Diaphorina citri psyllid: psy6111


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130---
MKDIYKDRKKFSKQVFQVASSDLVNMGITVVSYTLKDIRDDEGYLKSLGMARTAEVKRDARIGEAEAKKDARIKEAMAEEEKMAARFVNDTEIAKAQRDFEIKKATYDAEVETKSTPTIDVARRLKPYTASTT
cHHHHHHHHHHHHHHHHHHHHHHHHcccEEEEEEEccEEccHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHcHHHHccc
MKDIYKDRKKFSKQVFQVASSDLVNMGITVVSYTLKDIRDDEGYLKSLGM*******************************************AKAQRD*EI************************PY*****
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKDIYKDRKKFSKQVFQVASSDLVNMGITVVSYTLKDIRDDEGYLKSLGMARTAEVKRDARIGEAEAKKDARIKEAMAEEEKMAARFVNDTEIAKAQRDFEIKKATYDAEVETKSTPTIDVARRLKPYTASTT

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Flotillin-1 May act as a scaffolding protein within caveolar membranes, functionally participating in formation of caveolae or caveolae-like vesicles.confidentO61491
Flotillin-1 May act as a scaffolding protein within caveolar membranes, functionally participating in formation of caveolae or caveolae-like vesicles.confidentQ9Z1E1
Flotillin-1 May act as a scaffolding protein within caveolar membranes, functionally participating in formation of caveolae or caveolae-like vesicles.confidentQ767L6

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0007409 [BP]axonogenesisprobableGO:0032502, GO:0044707, GO:0030030, GO:0030154, GO:0048468, GO:0031175, GO:0009653, GO:0007275, GO:0044699, GO:0000904, GO:0000902, GO:0048869, GO:0016043, GO:0032989, GO:0071840, GO:0048666, GO:0048667, GO:0032501, GO:0030182, GO:0009987, GO:0044767, GO:0044763, GO:0048731, GO:0022008, GO:0032990, GO:0048699, GO:0048858, GO:0007399, GO:0048856, GO:0048812, GO:0008150
GO:0008180 [CC]signalosomeprobableGO:0043234, GO:0005575, GO:0032991, GO:0043231, GO:0005634, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0044428, GO:0044424, GO:0043227, GO:0043226, GO:0044422
GO:0072659 [BP]protein localization to plasma membraneprobableGO:0008104, GO:0070727, GO:0016044, GO:0071840, GO:0034613, GO:0016043, GO:0061024, GO:0007009, GO:0044763, GO:0072657, GO:0008150, GO:0009987, GO:0033036, GO:0051179, GO:0044699, GO:0051641
GO:0016600 [CC]flotillin complexprobableGO:0043234, GO:0016020, GO:0032991, GO:0045121, GO:0044464, GO:0005623, GO:0005575, GO:0005901, GO:0071944, GO:0005886, GO:0044425, GO:0044459
GO:0042383 [CC]sarcolemmaprobableGO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0071944, GO:0005886
GO:0035255 [MF]ionotropic glutamate receptor bindingprobableGO:0005102, GO:0003674, GO:0005488, GO:0005515, GO:0035254
GO:0035023 [BP]regulation of Rho protein signal transductionprobableGO:0051056, GO:0009966, GO:0048583, GO:0046578, GO:0050794, GO:0065007, GO:0023051, GO:0008150, GO:0010646, GO:0050789
GO:0034451 [CC]centriolar satelliteprobableGO:0005737, GO:0005856, GO:0015630, GO:0043228, GO:0005575, GO:0043232, GO:0005813, GO:0044464, GO:0043229, GO:0005623, GO:0005815, GO:0044446, GO:0044444, GO:0044430, GO:0044450, GO:0044424, GO:0005622, GO:0043226, GO:0044422
GO:0005768 [CC]endosomeprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1WIN, chain A
Confidence level:very confident
Coverage over the Query: 1-58
View the alignment between query and template
View the model in PyMOL
Template: 3BK6, chain A
Confidence level:confident
Coverage over the Query: 1-78
View the alignment between query and template
View the model in PyMOL