Diaphorina citri psyllid: psy6122


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------10
MATHQVYVIPRSTPLILTTNNGDEDKAPSEATFRGLEFLVYDQTRIGGEPIISSQDTISLYFRTKHSTGLILHADKAPSEATFRGLEFLVYEYCLIVH
ccccccCCccccccEEEEcccccccccccEEEEEccEEEEEEccccccccEEEcccEEEEEEEEccccCEEEECccccccccEEEEEEEEEEEEEEEc
*****VYVIPRSTPLIL**************TFRGLEFLVYDQTRIGGEPIISSQDTISLYFRTKHSTGLILHADKAPSEATFRGLEFLVYEYCLIVH
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MATHQVYVIPRSTPLILTTNNGDEDKAPSEATFRGLEFLVYDQTRIGGEPIISSQDTISLYFRTKHSTGLILHADKAPSEATFRGLEFLVYEYCLIVH

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Neurexin-3 Neuronal cell surface protein that may be involved in cell recognition and cell adhesion. May mediate intracellular signaling.confidentQ6P9K9
Neurexin-3 Neuronal cell surface protein that may be involved in cell recognition and cell adhesion. May mediate intracellular signaling.confidentQ9Y4C0

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0031594 [CC]neuromuscular junctionprobableGO:0005575, GO:0045202
GO:0007268 [BP]synaptic transmissionprobableGO:0044700, GO:0019226, GO:0032501, GO:0044707, GO:0035637, GO:0050877, GO:0009987, GO:0008150, GO:0044763, GO:0023052, GO:0007267, GO:0007154, GO:0044699, GO:0003008
GO:0008306 [BP]associative learningprobableGO:0032501, GO:0044707, GO:0050877, GO:0050896, GO:0050890, GO:0007610, GO:0007611, GO:0008150, GO:0044699, GO:0044708, GO:0007612, GO:0003008
GO:0007416 [BP]synapse assemblyprobableGO:0032502, GO:0050808, GO:0044707, GO:0007399, GO:0032501, GO:0009987, GO:0048856, GO:0016043, GO:0008150, GO:0022607, GO:0044763, GO:0071840, GO:0048731, GO:0007275, GO:0044699, GO:0044085

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2H0B, chain A
Confidence level:very confident
Coverage over the Query: 27-93
View the alignment between query and template
View the model in PyMOL