Psyllid ID: psy6110
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 174 | ||||||
| 357602466 | 465 | hypothetical protein KGM_21411 [Danaus p | 0.465 | 0.174 | 0.795 | 9e-32 | |
| 157110308 | 757 | hypothetical protein AaeL_AAEL005528 [Ae | 0.591 | 0.136 | 0.638 | 5e-31 | |
| 170051648 | 687 | rasputin [Culex quinquefasciatus] gi|167 | 0.591 | 0.149 | 0.638 | 1e-30 | |
| 312383845 | 909 | hypothetical protein AND_02863 [Anophele | 0.591 | 0.113 | 0.619 | 3e-30 | |
| 405961406 | 496 | Ras GTPase-activating protein-binding pr | 0.459 | 0.161 | 0.740 | 1e-28 | |
| 91076984 | 544 | PREDICTED: similar to rasputin CG9412-PB | 0.591 | 0.189 | 0.685 | 3e-27 | |
| 345494268 | 628 | PREDICTED: LOW QUALITY PROTEIN: ras GTPa | 0.459 | 0.127 | 0.703 | 5e-27 | |
| 443685184 | 504 | hypothetical protein CAPTEDRAFT_179128 [ | 0.586 | 0.202 | 0.609 | 2e-26 | |
| 383851131 | 614 | PREDICTED: uncharacterized protein LOC10 | 0.586 | 0.166 | 0.657 | 4e-26 | |
| 350396369 | 621 | PREDICTED: hypothetical protein LOC10074 | 0.586 | 0.164 | 0.657 | 4e-26 |
| >gi|357602466|gb|EHJ63410.1| hypothetical protein KGM_21411 [Danaus plexippus] | Back alignment and taxonomy information |
|---|
Score = 141 bits (356), Expect = 9e-32, Method: Compositional matrix adjust.
Identities = 66/83 (79%), Positives = 71/83 (85%), Gaps = 2/83 (2%)
Query: 1 MVMEVTPSP--QCVGREFVRQYYTLLNQAPAHLHRFYSENSLFIHGGLDAPNRETKQVVG 58
MVME +PSP Q VGREFVRQYYTLLN+APAHLHRFY+ S F+HGGLDAPNRET VVG
Sbjct: 1 MVMEASPSPSPQSVGREFVRQYYTLLNKAPAHLHRFYNNYSSFVHGGLDAPNRETLPVVG 60
Query: 59 QEQIHEHIQQLNFRDCHAKIRQV 81
Q+QIH IQQLNFRDCHAKI QV
Sbjct: 61 QKQIHNRIQQLNFRDCHAKISQV 83
|
Source: Danaus plexippus Species: Danaus plexippus Genus: Danaus Family: Nymphalidae Order: Lepidoptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|157110308|ref|XP_001651045.1| hypothetical protein AaeL_AAEL005528 [Aedes aegypti] gi|108878769|gb|EAT42994.1| AAEL005528-PA [Aedes aegypti] | Back alignment and taxonomy information |
|---|
| >gi|170051648|ref|XP_001861860.1| rasputin [Culex quinquefasciatus] gi|167872816|gb|EDS36199.1| rasputin [Culex quinquefasciatus] | Back alignment and taxonomy information |
|---|
| >gi|312383845|gb|EFR28759.1| hypothetical protein AND_02863 [Anopheles darlingi] | Back alignment and taxonomy information |
|---|
| >gi|405961406|gb|EKC27215.1| Ras GTPase-activating protein-binding protein 2 [Crassostrea gigas] | Back alignment and taxonomy information |
|---|
| >gi|91076984|ref|XP_975463.1| PREDICTED: similar to rasputin CG9412-PB [Tribolium castaneum] gi|270001993|gb|EEZ98440.1| hypothetical protein TcasGA2_TC000929 [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
| >gi|345494268|ref|XP_001605102.2| PREDICTED: LOW QUALITY PROTEIN: ras GTPase-activating protein-binding protein 1-like [Nasonia vitripennis] | Back alignment and taxonomy information |
|---|
| >gi|443685184|gb|ELT88883.1| hypothetical protein CAPTEDRAFT_179128 [Capitella teleta] | Back alignment and taxonomy information |
|---|
| >gi|383851131|ref|XP_003701093.1| PREDICTED: uncharacterized protein LOC100876463 [Megachile rotundata] | Back alignment and taxonomy information |
|---|
| >gi|350396369|ref|XP_003484531.1| PREDICTED: hypothetical protein LOC100747231 [Bombus impatiens] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 174 | ||||||
| FB|FBgn0015778 | 690 | rin "rasputin" [Drosophila mel | 0.425 | 0.107 | 0.670 | 1.7e-26 | |
| UNIPROTKB|Q5ZMN1 | 472 | G3BP1 "Uncharacterized protein | 0.459 | 0.169 | 0.629 | 3.4e-23 | |
| ZFIN|ZDB-GENE-030131-7452 | 477 | g3bp1 "GTPase activating prote | 0.459 | 0.167 | 0.629 | 4.6e-23 | |
| UNIPROTKB|D6RAC7 | 141 | G3BP2 "Ras GTPase-activating p | 0.459 | 0.567 | 0.604 | 1.3e-22 | |
| UNIPROTKB|D6RB17 | 198 | G3BP2 "Ras GTPase-activating p | 0.459 | 0.404 | 0.604 | 1.3e-22 | |
| UNIPROTKB|D6RBR0 | 102 | G3BP2 "Ras GTPase-activating p | 0.459 | 0.784 | 0.604 | 1.3e-22 | |
| UNIPROTKB|D6RBW8 | 116 | G3BP2 "Ras GTPase-activating p | 0.459 | 0.689 | 0.604 | 1.3e-22 | |
| UNIPROTKB|D6RE13 | 111 | G3BP2 "Ras GTPase-activating p | 0.459 | 0.720 | 0.604 | 1.3e-22 | |
| UNIPROTKB|D6REX8 | 99 | G3BP2 "Ras GTPase-activating p | 0.459 | 0.808 | 0.604 | 1.3e-22 | |
| UNIPROTKB|D6RGJ4 | 125 | G3BP2 "Ras GTPase-activating p | 0.459 | 0.64 | 0.604 | 1.3e-22 |
| FB|FBgn0015778 rin "rasputin" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Score = 274 (101.5 bits), Expect = 1.7e-26, Sum P(2) = 1.7e-26
Identities = 57/85 (67%), Positives = 63/85 (74%)
Query: 1 MVMEVT----PSPQCVGREFVRQYYTLLNQAPAHLHRFYSENSLFIHGGLDAPNRETKQV 56
MVM+ T PSPQ VGREFVRQYYTLLN+AP HLHRFY+ NS +IHG E+K V
Sbjct: 1 MVMDATQSQQPSPQSVGREFVRQYYTLLNKAPNHLHRFYNHNSSYIHG-------ESKLV 53
Query: 57 VGQEQIHEHIQQLNFRDCHAKIRQV 81
VGQ +IH IQQLNF DCHAKI QV
Sbjct: 54 VGQREIHNRIQQLNFNDCHAKISQV 78
|
|
| UNIPROTKB|Q5ZMN1 G3BP1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-030131-7452 g3bp1 "GTPase activating protein (SH3 domain) binding protein 1" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|D6RAC7 G3BP2 "Ras GTPase-activating protein-binding protein 2" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|D6RB17 G3BP2 "Ras GTPase-activating protein-binding protein 2" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|D6RBR0 G3BP2 "Ras GTPase-activating protein-binding protein 2" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|D6RBW8 G3BP2 "Ras GTPase-activating protein-binding protein 2" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|D6RE13 G3BP2 "Ras GTPase-activating protein-binding protein 2" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|D6REX8 G3BP2 "Ras GTPase-activating protein-binding protein 2" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|D6RGJ4 G3BP2 "Ras GTPase-activating protein-binding protein 2" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 174 | |||
| cd00780 | 119 | cd00780, NTF2, Nuclear transport factor 2 (NTF2) d | 6e-22 | |
| pfam02136 | 116 | pfam02136, NTF2, Nuclear transport factor 2 (NTF2) | 5e-14 | |
| cd00531 | 124 | cd00531, NTF2_like, Nuclear transport factor 2 (NT | 5e-10 | |
| PLN02226 | 463 | PLN02226, PLN02226, 2-oxoglutarate dehydrogenase E | 2e-04 | |
| PRK14950 | 585 | PRK14950, PRK14950, DNA polymerase III subunits ga | 2e-04 | |
| PHA03247 | 3151 | PHA03247, PHA03247, large tegument protein UL36; P | 3e-04 | |
| PRK14950 | 585 | PRK14950, PRK14950, DNA polymerase III subunits ga | 0.001 | |
| PLN02744 | 539 | PLN02744, PLN02744, dihydrolipoyllysine-residue ac | 0.003 |
| >gnl|CDD|238403 cd00780, NTF2, Nuclear transport factor 2 (NTF2) domain plays an important role in the trafficking of macromolecules, ions and small molecules between the cytoplasm and nucleus | Back alignment and domain information |
|---|
Score = 85.0 bits (211), Expect = 6e-22
Identities = 24/74 (32%), Positives = 36/74 (48%), Gaps = 7/74 (9%)
Query: 8 SPQCVGREFVRQYYTLLNQAPAHLHRFYSENSLFIHGGLDAPNRETKQVVGQEQIHEHIQ 67
S + V + FV+QYY++ + LHR Y + S+ G KQV G++ I E +
Sbjct: 1 SAEDVAKAFVQQYYSIFDNNREGLHRLYGDTSMLSREG-------MKQVTGRDAIVEKLS 53
Query: 68 QLNFRDCHAKIRQV 81
L F+ KI V
Sbjct: 54 SLPFQKTKHKITTV 67
|
This bi-directional transport of macromolecules across the nuclear envelope requires many soluble factors that includes GDP-binding protein Ran (RanGDP). RanGDP is required for both import and export of proteins and poly(A) RNA. RanGDP also has been implicated in cell cycle control, specifically in mitotic spindle assembly. In interphase cells, RanGDP is predominately nuclear and thought to be GTP bound, but it is also present in the cytoplasm, probably in the GDP-bound state. NTF2 mediates the nuclear import of RanGDP. NTF2 binds to both RanGDP and FxFG repeat-containing nucleoporins. Length = 119 |
| >gnl|CDD|216894 pfam02136, NTF2, Nuclear transport factor 2 (NTF2) domain | Back alignment and domain information |
|---|
| >gnl|CDD|238296 cd00531, NTF2_like, Nuclear transport factor 2 (NTF2-like) superfamily | Back alignment and domain information |
|---|
| >gnl|CDD|177871 PLN02226, PLN02226, 2-oxoglutarate dehydrogenase E2 component | Back alignment and domain information |
|---|
| >gnl|CDD|237864 PRK14950, PRK14950, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237864 PRK14950, PRK14950, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|215397 PLN02744, PLN02744, dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 174 | |||
| KOG2104|consensus | 126 | 99.93 | ||
| KOG0116|consensus | 419 | 99.92 | ||
| cd00780 | 119 | NTF2 Nuclear transport factor 2 (NTF2) domain play | 99.92 | |
| PF02136 | 118 | NTF2: Nuclear transport factor 2 (NTF2) domain; In | 99.79 | |
| KOG4353|consensus | 139 | 99.78 | ||
| PF10429 | 166 | Mtr2: Nuclear pore RNA shuttling protein Mtr2; Int | 98.34 | |
| cd00531 | 124 | NTF2_like Nuclear transport factor 2 (NTF2-like) s | 97.78 | |
| KOG3763|consensus | 585 | 96.13 | ||
| PF13474 | 121 | SnoaL_3: SnoaL-like domain; PDB: 2GXF_A 3KSP_A 3KE | 96.07 | |
| PF15008 | 262 | DUF4518: Domain of unknown function (DUF4518) | 95.74 | |
| TIGR02246 | 128 | conserved hypothetical protein. This family consis | 94.42 | |
| PF12680 | 102 | SnoaL_2: SnoaL-like domain; PDB: 3F40_A 3RGA_A 3G8 | 93.99 | |
| TIGR02096 | 129 | conserved hypothetical protein, steroid delta-isom | 90.87 | |
| cd00781 | 122 | ketosteroid_isomerase ketosteroid isomerase: Many | 90.79 | |
| PF14534 | 107 | DUF4440: Domain of unknown function (DUF4440); PDB | 88.43 |
| >KOG2104|consensus | Back alignment and domain information |
|---|
Probab=99.93 E-value=5.5e-26 Score=175.71 Aligned_cols=90 Identities=24% Similarity=0.429 Sum_probs=85.0
Q ss_pred CCCHHHHHHHHHHHHHHhhccCchhHhhccccCCceeecCCCCCCcCccccccHHHHHHHHHhCCCCcccEEEeeecccc
Q psy6110 6 TPSPQCVGREFVRQYYTLLNQAPAHLHRFYSENSLFIHGGLDAPNRETKQVVGQEQIHEHIQQLNFRDCHAKIRQVPVTQ 85 (174)
Q Consensus 6 ~ps~~~VG~~FV~qYYt~L~~~p~~L~rFY~~~S~lv~gg~d~~t~eg~~~~G~e~I~eki~sL~f~~~k~~I~SiDaQp 85 (174)
++.++.||.+||++||.+||.+|.+|..||.+.|+| ||||++++|.++|.||+.+|||++|++.|+++||||
T Consensus 3 d~~~e~v~~~FvqhYY~~FD~dR~ql~~lY~~~S~L--------TfEGqq~qG~~~IveKl~sLpFqkiqh~IttvD~QP 74 (126)
T KOG2104|consen 3 DPVYEAVAKAFVQHYYSLFDNDRSQLGALYIDTSML--------TFEGQQIQGKDAIVEKLTSLPFQKIQHSITTVDSQP 74 (126)
T ss_pred CccHHHHHHHHHHHHHHHhcCchhHhhhhhccccee--------eEcchhhcchHHHHHHHhcCChhhhhceeeeccccc
Confidence 347799999999999999999999999999999997 569999999999999999999999999999999999
Q ss_pred CC--CcEEEEEeeecCCCCC
Q psy6110 86 QF--PTVKQVEESLPPVTQP 103 (174)
Q Consensus 86 S~--GILI~VtG~ls~~~~p 103 (174)
+. ||||+|+|+|+.++++
T Consensus 75 t~~g~ilv~V~G~Lk~dEd~ 94 (126)
T KOG2104|consen 75 TPDGGILVMVVGQLKLDEDP 94 (126)
T ss_pred CCCCcEEEEEeeeeeeccCC
Confidence 99 7999999999999664
|
|
| >KOG0116|consensus | Back alignment and domain information |
|---|
| >cd00780 NTF2 Nuclear transport factor 2 (NTF2) domain plays an important role in the trafficking of macromolecules, ions and small molecules between the cytoplasm and nucleus | Back alignment and domain information |
|---|
| >PF02136 NTF2: Nuclear transport factor 2 (NTF2) domain; InterPro: IPR002075 Nuclear transport factor 2 (NTF2) is a homodimer which stimulates efficient nuclear import of a cargo protein | Back alignment and domain information |
|---|
| >KOG4353|consensus | Back alignment and domain information |
|---|
| >PF10429 Mtr2: Nuclear pore RNA shuttling protein Mtr2; InterPro: IPR019488 Mtr2 is a monomeric, dual-action, RNA-shuttle protein found in yeasts | Back alignment and domain information |
|---|
| >cd00531 NTF2_like Nuclear transport factor 2 (NTF2-like) superfamily | Back alignment and domain information |
|---|
| >KOG3763|consensus | Back alignment and domain information |
|---|
| >PF13474 SnoaL_3: SnoaL-like domain; PDB: 2GXF_A 3KSP_A 3KE7_A 3BB9_E 3CNX_A 3F7S_A 3GWR_B | Back alignment and domain information |
|---|
| >PF15008 DUF4518: Domain of unknown function (DUF4518) | Back alignment and domain information |
|---|
| >TIGR02246 conserved hypothetical protein | Back alignment and domain information |
|---|
| >PF12680 SnoaL_2: SnoaL-like domain; PDB: 3F40_A 3RGA_A 3G8Z_A 3DMC_A 3FH1_A 1TUH_A 3F14_A 3ER7_A 1Z1S_A 3F7X_A | Back alignment and domain information |
|---|
| >TIGR02096 conserved hypothetical protein, steroid delta-isomerase-related | Back alignment and domain information |
|---|
| >cd00781 ketosteroid_isomerase ketosteroid isomerase: Many biological reactions proceed by enzymatic cleavage of a C-H bond adjacent to carbonyl or a carboxyl group, leading to an enol or a enolate intermediate that is subsequently re-protonated at the same or an adjacent carbon | Back alignment and domain information |
|---|
| >PF14534 DUF4440: Domain of unknown function (DUF4440); PDB: 3HX8_A 3SOY_A 3ROB_B 3GZR_A 3B7C_A 3CU3_A 3FSD_A 2R4I_C 1TP6_A | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 174 | ||||
| 3q90_A | 140 | Crystal Structure Of The Ntf2 Domain Of Ras Gtpase- | 9e-24 | ||
| 3ujm_A | 120 | Crystal Structure Of The Ntf2-Like Domain Of The Dr | 2e-22 |
| >pdb|3Q90|A Chain A, Crystal Structure Of The Ntf2 Domain Of Ras Gtpase-Activating Protein- Binding Protein 1 Length = 140 | Back alignment and structure |
|
| >pdb|3UJM|A Chain A, Crystal Structure Of The Ntf2-Like Domain Of The Drosophila Melanogaster Rasputin Protein Length = 120 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 174 | |||
| 3q90_A | 140 | RAS GTPase-activating protein-binding protein 1; s | 1e-28 | |
| 3ujm_A | 120 | Rasputin; NTF2-like fold, RAS signaling, signaling | 6e-22 | |
| 1gy7_A | 125 | Nuclear transport factor 2; protein transport; 1.6 | 1e-21 | |
| 1zo2_A | 129 | NTF2, nuclear transport factor 2; structural genom | 1e-21 | |
| 2qiy_A | 154 | UBP3-associated protein BRE5; deubiquitylation, ub | 2e-21 | |
| 1gy6_A | 127 | Nuclear transport factor 2; 1.6A {Rattus norvegicu | 2e-21 | |
| 1jkg_A | 140 | P15; NTF2-like domain, transport protein; 1.90A {H | 4e-18 | |
| 3nv0_B | 154 | NTF2-related export protein; NTF2-like domain, bet | 7e-14 |
| >3q90_A RAS GTPase-activating protein-binding protein 1; structural genomics, structural genomics consortium, SGC, NT (A+B proteins); 1.70A {Homo sapiens} Length = 140 | Back alignment and structure |
|---|
Score = 102 bits (256), Expect = 1e-28
Identities = 49/81 (60%), Positives = 58/81 (71%), Gaps = 1/81 (1%)
Query: 1 MVMEVTPSPQCVGREFVRQYYTLLNQAPAHLHRFYSENSLFIHGGLDAPNRETKQVVGQE 60
MVME PSP VGREFVRQYYTLLNQAP LHRFY +NS ++HGGLD+ + V GQ+
Sbjct: 2 MVME-KPSPLLVGREFVRQYYTLLNQAPDMLHRFYGKNSSYVHGGLDSNGKPADAVYGQK 60
Query: 61 QIHEHIQQLNFRDCHAKIRQV 81
+IH + NF +CH KIR V
Sbjct: 61 EIHRKVMSQNFTNCHTKIRHV 81
|
| >3ujm_A Rasputin; NTF2-like fold, RAS signaling, signaling protein; HET: EPE; 2.74A {Drosophila melanogaster} Length = 120 | Back alignment and structure |
|---|
| >1gy7_A Nuclear transport factor 2; protein transport; 1.6A {Saccharomyces cerevisiae} SCOP: d.17.4.2 PDB: 1gyb_A Length = 125 | Back alignment and structure |
|---|
| >1zo2_A NTF2, nuclear transport factor 2; structural genomics, structural genomics consortium, SGC, transport protein; 1.60A {Cryptosporidium parvum} SCOP: d.17.4.2 Length = 129 | Back alignment and structure |
|---|
| >2qiy_A UBP3-associated protein BRE5; deubiquitylation, ubiquitin-specific processing proteases(UB NTF2, protein-protein recognition; 1.69A {Saccharomyces cerevisiae} SCOP: d.17.4.2 PDB: 1zx2_A Length = 154 | Back alignment and structure |
|---|
| >1gy6_A Nuclear transport factor 2; 1.6A {Rattus norvegicus} SCOP: d.17.4.2 PDB: 1a2k_A 1oun_A 1ar0_A 1u5o_A 1ask_A 1gy5_A 1jb5_A 1jb4_A 1jb2_A 1qma_A Length = 127 | Back alignment and structure |
|---|
| >1jkg_A P15; NTF2-like domain, transport protein; 1.90A {Homo sapiens} SCOP: d.17.4.2 PDB: 1jn5_A Length = 140 | Back alignment and structure |
|---|
| >3nv0_B NTF2-related export protein; NTF2-like domain, beta sheet heterodimer interface, nucleopo binding pocket, water mediated interface; 1.84A {Caenorhabditis elegans} Length = 154 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 174 | |||
| 3q90_A | 140 | RAS GTPase-activating protein-binding protein 1; s | 99.97 | |
| 3ujm_A | 120 | Rasputin; NTF2-like fold, RAS signaling, signaling | 99.96 | |
| 1gy6_A | 127 | Nuclear transport factor 2; 1.6A {Rattus norvegicu | 99.96 | |
| 1zo2_A | 129 | NTF2, nuclear transport factor 2; structural genom | 99.95 | |
| 1gy7_A | 125 | Nuclear transport factor 2; protein transport; 1.6 | 99.95 | |
| 2qiy_A | 154 | UBP3-associated protein BRE5; deubiquitylation, ub | 99.93 | |
| 1jkg_A | 140 | P15; NTF2-like domain, transport protein; 1.90A {H | 99.92 | |
| 3nv0_B | 154 | NTF2-related export protein; NTF2-like domain, bet | 99.9 | |
| 1jkg_B | 250 | TAP; NTF2-like domain, transport protein; 1.90A {H | 99.67 | |
| 1q40_B | 219 | MEX67, mRNA export factor MEX67; NTF2-fold, nuclea | 99.67 | |
| 1of5_A | 221 | MRNA export factor MEX67; nuclear protein, repeat, | 99.67 | |
| 1q42_A | 201 | MTR2, mRNA transport regulator MTR2; NTF2-fold, nu | 99.43 | |
| 3nv0_A | 205 | Nuclear RNA export factor 2; NTF2-like domain, bet | 99.22 | |
| 1of5_B | 184 | MTR2, YKL186C, mRNA transport regulator MTR2; nucl | 99.07 | |
| 3gwr_A | 144 | Putative calcium/calmodulin-dependent protein KIN | 94.52 | |
| 3dm8_A | 143 | Uncharacterized protein RPA4348; siras, putative i | 93.42 | |
| 4h3u_A | 158 | Hypothetical protein; structural genomics, PSI-bio | 92.95 | |
| 3cu3_A | 172 | Domain of unknown function with A cystatin-like F; | 92.75 | |
| 3dxo_A | 121 | Uncharacterized snoal-like protein; putative isome | 92.27 | |
| 3gzb_A | 154 | Putative snoal-like polyketide cyclase; YP_0011826 | 92.0 | |
| 2gxf_A | 142 | Hypothetical protein YYBH; alpha-beta protein., st | 91.51 | |
| 3h51_A | 156 | Putative calcium/calmodulin dependent protein KIN | 91.41 | |
| 3hx8_A | 129 | MLR2180 protein, putative ketosteroid isomerase; s | 91.1 | |
| 3h3h_A | 122 | Uncharacterized snoal-like protein; structural gen | 91.09 | |
| 3er7_A | 131 | Uncharacterized NTF2-like protein; YP_001812677.1, | 89.84 | |
| 2rcd_A | 129 | Uncharacterized protein; structural genomics, join | 89.46 | |
| 4i4k_A | 143 | Uncharacterized protein SGCJ; structural genomics, | 88.04 | |
| 3ehc_A | 128 | Snoal-like polyketide cyclase; structural genomics | 87.84 | |
| 3k0z_A | 159 | Putative polyketide cyclase; structural genomics, | 87.66 | |
| 1ohp_A | 125 | Steroid delta-isomerase; inhibitor; HET: ESR; 1.53 | 87.35 | |
| 1nww_A | 149 | Limonene-1,2-epoxide hydrolase; HET: MES; 1.20A {R | 86.46 | |
| 3en8_A | 128 | Uncharacterized NTF-2 like protein; YP_553245.1, N | 86.26 | |
| 3d9r_A | 135 | Ketosteroid isomerase-like protein; YP_049581.1, s | 86.06 | |
| 3fh1_A | 129 | Uncharacterized NTF2-like protein; structural geno | 86.06 | |
| 3f9s_A | 146 | Putative polyketide cyclase; structural genomics, | 85.92 | |
| 1oh0_A | 131 | Steroid delta-isomerase; ketosteroid isomerase, KS | 85.44 | |
| 2owp_A | 129 | Hypothetical protein BXE_B1374; cystatin-like fold | 85.32 | |
| 3mg1_A | 323 | OCP, orange carotenoid protein; carotenoid binding | 85.02 | |
| 2gey_A | 158 | ACLR protein; alpha+beta barrel, oxidoreductase; H | 84.69 | |
| 2gex_A | 152 | SNOL; alpha+beta barrel, oxidoreductase; 2.50A {St | 83.6 | |
| 3bb9_A | 148 | Putative orphan protein; structural genomics, join | 82.98 | |
| 1sjw_A | 144 | Nogalonic acid methyl ester cyclase; anthracycline | 82.79 | |
| 3g16_A | 156 | Uncharacterized protein with cystatin-like fold; Y | 82.76 | |
| 3ff2_A | 117 | Uncharacterized cystatin fold protein (YP_497570. | 82.4 | |
| 3soy_A | 145 | NTF2-like superfamily protein; structural genomics | 82.35 | |
| 3ec9_A | 140 | Uncharacterized NTF2-like protein; structural geno | 82.22 | |
| 2f99_A | 153 | Aklanonic acid methyl ester cyclase, AKNH; anthrac | 82.21 | |
| 2a15_A | 139 | Hypothetical protein RV0760C; beta-alpha-barrel, s | 81.64 | |
| 3fgy_A | 135 | Uncharacterized NTF2-like protein; structural geno | 81.37 | |
| 2bng_A | 149 | MB2760; epoxide hydrolase, limonene, hydrolase, st | 81.36 | |
| 3jum_A | 185 | Phenazine biosynthesis protein A/B; chirality, dru | 80.66 |
| >3q90_A RAS GTPase-activating protein-binding protein 1; structural genomics, structural genomics consortium, SGC, NT (A+B proteins); 1.70A {Homo sapiens} SCOP: d.17.4.0 | Back alignment and structure |
|---|
Probab=99.97 E-value=8.7e-33 Score=215.11 Aligned_cols=115 Identities=51% Similarity=0.782 Sum_probs=92.7
Q ss_pred CCCCCCCCHHHHHHHHHHHHHHhhccCchhHhhccccCCceeecCCCCCCcCccccccHHHHHHHHHhCCCCcccEEEee
Q psy6110 1 MVMEVTPSPQCVGREFVRQYYTLLNQAPAHLHRFYSENSLFIHGGLDAPNRETKQVVGQEQIHEHIQQLNFRDCHAKIRQ 80 (174)
Q Consensus 1 ~~m~~~ps~~~VG~~FV~qYYt~L~~~p~~L~rFY~~~S~lv~gg~d~~t~eg~~~~G~e~I~eki~sL~f~~~k~~I~S 80 (174)
|||| +|++++||++||+|||++|+++|+.|++||+++|+|+|++.|+++.....+.|+++|.++|++|||++|+|+|.+
T Consensus 2 ~~~~-~p~~~~vg~~Fv~~YY~~ld~~r~~L~~~Y~~~S~l~~~~~~~ng~~~~~~~G~~~I~~~l~~Lp~~~~~~~I~t 80 (140)
T 3q90_A 2 MVME-KPSPLLVGREFVRQYYTLLNQAPDMLHRFYGKNSSYVHGGLDSNGKPADAVYGQKEIHRKVMSQNFTNCHTKIRH 80 (140)
T ss_dssp -------CHHHHHHHHHHHHHHHHHHCGGGGGGGEEEEEEEC----------CCCEEHHHHHHHHHHHTCCCSCEEEEEE
T ss_pred Cccc-CCCHHHHHHHHHHHHHHHHhcCHHHHHhhcccCceEEEEccCCCCceeecccCHHHHHHHHHhCCCccceEEEEe
Confidence 9999 999999999999999999999999999999999999997654221122378999999999999999999999999
Q ss_pred eccccCC--CcEEEEEeeecCCCCCCCCCCCCCCCCCCCccccccccccceecCC
Q psy6110 81 VPVTQQF--PTVKQVEESLPPVTQPPSPPADPTPPSPPKEDEWKWNEQTPVEAPR 133 (174)
Q Consensus 81 iDaQpS~--GILI~VtG~ls~~~~p~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 133 (174)
+|||++. ||||+|+|+|+.+++ ..|-|.|||+|+|.
T Consensus 81 vD~Qps~~~gilI~V~G~l~~~~~-----------------~~~~F~QtF~L~p~ 118 (140)
T 3q90_A 81 VDAHATLNDGVVVQVMGLLSNNNQ-----------------ALRRFMQTFVLAPE 118 (140)
T ss_dssp EEEEECGGGCEEEEEEEEEECTTC-----------------CCEEEEEEEEEEEC
T ss_pred EEEEEeCCCCEEEEEEEEEecCCC-----------------CccEEEEEEEEeec
Confidence 9999998 899999999998653 36889999999987
|
| >3ujm_A Rasputin; NTF2-like fold, RAS signaling, signaling protein; HET: EPE; 2.74A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >1gy6_A Nuclear transport factor 2; 1.6A {Rattus norvegicus} SCOP: d.17.4.2 PDB: 1a2k_A 1oun_A 1ar0_A 1u5o_A 1ask_A 1gy5_A 1jb5_A 1jb4_A 1jb2_A 1qma_A | Back alignment and structure |
|---|
| >1zo2_A NTF2, nuclear transport factor 2; structural genomics, structural genomics consortium, SGC, transport protein; 1.60A {Cryptosporidium parvum} SCOP: d.17.4.2 | Back alignment and structure |
|---|
| >1gy7_A Nuclear transport factor 2; protein transport; 1.6A {Saccharomyces cerevisiae} SCOP: d.17.4.2 PDB: 1gyb_A | Back alignment and structure |
|---|
| >2qiy_A UBP3-associated protein BRE5; deubiquitylation, ubiquitin-specific processing proteases(UB NTF2, protein-protein recognition; 1.69A {Saccharomyces cerevisiae} SCOP: d.17.4.2 PDB: 1zx2_A | Back alignment and structure |
|---|
| >1jkg_A P15; NTF2-like domain, transport protein; 1.90A {Homo sapiens} SCOP: d.17.4.2 PDB: 1jn5_A | Back alignment and structure |
|---|
| >3nv0_B NTF2-related export protein; NTF2-like domain, beta sheet heterodimer interface, nucleopo binding pocket, water mediated interface; 1.84A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >1jkg_B TAP; NTF2-like domain, transport protein; 1.90A {Homo sapiens} SCOP: d.17.4.2 PDB: 1jn5_B 1go5_A | Back alignment and structure |
|---|
| >1q40_B MEX67, mRNA export factor MEX67; NTF2-fold, nuclear export, translation; 1.95A {Candida albicans} SCOP: d.17.4.2 | Back alignment and structure |
|---|
| >1of5_A MRNA export factor MEX67; nuclear protein, repeat, leucine- rich repeat, nuclear transport; 2.8A {Saccharomyces cerevisiae} SCOP: d.17.4.2 | Back alignment and structure |
|---|
| >1q42_A MTR2, mRNA transport regulator MTR2; NTF2-fold, nuclear export, translation; 1.75A {Candida albicans} SCOP: d.17.4.2 PDB: 1q40_A | Back alignment and structure |
|---|
| >3nv0_A Nuclear RNA export factor 2; NTF2-like domain, beta sheet heterodimer interface, nucleopo binding pocket, water mediated interface; 1.84A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >1of5_B MTR2, YKL186C, mRNA transport regulator MTR2; nuclear protein, repeat, leucine- rich repeat, nuclear transport; 2.8A {Saccharomyces cerevisiae} SCOP: d.17.4.2 | Back alignment and structure |
|---|
| >3gwr_A Putative calcium/calmodulin-dependent protein KIN II association domain; YP_315894.1; HET: MSE PG4; 2.01A {Thiobacillus denitrificans atcc 25259} | Back alignment and structure |
|---|
| >3dm8_A Uncharacterized protein RPA4348; siras, putative isomerase, structural genomics, PSI-2, prote structure initiative; HET: CE9; 1.80A {Rhodopseudomonas palustris} SCOP: d.17.4.20 | Back alignment and structure |
|---|
| >4h3u_A Hypothetical protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MSE; 1.15A {Catenulispora acidiphila} | Back alignment and structure |
|---|
| >3cu3_A Domain of unknown function with A cystatin-like F; structural genomics, joint center for structural genomics, J protein structure initiative; 2.00A {Nostoc punctiforme} SCOP: d.17.4.28 | Back alignment and structure |
|---|
| >3dxo_A Uncharacterized snoal-like protein; putative isomerase of the snoal-like family; HET: MSE PGE; 2.70A {Agrobacterium tumefaciens str} SCOP: d.17.4.19 | Back alignment and structure |
|---|
| >3gzb_A Putative snoal-like polyketide cyclase; YP_001182657.1, STRU genomics, joint center for structural genomics, JCSG; HET: MSE; 1.44A {Shewanella putrefaciens} PDB: 3lza_A* | Back alignment and structure |
|---|
| >2gxf_A Hypothetical protein YYBH; alpha-beta protein., structural genomics, PSI, protein structure initiative; HET: MES; 3.10A {Bacillus subtilis} SCOP: d.17.4.22 | Back alignment and structure |
|---|
| >3h51_A Putative calcium/calmodulin dependent protein KIN association domain; NP_636218.1; HET: MSE PG4; 1.70A {Xanthomonas campestris PV} | Back alignment and structure |
|---|
| >3hx8_A MLR2180 protein, putative ketosteroid isomerase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative; HET: MSE UNL PG4; 1.45A {Mesorhizobium loti} | Back alignment and structure |
|---|
| >3h3h_A Uncharacterized snoal-like protein; structural genomics, joint center for structural genomics, J protein structure initiative; HET: MSE UNL MES; 1.60A {Burkholderia thailandensis E264} | Back alignment and structure |
|---|
| >3er7_A Uncharacterized NTF2-like protein; YP_001812677.1, NTF2-like protein of unknown function, struc genomics; HET: MSE; 1.50A {Exiguobacterium sibiricum 255-15} SCOP: d.17.4.24 | Back alignment and structure |
|---|
| >2rcd_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE; 2.32A {Pectobacterium atrosepticum SCRI1043} SCOP: d.17.4.18 | Back alignment and structure |
|---|
| >4i4k_A Uncharacterized protein SGCJ; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: CIT PG4 1PE; 1.70A {Streptomyces globisporus} | Back alignment and structure |
|---|
| >3ehc_A Snoal-like polyketide cyclase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 2.12A {Agrobacterium tumefaciens str} | Back alignment and structure |
|---|
| >3k0z_A Putative polyketide cyclase; structural genomics, joint CENT structural genomics, JCSG, protein structure initiative, PS lipoprotein; HET: NHE; 1.91A {Bacillus cereus} | Back alignment and structure |
|---|
| >1ohp_A Steroid delta-isomerase; inhibitor; HET: ESR; 1.53A {Pseudomonas testosteroni} SCOP: d.17.4.3 PDB: 1qjg_A* 8cho_A* 1ohs_A* 1ocv_A 1isk_A 3nuv_A* 1ogz_A* 3nhx_A* 3m8c_A* 3nxj_A* 3myt_A* 3mki_A 3mhe_A 1buq_A* 3nbr_A* 3t8u_A 3ov4_A* 3nm2_A | Back alignment and structure |
|---|
| >1nww_A Limonene-1,2-epoxide hydrolase; HET: MES; 1.20A {Rhodococcus erythropolis} SCOP: d.17.4.8 PDB: 1nu3_A* | Back alignment and structure |
|---|
| >3en8_A Uncharacterized NTF-2 like protein; YP_553245.1, NTF-2 like protein of unknown function, structu genomics; HET: MSE PG4; 1.85A {Burkholderia xenovorans LB400} SCOP: d.17.4.20 | Back alignment and structure |
|---|
| >3d9r_A Ketosteroid isomerase-like protein; YP_049581.1, structural joint center for structural genomics, JCSG, protein structu initiative; HET: MSE; 2.40A {Pectobacterium atrosepticum} SCOP: d.17.4.27 | Back alignment and structure |
|---|
| >3fh1_A Uncharacterized NTF2-like protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE; 1.60A {Mesorhizobium loti} | Back alignment and structure |
|---|
| >3f9s_A Putative polyketide cyclase; structural genomics, joint center for structural genomics, J protein structure initiative; 1.76A {Acidithiobacillus ferrooxidans atcc 23} | Back alignment and structure |
|---|
| >1oh0_A Steroid delta-isomerase; ketosteroid isomerase, KSI, equilenin, PI, LBHB; HET: EQU; 1.1A {Pseudomonas putida} SCOP: d.17.4.3 PDB: 1e3v_A* 1opy_A 1dmq_A 1dmm_A 1ea2_A 3cpo_A 1e3r_A* 1ogx_A 2inx_A 2pzv_A 1c7h_A 1dmn_A 1k41_A 1oho_A* 3fzw_A* 1cqs_A* 1w00_A 1e97_A 1w6y_A* 3ipt_A* ... | Back alignment and structure |
|---|
| >2owp_A Hypothetical protein BXE_B1374; cystatin-like fold, DUF3225 family protein, structural genom joint center for structural genomics, JCSG; 2.00A {Burkholderia xenovorans} SCOP: d.17.4.18 | Back alignment and structure |
|---|
| >3mg1_A OCP, orange carotenoid protein; carotenoid binding protein, echinone, phycobilisome; HET: ECH; 1.65A {Synechocystis SP} PDB: 3mg2_A* 3mg3_A* 1m98_A* | Back alignment and structure |
|---|
| >2gey_A ACLR protein; alpha+beta barrel, oxidoreductase; HET: PG4; 1.80A {Streptomyces galilaeus} SCOP: d.17.4.9 | Back alignment and structure |
|---|
| >2gex_A SNOL; alpha+beta barrel, oxidoreductase; 2.50A {Streptomyces nogalater} SCOP: d.17.4.9 | Back alignment and structure |
|---|
| >3bb9_A Putative orphan protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE; 1.80A {Shewanella frigidimarina} SCOP: d.17.4.16 | Back alignment and structure |
|---|
| >1sjw_A Nogalonic acid methyl ester cyclase; anthracyclines, nogalamycin, snoal, aldol condensation, LYAS structural genomics; HET: NGV; 1.35A {Streptomyces nogalater} SCOP: d.17.4.9 | Back alignment and structure |
|---|
| >3g16_A Uncharacterized protein with cystatin-like fold; YP_001022489.1, protein of unknown function with cystatin-LI structural genomics; HET: MSE; 1.45A {Methylibium petroleiphilum PM1} | Back alignment and structure |
|---|
| >3ff2_A Uncharacterized cystatin fold protein (YP_497570. NTF2 superfamily; structural genomics; 1.90A {Novosphingobium aromaticivorans dsm 12ORGANISM_TAXID} | Back alignment and structure |
|---|
| >3soy_A NTF2-like superfamily protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; 2.00A {Salmonella enterica subsp} | Back alignment and structure |
|---|
| >3ec9_A Uncharacterized NTF2-like protein; structural genomics, joint center for STR genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.60A {Burkholderia thailandensis E264} SCOP: d.17.4.10 | Back alignment and structure |
|---|
| >2f99_A Aklanonic acid methyl ester cyclase, AKNH; anthracycline,polyketide cyclase,stereoselectivity, aklavino biosynthetic protein; HET: AKV; 1.90A {Streptomyces galilaeus} SCOP: d.17.4.9 PDB: 2f98_A* | Back alignment and structure |
|---|
| >2a15_A Hypothetical protein RV0760C; beta-alpha-barrel, structural genomics, PSI, protein structure initiative; 1.68A {Mycobacterium tuberculosis} SCOP: d.17.4.3 PDB: 2z76_A* 2z77_A* 2z7a_A | Back alignment and structure |
|---|
| >3fgy_A Uncharacterized NTF2-like protein; structural genomics, joint center for STR genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.59A {Burkholderia xenovorans LB400} SCOP: d.17.4.0 | Back alignment and structure |
|---|
| >2bng_A MB2760; epoxide hydrolase, limonene, hydrolase, structural proteomics in europe, spine, structural genomics; 2.5A {Mycobacterium tuberculosis} SCOP: d.17.4.8 | Back alignment and structure |
|---|
| >3jum_A Phenazine biosynthesis protein A/B; chirality, drug design, medicinal CH inhibitor, biosynthetic protein; HET: AOD; 1.45A {Burkholderia SP} PDB: 3b4o_A* 3b4p_A* 3dzl_A* 3ex9_A 3cnm_A* 3jun_A* 3juo_A* 3jup_A* 3juq_A* | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 174 | ||||
| d1zo2a1 | 117 | d.17.4.2 (A:10-126) Nuclear transport factor-2 (NT | 3e-20 | |
| d2qiya1 | 139 | d.17.4.2 (A:3-141) UBP3-associated protein BRE5 {B | 3e-20 | |
| d1gy7a_ | 121 | d.17.4.2 (A:) Nuclear transport factor-2 (NTF2) {B | 4e-20 | |
| d1gy6a_ | 125 | d.17.4.2 (A:) Nuclear transport factor-2 (NTF2) {R | 1e-19 | |
| d1jkga_ | 139 | d.17.4.2 (A:) NTF2-related export protein 1 (p15) | 2e-16 |
| >d1zo2a1 d.17.4.2 (A:10-126) Nuclear transport factor-2 (NTF2) {Cryptosporidium parvum [TaxId: 5807]} Length = 117 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: Cystatin-like superfamily: NTF2-like family: NTF2-like domain: Nuclear transport factor-2 (NTF2) species: Cryptosporidium parvum [TaxId: 5807]
Score = 79.1 bits (195), Expect = 3e-20
Identities = 17/70 (24%), Positives = 25/70 (35%), Gaps = 8/70 (11%)
Query: 12 VGREFVRQYYTLLNQAPAHLHRFYSENSLFIHGGLDAPNRETKQVVGQEQIHEHIQQLNF 71
+G++FV+ YY L Y S+ Q GQ I LNF
Sbjct: 4 IGKQFVQHYYQTFQTNRPALGGLYGPQSMLTWED--------TQFQGQANIVNKFNSLNF 55
Query: 72 RDCHAKIRQV 81
+ +I +V
Sbjct: 56 QRVQFEITRV 65
|
| >d2qiya1 d.17.4.2 (A:3-141) UBP3-associated protein BRE5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 139 | Back information, alignment and structure |
|---|
| >d1gy7a_ d.17.4.2 (A:) Nuclear transport factor-2 (NTF2) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 121 | Back information, alignment and structure |
|---|
| >d1gy6a_ d.17.4.2 (A:) Nuclear transport factor-2 (NTF2) {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 125 | Back information, alignment and structure |
|---|
| >d1jkga_ d.17.4.2 (A:) NTF2-related export protein 1 (p15) {Human (Homo sapiens) [TaxId: 9606]} Length = 139 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 174 | |||
| d1gy7a_ | 121 | Nuclear transport factor-2 (NTF2) {Baker's yeast ( | 99.94 | |
| d1gy6a_ | 125 | Nuclear transport factor-2 (NTF2) {Rat (Rattus nor | 99.94 | |
| d1zo2a1 | 117 | Nuclear transport factor-2 (NTF2) {Cryptosporidium | 99.94 | |
| d1jkga_ | 139 | NTF2-related export protein 1 (p15) {Human (Homo s | 99.9 | |
| d2qiya1 | 139 | UBP3-associated protein BRE5 {Baker's yeast (Sacch | 99.88 | |
| d1of5b_ | 165 | mRNA transport regulator MTR2 {Baker's yeast (Sacc | 99.45 | |
| d1q40b_ | 205 | NTF2-like domain of mRNA export factor MEX67 {Yeas | 99.06 | |
| d1jkgb_ | 186 | NTF2-like domain of Tip associating protein, TAP { | 98.84 | |
| d1of5a_ | 221 | NTF2-like domain of mRNA export factor MEX67 {Bake | 98.78 | |
| d1q42a_ | 174 | mRNA transport regulator MTR2 {Yeast (Candida albi | 97.36 | |
| d3en8a1 | 127 | Uncharacterized protein BxeB2092 {Burkholderia xen | 95.36 | |
| d1m98a2 | 142 | Orange carotenoid protein, C-terminal domain {Cyan | 94.45 | |
| d2owpa1 | 128 | Hypothetical protein BxeB1374 {Burkholderia xenovo | 94.21 | |
| d3dm8a1 | 135 | Uncharacterized protein Rpa4348 {Rhodopseudomonas | 94.08 | |
| d2rcda1 | 127 | Uncharacterized protein ECA3500 {Pectobacterium at | 93.28 | |
| d1oh0a_ | 125 | Delta-5-3-ketosteroid isomerase, steroid delta-iso | 93.03 | |
| d3cu3a1 | 162 | Uncharacterized protein NpunR1993 {Nostoc punctifo | 92.38 | |
| d3dmca1 | 133 | Uncharacterized protein Ava2261 {Anabaena variabil | 91.47 | |
| d3dxoa1 | 117 | Uncharacterized protein Atu0744 {Agrobacterium tum | 90.67 | |
| d2bnga1 | 132 | Uncharacterized protein Mb2760 {Mycobacterium tube | 90.64 | |
| d3b7ca1 | 121 | Uncharacterized protein SO0125 {Shewanella oneiden | 90.53 | |
| d1z1sa1 | 129 | Uncharacterized protein PA3332 {Pseudomonas aerugi | 90.51 | |
| d1ohpa1 | 125 | Delta-5-3-ketosteroid isomerase, steroid delta-iso | 89.42 | |
| d1nwwa_ | 145 | Limonene-1,2-epoxide hydrolase {Rhodococcus erythr | 89.18 | |
| d2gxfa1 | 128 | Hypothetical protein YybH {Bacillus subtilis [TaxI | 87.88 | |
| d3cnxa1 | 153 | Uncharacterized protein SAV4671 {Streptomyces aver | 87.88 | |
| d3ebta1 | 131 | Uncharacterized protein BPSS0132 {Burkholderia pse | 86.59 | |
| d1s5aa_ | 139 | Hypothetical protein YesE {Bacillus subtilis [TaxI | 86.23 | |
| d2f86b1 | 129 | Association domain of calcium/calmodulin-dependent | 85.74 | |
| d2geya1 | 144 | Putative hydroxylase AclR {Streptomyces galilaeus | 83.96 | |
| d3d9ra1 | 132 | Uncharacterized protein ECA1476 {Pectobacterium at | 82.71 | |
| d2gexa1 | 138 | Nogalamycin biosynthesis protein SnoL {Streptomyce | 82.61 | |
| d3ec9a1 | 130 | Uncharacterized protein BTHI0051 {Burkholderia tha | 82.6 | |
| d2a15a1 | 132 | Hypothetical protein Rv0760c {Mycobacterium tuberc | 81.52 | |
| d2k54a1 | 123 | Uncharacterized protein Atu0742 {Agrobacterium tum | 80.47 |
| >d1gy7a_ d.17.4.2 (A:) Nuclear transport factor-2 (NTF2) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: Cystatin-like superfamily: NTF2-like family: NTF2-like domain: Nuclear transport factor-2 (NTF2) species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]
Probab=99.94 E-value=2.7e-28 Score=183.20 Aligned_cols=101 Identities=18% Similarity=0.279 Sum_probs=90.6
Q ss_pred CHHHHHHHHHHHHHHhhccCchhHhhccccCCceeecCCCCCCcCccccccHHHHHHHHHhCCCCcccEEEeeeccccCC
Q psy6110 8 SPQCVGREFVRQYYTLLNQAPAHLHRFYSENSLFIHGGLDAPNRETKQVVGQEQIHEHIQQLNFRDCHAKIRQVPVTQQF 87 (174)
Q Consensus 8 s~~~VG~~FV~qYYt~L~~~p~~L~rFY~~~S~lv~gg~d~~t~eg~~~~G~e~I~eki~sL~f~~~k~~I~SiDaQpS~ 87 (174)
++++||++||++||+.|+++|+.|++||.++|.|+| +|+.+.|+++|.++|++|++++++++|.++||||+.
T Consensus 1 d~~~Ia~~Fv~~YY~~l~~~r~~L~~~Y~~~s~l~~--------~g~~~~G~~~I~~~l~~lp~~~~~~~i~~~D~Qp~~ 72 (121)
T d1gy7a_ 1 DFNTLAQNFTQFYYNQFDTDRSQLGNLYRNESMLTF--------ETSQLQGAKDIVEKLVSLPFQKVQHRITTLDAQPAS 72 (121)
T ss_dssp CHHHHHHHHHHHHHHHHHHHGGGGGGGEEEEEEEEE--------TTEEEESHHHHHHHHHHSCCSCEEEEEEEEEEEESS
T ss_pred CHHHHHHHHHHHHHHHHhcCHHHHHHHcCCCcEEEE--------CCeEecCHHHHHHHHHhCCCcccEEEEeeEeeEEcc
Confidence 578999999999999999999999999999999987 678899999999999999999999999999999965
Q ss_pred ---CcEEEEEeeecCCCCCCCCCCCCCCCCCCCccccccccccceecC
Q psy6110 88 ---PTVKQVEESLPPVTQPPSPPADPTPPSPPKEDEWKWNEQTPVEAP 132 (174)
Q Consensus 88 ---GILI~VtG~ls~~~~p~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 132 (174)
+|||+|+|.++.+++ ..++.|.|+|+|+|
T Consensus 73 ~~~~ili~V~G~~~~~~~----------------~~~~~F~qtF~L~~ 104 (121)
T d1gy7a_ 73 PYGDVLVMITGDLLIDEE----------------QNPQRFSQVFHLIP 104 (121)
T ss_dssp TTSCEEEEEEEEEEETTC----------------SSCEEEEEEEEEEE
T ss_pred CCCeEEEEEEEEEEECCC----------------CCcceeEEEEEEEe
Confidence 699999999998653 23467788887776
|
| >d1gy6a_ d.17.4.2 (A:) Nuclear transport factor-2 (NTF2) {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1zo2a1 d.17.4.2 (A:10-126) Nuclear transport factor-2 (NTF2) {Cryptosporidium parvum [TaxId: 5807]} | Back information, alignment and structure |
|---|
| >d1jkga_ d.17.4.2 (A:) NTF2-related export protein 1 (p15) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2qiya1 d.17.4.2 (A:3-141) UBP3-associated protein BRE5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1of5b_ d.17.4.2 (B:) mRNA transport regulator MTR2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1q40b_ d.17.4.2 (B:) NTF2-like domain of mRNA export factor MEX67 {Yeast (Candida albicans) [TaxId: 5476]} | Back information, alignment and structure |
|---|
| >d1jkgb_ d.17.4.2 (B:) NTF2-like domain of Tip associating protein, TAP {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1of5a_ d.17.4.2 (A:) NTF2-like domain of mRNA export factor MEX67 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1q42a_ d.17.4.2 (A:) mRNA transport regulator MTR2 {Yeast (Candida albicans) [TaxId: 5476]} | Back information, alignment and structure |
|---|
| >d3en8a1 d.17.4.20 (A:1-127) Uncharacterized protein BxeB2092 {Burkholderia xenovorans [TaxId: 36873]} | Back information, alignment and structure |
|---|
| >d1m98a2 d.17.4.6 (A:176-317) Orange carotenoid protein, C-terminal domain {Cyanobacteria (Arthrospira maxima) [TaxId: 129910]} | Back information, alignment and structure |
|---|
| >d2owpa1 d.17.4.18 (A:1-128) Hypothetical protein BxeB1374 {Burkholderia xenovorans [TaxId: 36873]} | Back information, alignment and structure |
|---|
| >d3dm8a1 d.17.4.20 (A:1-135) Uncharacterized protein Rpa4348 {Rhodopseudomonas palustris [TaxId: 1076]} | Back information, alignment and structure |
|---|
| >d2rcda1 d.17.4.18 (A:1-127) Uncharacterized protein ECA3500 {Pectobacterium atrosepticum [TaxId: 29471]} | Back information, alignment and structure |
|---|
| >d1oh0a_ d.17.4.3 (A:) Delta-5-3-ketosteroid isomerase, steroid delta-isomerase, KSI {Pseudomonas putida [TaxId: 303]} | Back information, alignment and structure |
|---|
| >d3cu3a1 d.17.4.28 (A:9-170) Uncharacterized protein NpunR1993 {Nostoc punctiforme [TaxId: 272131]} | Back information, alignment and structure |
|---|
| >d3dmca1 d.17.4.10 (A:1-133) Uncharacterized protein Ava2261 {Anabaena variabilis [TaxId: 1172]} | Back information, alignment and structure |
|---|
| >d3dxoa1 d.17.4.19 (A:1-117) Uncharacterized protein Atu0744 {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d2bnga1 d.17.4.8 (A:13-144) Uncharacterized protein Mb2760 {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d3b7ca1 d.17.4.16 (A:1-121) Uncharacterized protein SO0125 {Shewanella oneidensis [TaxId: 70863]} | Back information, alignment and structure |
|---|
| >d1z1sa1 d.17.4.10 (A:1-129) Uncharacterized protein PA3332 {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1ohpa1 d.17.4.3 (A:1-125) Delta-5-3-ketosteroid isomerase, steroid delta-isomerase, KSI {Comamonas testosteroni, also known as Pseudomonas testosteroni [TaxId: 285]} | Back information, alignment and structure |
|---|
| >d1nwwa_ d.17.4.8 (A:) Limonene-1,2-epoxide hydrolase {Rhodococcus erythropolis [TaxId: 1833]} | Back information, alignment and structure |
|---|
| >d2gxfa1 d.17.4.22 (A:1-128) Hypothetical protein YybH {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d3cnxa1 d.17.4.17 (A:5-157) Uncharacterized protein SAV4671 {Streptomyces avermitilis [TaxId: 33903]} | Back information, alignment and structure |
|---|
| >d3ebta1 d.17.4.9 (A:1-131) Uncharacterized protein BPSS0132 {Burkholderia pseudomallei [TaxId: 28450]} | Back information, alignment and structure |
|---|
| >d1s5aa_ d.17.4.10 (A:) Hypothetical protein YesE {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d2f86b1 d.17.4.7 (B:343-471) Association domain of calcium/calmodulin-dependent protein kinase type II alpha subunit, CAMK2A {Caenorhabditis elegans [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d2geya1 d.17.4.9 (A:2-145) Putative hydroxylase AclR {Streptomyces galilaeus [TaxId: 33899]} | Back information, alignment and structure |
|---|
| >d3d9ra1 d.17.4.27 (A:3-134) Uncharacterized protein ECA1476 {Pectobacterium atrosepticum [TaxId: 29471]} | Back information, alignment and structure |
|---|
| >d2gexa1 d.17.4.9 (A:2-139) Nogalamycin biosynthesis protein SnoL {Streptomyces nogalater [TaxId: 38314]} | Back information, alignment and structure |
|---|
| >d3ec9a1 d.17.4.10 (A:10-139) Uncharacterized protein BTHI0051 {Burkholderia thailandensis [TaxId: 57975]} | Back information, alignment and structure |
|---|
| >d2a15a1 d.17.4.3 (A:5-136) Hypothetical protein Rv0760c {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d2k54a1 d.17.4.29 (A:1-123) Uncharacterized protein Atu0742 {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|