999999999999999999999999


Q ss_pred             eccccCC--CcEEEEEeeecCCCCCCCCCCCCCCCCCCCccccccccccceecCC
Q psy6110          81 VPVTQQF--PTVKQVEESLPPVTQPPSPPADPTPPSPPKEDEWKWNEQTPVEAPR  133 (174)
Q Consensus        81 iDaQpS~--GILI~VtG~ls~~~~p~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  133 (174)
                      +|||++.  ||||+|+|+|+.+++                 ..|-|.|||+|+|.
T Consensus        81 vD~Qps~~~gilI~V~G~l~~~~~-----------------~~~~F~QtF~L~p~  118 (140)
T 3q90_A           81 VDAHATLNDGVVVQVMGLLSNNNQ-----------------ALRRFMQTFVLAPE  118 (140)
T ss_dssp             EEEEECGGGCEEEEEEEEEECTTC-----------------CCEEEEEEEEEEEC
T ss_pred             EEEEEeCCCCEEEEEEEEEecCCC-----------------CccEEEEEEEEeec
Confidence            9999998  899999999998653                 36889999999987



>3ujm_A Rasputin; NTF2-like fold, RAS signaling, signaling protein; HET: EPE; 2.74A {Drosophila melanogaster} Back     alignment and structure
>1gy6_A Nuclear transport factor 2; 1.6A {Rattus norvegicus} SCOP: d.17.4.2 PDB: 1a2k_A 1oun_A 1ar0_A 1u5o_A 1ask_A 1gy5_A 1jb5_A 1jb4_A 1jb2_A 1qma_A Back     alignment and structure
>1zo2_A NTF2, nuclear transport factor 2; structural genomics, structural genomics consortium, SGC, transport protein; 1.60A {Cryptosporidium parvum} SCOP: d.17.4.2 Back     alignment and structure
>1gy7_A Nuclear transport factor 2; protein transport; 1.6A {Saccharomyces cerevisiae} SCOP: d.17.4.2 PDB: 1gyb_A Back     alignment and structure
>2qiy_A UBP3-associated protein BRE5; deubiquitylation, ubiquitin-specific processing proteases(UB NTF2, protein-protein recognition; 1.69A {Saccharomyces cerevisiae} SCOP: d.17.4.2 PDB: 1zx2_A Back     alignment and structure
>1jkg_A P15; NTF2-like domain, transport protein; 1.90A {Homo sapiens} SCOP: d.17.4.2 PDB: 1jn5_A Back     alignment and structure
>3nv0_B NTF2-related export protein; NTF2-like domain, beta sheet heterodimer interface, nucleopo binding pocket, water mediated interface; 1.84A {Caenorhabditis elegans} Back     alignment and structure
>1jkg_B TAP; NTF2-like domain, transport protein; 1.90A {Homo sapiens} SCOP: d.17.4.2 PDB: 1jn5_B 1go5_A Back     alignment and structure
>1q40_B MEX67, mRNA export factor MEX67; NTF2-fold, nuclear export, translation; 1.95A {Candida albicans} SCOP: d.17.4.2 Back     alignment and structure
>1of5_A MRNA export factor MEX67; nuclear protein, repeat, leucine- rich repeat, nuclear transport; 2.8A {Saccharomyces cerevisiae} SCOP: d.17.4.2 Back     alignment and structure
>1q42_A MTR2, mRNA transport regulator MTR2; NTF2-fold, nuclear export, translation; 1.75A {Candida albicans} SCOP: d.17.4.2 PDB: 1q40_A Back     alignment and structure
>3nv0_A Nuclear RNA export factor 2; NTF2-like domain, beta sheet heterodimer interface, nucleopo binding pocket, water mediated interface; 1.84A {Caenorhabditis elegans} Back     alignment and structure
>1of5_B MTR2, YKL186C, mRNA transport regulator MTR2; nuclear protein, repeat, leucine- rich repeat, nuclear transport; 2.8A {Saccharomyces cerevisiae} SCOP: d.17.4.2 Back     alignment and structure
>3gwr_A Putative calcium/calmodulin-dependent protein KIN II association domain; YP_315894.1; HET: MSE PG4; 2.01A {Thiobacillus denitrificans atcc 25259} Back     alignment and structure
>3dm8_A Uncharacterized protein RPA4348; siras, putative isomerase, structural genomics, PSI-2, prote structure initiative; HET: CE9; 1.80A {Rhodopseudomonas palustris} SCOP: d.17.4.20 Back     alignment and structure
>4h3u_A Hypothetical protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MSE; 1.15A {Catenulispora acidiphila} Back     alignment and structure
>3cu3_A Domain of unknown function with A cystatin-like F; structural genomics, joint center for structural genomics, J protein structure initiative; 2.00A {Nostoc punctiforme} SCOP: d.17.4.28 Back     alignment and structure
>3dxo_A Uncharacterized snoal-like protein; putative isomerase of the snoal-like family; HET: MSE PGE; 2.70A {Agrobacterium tumefaciens str} SCOP: d.17.4.19 Back     alignment and structure
>3gzb_A Putative snoal-like polyketide cyclase; YP_001182657.1, STRU genomics, joint center for structural genomics, JCSG; HET: MSE; 1.44A {Shewanella putrefaciens} PDB: 3lza_A* Back     alignment and structure
>2gxf_A Hypothetical protein YYBH; alpha-beta protein., structural genomics, PSI, protein structure initiative; HET: MES; 3.10A {Bacillus subtilis} SCOP: d.17.4.22 Back     alignment and structure
>3h51_A Putative calcium/calmodulin dependent protein KIN association domain; NP_636218.1; HET: MSE PG4; 1.70A {Xanthomonas campestris PV} Back     alignment and structure
>3hx8_A MLR2180 protein, putative ketosteroid isomerase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative; HET: MSE UNL PG4; 1.45A {Mesorhizobium loti} Back     alignment and structure
>3h3h_A Uncharacterized snoal-like protein; structural genomics, joint center for structural genomics, J protein structure initiative; HET: MSE UNL MES; 1.60A {Burkholderia thailandensis E264} Back     alignment and structure
>3er7_A Uncharacterized NTF2-like protein; YP_001812677.1, NTF2-like protein of unknown function, struc genomics; HET: MSE; 1.50A {Exiguobacterium sibiricum 255-15} SCOP: d.17.4.24 Back     alignment and structure
>2rcd_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE; 2.32A {Pectobacterium atrosepticum SCRI1043} SCOP: d.17.4.18 Back     alignment and structure
>4i4k_A Uncharacterized protein SGCJ; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: CIT PG4 1PE; 1.70A {Streptomyces globisporus} Back     alignment and structure
>3ehc_A Snoal-like polyketide cyclase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 2.12A {Agrobacterium tumefaciens str} Back     alignment and structure
>3k0z_A Putative polyketide cyclase; structural genomics, joint CENT structural genomics, JCSG, protein structure initiative, PS lipoprotein; HET: NHE; 1.91A {Bacillus cereus} Back     alignment and structure
>1ohp_A Steroid delta-isomerase; inhibitor; HET: ESR; 1.53A {Pseudomonas testosteroni} SCOP: d.17.4.3 PDB: 1qjg_A* 8cho_A* 1ohs_A* 1ocv_A 1isk_A 3nuv_A* 1ogz_A* 3nhx_A* 3m8c_A* 3nxj_A* 3myt_A* 3mki_A 3mhe_A 1buq_A* 3nbr_A* 3t8u_A 3ov4_A* 3nm2_A Back     alignment and structure
>1nww_A Limonene-1,2-epoxide hydrolase; HET: MES; 1.20A {Rhodococcus erythropolis} SCOP: d.17.4.8 PDB: 1nu3_A* Back     alignment and structure
>3en8_A Uncharacterized NTF-2 like protein; YP_553245.1, NTF-2 like protein of unknown function, structu genomics; HET: MSE PG4; 1.85A {Burkholderia xenovorans LB400} SCOP: d.17.4.20 Back     alignment and structure
>3d9r_A Ketosteroid isomerase-like protein; YP_049581.1, structural joint center for structural genomics, JCSG, protein structu initiative; HET: MSE; 2.40A {Pectobacterium atrosepticum} SCOP: d.17.4.27 Back     alignment and structure
>3fh1_A Uncharacterized NTF2-like protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE; 1.60A {Mesorhizobium loti} Back     alignment and structure
>3f9s_A Putative polyketide cyclase; structural genomics, joint center for structural genomics, J protein structure initiative; 1.76A {Acidithiobacillus ferrooxidans atcc 23} Back     alignment and structure
>1oh0_A Steroid delta-isomerase; ketosteroid isomerase, KSI, equilenin, PI, LBHB; HET: EQU; 1.1A {Pseudomonas putida} SCOP: d.17.4.3 PDB: 1e3v_A* 1opy_A 1dmq_A 1dmm_A 1ea2_A 3cpo_A 1e3r_A* 1ogx_A 2inx_A 2pzv_A 1c7h_A 1dmn_A 1k41_A 1oho_A* 3fzw_A* 1cqs_A* 1w00_A 1e97_A 1w6y_A* 3ipt_A* ... Back     alignment and structure
>2owp_A Hypothetical protein BXE_B1374; cystatin-like fold, DUF3225 family protein, structural genom joint center for structural genomics, JCSG; 2.00A {Burkholderia xenovorans} SCOP: d.17.4.18 Back     alignment and structure
>3mg1_A OCP, orange carotenoid protein; carotenoid binding protein, echinone, phycobilisome; HET: ECH; 1.65A {Synechocystis SP} PDB: 3mg2_A* 3mg3_A* 1m98_A* Back     alignment and structure
>2gey_A ACLR protein; alpha+beta barrel, oxidoreductase; HET: PG4; 1.80A {Streptomyces galilaeus} SCOP: d.17.4.9 Back     alignment and structure
>2gex_A SNOL; alpha+beta barrel, oxidoreductase; 2.50A {Streptomyces nogalater} SCOP: d.17.4.9 Back     alignment and structure
>3bb9_A Putative orphan protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE; 1.80A {Shewanella frigidimarina} SCOP: d.17.4.16 Back     alignment and structure
>1sjw_A Nogalonic acid methyl ester cyclase; anthracyclines, nogalamycin, snoal, aldol condensation, LYAS structural genomics; HET: NGV; 1.35A {Streptomyces nogalater} SCOP: d.17.4.9 Back     alignment and structure
>3g16_A Uncharacterized protein with cystatin-like fold; YP_001022489.1, protein of unknown function with cystatin-LI structural genomics; HET: MSE; 1.45A {Methylibium petroleiphilum PM1} Back     alignment and structure
>3ff2_A Uncharacterized cystatin fold protein (YP_497570. NTF2 superfamily; structural genomics; 1.90A {Novosphingobium aromaticivorans dsm 12ORGANISM_TAXID} Back     alignment and structure
>3soy_A NTF2-like superfamily protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; 2.00A {Salmonella enterica subsp} Back     alignment and structure
>3ec9_A Uncharacterized NTF2-like protein; structural genomics, joint center for STR genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.60A {Burkholderia thailandensis E264} SCOP: d.17.4.10 Back     alignment and structure
>2f99_A Aklanonic acid methyl ester cyclase, AKNH; anthracycline,polyketide cyclase,stereoselectivity, aklavino biosynthetic protein; HET: AKV; 1.90A {Streptomyces galilaeus} SCOP: d.17.4.9 PDB: 2f98_A* Back     alignment and structure
>2a15_A Hypothetical protein RV0760C; beta-alpha-barrel, structural genomics, PSI, protein structure initiative; 1.68A {Mycobacterium tuberculosis} SCOP: d.17.4.3 PDB: 2z76_A* 2z77_A* 2z7a_A Back     alignment and structure
>3fgy_A Uncharacterized NTF2-like protein; structural genomics, joint center for STR genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.59A {Burkholderia xenovorans LB400} SCOP: d.17.4.0 Back     alignment and structure
>2bng_A MB2760; epoxide hydrolase, limonene, hydrolase, structural proteomics in europe, spine, structural genomics; 2.5A {Mycobacterium tuberculosis} SCOP: d.17.4.8 Back     alignment and structure
>3jum_A Phenazine biosynthesis protein A/B; chirality, drug design, medicinal CH inhibitor, biosynthetic protein; HET: AOD; 1.45A {Burkholderia SP} PDB: 3b4o_A* 3b4p_A* 3dzl_A* 3ex9_A 3cnm_A* 3jun_A* 3juo_A* 3jup_A* 3juq_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 174
d1zo2a1117 d.17.4.2 (A:10-126) Nuclear transport factor-2 (NT 3e-20
d2qiya1139 d.17.4.2 (A:3-141) UBP3-associated protein BRE5 {B 3e-20
d1gy7a_121 d.17.4.2 (A:) Nuclear transport factor-2 (NTF2) {B 4e-20
d1gy6a_125 d.17.4.2 (A:) Nuclear transport factor-2 (NTF2) {R 1e-19
d1jkga_139 d.17.4.2 (A:) NTF2-related export protein 1 (p15) 2e-16
>d1zo2a1 d.17.4.2 (A:10-126) Nuclear transport factor-2 (NTF2) {Cryptosporidium parvum [TaxId: 5807]} Length = 117 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Cystatin-like
superfamily: NTF2-like
family: NTF2-like
domain: Nuclear transport factor-2 (NTF2)
species: Cryptosporidium parvum [TaxId: 5807]
 Score = 79.1 bits (195), Expect = 3e-20
 Identities = 17/70 (24%), Positives = 25/70 (35%), Gaps = 8/70 (11%)

Query: 12 VGREFVRQYYTLLNQAPAHLHRFYSENSLFIHGGLDAPNRETKQVVGQEQIHEHIQQLNF 71
          +G++FV+ YY         L   Y   S+              Q  GQ  I      LNF
Sbjct: 4  IGKQFVQHYYQTFQTNRPALGGLYGPQSMLTWED--------TQFQGQANIVNKFNSLNF 55

Query: 72 RDCHAKIRQV 81
          +    +I +V
Sbjct: 56 QRVQFEITRV 65


>d2qiya1 d.17.4.2 (A:3-141) UBP3-associated protein BRE5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 139 Back     information, alignment and structure
>d1gy7a_ d.17.4.2 (A:) Nuclear transport factor-2 (NTF2) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 121 Back     information, alignment and structure
>d1gy6a_ d.17.4.2 (A:) Nuclear transport factor-2 (NTF2) {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 125 Back     information, alignment and structure
>d1jkga_ d.17.4.2 (A:) NTF2-related export protein 1 (p15) {Human (Homo sapiens) [TaxId: 9606]} Length = 139 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query174
d1gy7a_121 Nuclear transport factor-2 (NTF2) {Baker's yeast ( 99.94
d1gy6a_125 Nuclear transport factor-2 (NTF2) {Rat (Rattus nor 99.94
d1zo2a1117 Nuclear transport factor-2 (NTF2) {Cryptosporidium 99.94
d1jkga_139 NTF2-related export protein 1 (p15) {Human (Homo s 99.9
d2qiya1139 UBP3-associated protein BRE5 {Baker's yeast (Sacch 99.88
d1of5b_165 mRNA transport regulator MTR2 {Baker's yeast (Sacc 99.45
d1q40b_205 NTF2-like domain of mRNA export factor MEX67 {Yeas 99.06
d1jkgb_186 NTF2-like domain of Tip associating protein, TAP { 98.84
d1of5a_221 NTF2-like domain of mRNA export factor MEX67 {Bake 98.78
d1q42a_174 mRNA transport regulator MTR2 {Yeast (Candida albi 97.36
d3en8a1127 Uncharacterized protein BxeB2092 {Burkholderia xen 95.36
d1m98a2142 Orange carotenoid protein, C-terminal domain {Cyan 94.45
d2owpa1128 Hypothetical protein BxeB1374 {Burkholderia xenovo 94.21
d3dm8a1135 Uncharacterized protein Rpa4348 {Rhodopseudomonas 94.08
d2rcda1127 Uncharacterized protein ECA3500 {Pectobacterium at 93.28
d1oh0a_125 Delta-5-3-ketosteroid isomerase, steroid delta-iso 93.03
d3cu3a1162 Uncharacterized protein NpunR1993 {Nostoc punctifo 92.38
d3dmca1133 Uncharacterized protein Ava2261 {Anabaena variabil 91.47
d3dxoa1117 Uncharacterized protein Atu0744 {Agrobacterium tum 90.67
d2bnga1132 Uncharacterized protein Mb2760 {Mycobacterium tube 90.64
d3b7ca1121 Uncharacterized protein SO0125 {Shewanella oneiden 90.53
d1z1sa1129 Uncharacterized protein PA3332 {Pseudomonas aerugi 90.51
d1ohpa1125 Delta-5-3-ketosteroid isomerase, steroid delta-iso 89.42
d1nwwa_145 Limonene-1,2-epoxide hydrolase {Rhodococcus erythr 89.18
d2gxfa1128 Hypothetical protein YybH {Bacillus subtilis [TaxI 87.88
d3cnxa1153 Uncharacterized protein SAV4671 {Streptomyces aver 87.88
d3ebta1131 Uncharacterized protein BPSS0132 {Burkholderia pse 86.59
d1s5aa_139 Hypothetical protein YesE {Bacillus subtilis [TaxI 86.23
d2f86b1129 Association domain of calcium/calmodulin-dependent 85.74
d2geya1144 Putative hydroxylase AclR {Streptomyces galilaeus 83.96
d3d9ra1132 Uncharacterized protein ECA1476 {Pectobacterium at 82.71
d2gexa1138 Nogalamycin biosynthesis protein SnoL {Streptomyce 82.61
d3ec9a1130 Uncharacterized protein BTHI0051 {Burkholderia tha 82.6
d2a15a1132 Hypothetical protein Rv0760c {Mycobacterium tuberc 81.52
d2k54a1123 Uncharacterized protein Atu0742 {Agrobacterium tum 80.47
>d1gy7a_ d.17.4.2 (A:) Nuclear transport factor-2 (NTF2) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Cystatin-like
superfamily: NTF2-like
family: NTF2-like
domain: Nuclear transport factor-2 (NTF2)
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]
Probab=99.94  E-value=2.7e-28  Score=183.20  Aligned_cols=101  Identities=18%  Similarity=0.279  Sum_probs=90.6

Q ss_pred             CHHHHHHHHHHHHHHhhccCchhHhhccccCCceeecCCCCCCcCccccccHHHHHHHHHhCCCCcccEEEeeeccccCC
Q psy6110           8 SPQCVGREFVRQYYTLLNQAPAHLHRFYSENSLFIHGGLDAPNRETKQVVGQEQIHEHIQQLNFRDCHAKIRQVPVTQQF   87 (174)
Q Consensus         8 s~~~VG~~FV~qYYt~L~~~p~~L~rFY~~~S~lv~gg~d~~t~eg~~~~G~e~I~eki~sL~f~~~k~~I~SiDaQpS~   87 (174)
                      ++++||++||++||+.|+++|+.|++||.++|.|+|        +|+.+.|+++|.++|++|++++++++|.++||||+.
T Consensus         1 d~~~Ia~~Fv~~YY~~l~~~r~~L~~~Y~~~s~l~~--------~g~~~~G~~~I~~~l~~lp~~~~~~~i~~~D~Qp~~   72 (121)
T d1gy7a_           1 DFNTLAQNFTQFYYNQFDTDRSQLGNLYRNESMLTF--------ETSQLQGAKDIVEKLVSLPFQKVQHRITTLDAQPAS   72 (121)
T ss_dssp             CHHHHHHHHHHHHHHHHHHHGGGGGGGEEEEEEEEE--------TTEEEESHHHHHHHHHHSCCSCEEEEEEEEEEEESS
T ss_pred             CHHHHHHHHHHHHHHHHhcCHHHHHHHcCCCcEEEE--------CCeEecCHHHHHHHHHhCCCcccEEEEeeEeeEEcc
Confidence            578999999999999999999999999999999987        678899999999999999999999999999999965


Q ss_pred             ---CcEEEEEeeecCCCCCCCCCCCCCCCCCCCccccccccccceecC
Q psy6110          88 ---PTVKQVEESLPPVTQPPSPPADPTPPSPPKEDEWKWNEQTPVEAP  132 (174)
Q Consensus        88 ---GILI~VtG~ls~~~~p~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  132 (174)
                         +|||+|+|.++.+++                ..++.|.|+|+|+|
T Consensus        73 ~~~~ili~V~G~~~~~~~----------------~~~~~F~qtF~L~~  104 (121)
T d1gy7a_          73 PYGDVLVMITGDLLIDEE----------------QNPQRFSQVFHLIP  104 (121)
T ss_dssp             TTSCEEEEEEEEEEETTC----------------SSCEEEEEEEEEEE
T ss_pred             CCCeEEEEEEEEEEECCC----------------CCcceeEEEEEEEe
Confidence               699999999998653                23467788887776



>d1gy6a_ d.17.4.2 (A:) Nuclear transport factor-2 (NTF2) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1zo2a1 d.17.4.2 (A:10-126) Nuclear transport factor-2 (NTF2) {Cryptosporidium parvum [TaxId: 5807]} Back     information, alignment and structure
>d1jkga_ d.17.4.2 (A:) NTF2-related export protein 1 (p15) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2qiya1 d.17.4.2 (A:3-141) UBP3-associated protein BRE5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1of5b_ d.17.4.2 (B:) mRNA transport regulator MTR2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1q40b_ d.17.4.2 (B:) NTF2-like domain of mRNA export factor MEX67 {Yeast (Candida albicans) [TaxId: 5476]} Back     information, alignment and structure
>d1jkgb_ d.17.4.2 (B:) NTF2-like domain of Tip associating protein, TAP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1of5a_ d.17.4.2 (A:) NTF2-like domain of mRNA export factor MEX67 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1q42a_ d.17.4.2 (A:) mRNA transport regulator MTR2 {Yeast (Candida albicans) [TaxId: 5476]} Back     information, alignment and structure
>d3en8a1 d.17.4.20 (A:1-127) Uncharacterized protein BxeB2092 {Burkholderia xenovorans [TaxId: 36873]} Back     information, alignment and structure
>d1m98a2 d.17.4.6 (A:176-317) Orange carotenoid protein, C-terminal domain {Cyanobacteria (Arthrospira maxima) [TaxId: 129910]} Back     information, alignment and structure
>d2owpa1 d.17.4.18 (A:1-128) Hypothetical protein BxeB1374 {Burkholderia xenovorans [TaxId: 36873]} Back     information, alignment and structure
>d3dm8a1 d.17.4.20 (A:1-135) Uncharacterized protein Rpa4348 {Rhodopseudomonas palustris [TaxId: 1076]} Back     information, alignment and structure
>d2rcda1 d.17.4.18 (A:1-127) Uncharacterized protein ECA3500 {Pectobacterium atrosepticum [TaxId: 29471]} Back     information, alignment and structure
>d1oh0a_ d.17.4.3 (A:) Delta-5-3-ketosteroid isomerase, steroid delta-isomerase, KSI {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d3cu3a1 d.17.4.28 (A:9-170) Uncharacterized protein NpunR1993 {Nostoc punctiforme [TaxId: 272131]} Back     information, alignment and structure
>d3dmca1 d.17.4.10 (A:1-133) Uncharacterized protein Ava2261 {Anabaena variabilis [TaxId: 1172]} Back     information, alignment and structure
>d3dxoa1 d.17.4.19 (A:1-117) Uncharacterized protein Atu0744 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d2bnga1 d.17.4.8 (A:13-144) Uncharacterized protein Mb2760 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d3b7ca1 d.17.4.16 (A:1-121) Uncharacterized protein SO0125 {Shewanella oneidensis [TaxId: 70863]} Back     information, alignment and structure
>d1z1sa1 d.17.4.10 (A:1-129) Uncharacterized protein PA3332 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1ohpa1 d.17.4.3 (A:1-125) Delta-5-3-ketosteroid isomerase, steroid delta-isomerase, KSI {Comamonas testosteroni, also known as Pseudomonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d1nwwa_ d.17.4.8 (A:) Limonene-1,2-epoxide hydrolase {Rhodococcus erythropolis [TaxId: 1833]} Back     information, alignment and structure
>d2gxfa1 d.17.4.22 (A:1-128) Hypothetical protein YybH {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d3cnxa1 d.17.4.17 (A:5-157) Uncharacterized protein SAV4671 {Streptomyces avermitilis [TaxId: 33903]} Back     information, alignment and structure
>d3ebta1 d.17.4.9 (A:1-131) Uncharacterized protein BPSS0132 {Burkholderia pseudomallei [TaxId: 28450]} Back     information, alignment and structure
>d1s5aa_ d.17.4.10 (A:) Hypothetical protein YesE {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2f86b1 d.17.4.7 (B:343-471) Association domain of calcium/calmodulin-dependent protein kinase type II alpha subunit, CAMK2A {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d2geya1 d.17.4.9 (A:2-145) Putative hydroxylase AclR {Streptomyces galilaeus [TaxId: 33899]} Back     information, alignment and structure
>d3d9ra1 d.17.4.27 (A:3-134) Uncharacterized protein ECA1476 {Pectobacterium atrosepticum [TaxId: 29471]} Back     information, alignment and structure
>d2gexa1 d.17.4.9 (A:2-139) Nogalamycin biosynthesis protein SnoL {Streptomyces nogalater [TaxId: 38314]} Back     information, alignment and structure
>d3ec9a1 d.17.4.10 (A:10-139) Uncharacterized protein BTHI0051 {Burkholderia thailandensis [TaxId: 57975]} Back     information, alignment and structure
>d2a15a1 d.17.4.3 (A:5-136) Hypothetical protein Rv0760c {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2k54a1 d.17.4.29 (A:1-123) Uncharacterized protein Atu0742 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure