Diaphorina citri psyllid: psy6125


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240--
MSDRINSKYSEELAQECLEWIREITGENIDTSGNMDNFYEILKDGTLLCKTTINSKYSEELAQECLEWIREITGENIDTSGNMDNFYEILKDGTLLCKLVNDLKPNSVKKINVSTMAFKCMENINCFLDVAREMGVPAQETFQTVDLWERQNLNSVVICLQSLGRKASINSRNFNLKAISLLWELSGGNYGKPSIGPKEADKNVRHFTEEQLKAGQTVISLQYGSNKGANQSGINFGNTRHM
ccccccccccHHHHHHHHHHHHHHccccccccccccccccccccccHHHHHHHHccccHHHHHHHHHHHHHHHccccccccccHHHHHHcccHHHHHHHHHHcccccccccccccccccccccHHHHHHHHHHccccccccccccccccccccHHHHHHHHHHHHHHHHccccccHHHHHHHHHccccccccccccccccccccccccHHHHHccccccccccccccccccccccccccccc
************LAQECLEWIREITGENIDTSGNMDNFYEILKDGTLLCKTTINSKYSEELAQECLEWIREITGENIDTSGNMDNFYEILKDGTLLCKLVNDLKPNSVKKINVSTMAFKCMENINCFLDVAREMGVPAQETFQTVDLWERQNLNSVVICLQSLGRKASINSRNFNLKAISLLWELSGGNY*****************************SLQYGSNKGANQS**NFG**R**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSDRINSKYSEELAQECLEWIREITGENIDTSGNMDNFYEILKDGTLLCKTTINSKYSEELAQECLEWIREITGENIDTSGNMDNFYEILKDGTLLCKLVNDLKPNSVKKINVSTMAFKCMENINCFLDVAREMGVPAQETFQTVDLWERQNLNSVVICLQSLGRKASINSRNFNLKAISLLWELSGGNYGKPSIGPKEADKNVRHFTEEQLKAGQTVISLQYGSNKGANQSGINFGNTRHM

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Transgelin-2 confidentQ9WVA4
Transgelin-3 confidentQ3ZBY2
Transgelin-3 confidentQ5R6R2

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0070594 [MF]juvenile hormone response element bindingprobableGO:0044212, GO:0097159, GO:0000975, GO:0001067, GO:0003674, GO:0005488, GO:0003676, GO:0003677, GO:1901363
GO:0030674 [MF]protein binding, bridgingprobableGO:0003674, GO:0005488, GO:0005515, GO:0060090
GO:0051015 [MF]actin filament bindingprobableGO:0003779, GO:0003674, GO:0005488, GO:0005515, GO:0008092
GO:0048856 [BP]anatomical structure developmentprobableGO:0032502, GO:0008150
GO:0044430 [CC]cytoskeletal partprobableGO:0005856, GO:0005575, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0043228, GO:0044424, GO:0043226, GO:0044422
GO:0044707 [BP]single-multicellular organism processprobableGO:0032501, GO:0008150, GO:0044699
GO:0035626 [BP]juvenile hormone mediated signaling pathwayprobableGO:0023052, GO:0007165, GO:0070887, GO:0007154, GO:0050789, GO:0044699, GO:0009755, GO:0051716, GO:0030522, GO:0071310, GO:0065007, GO:0071495, GO:0009719, GO:0009987, GO:0050794, GO:0032870, GO:0008150, GO:0042221, GO:0010033, GO:0044700, GO:0009725, GO:0050896, GO:0044763
GO:0044448 [CC]cell cortex partprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0071944, GO:0005938, GO:0044424
GO:0030016 [CC]myofibrilprobableGO:0005737, GO:0043232, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044424, GO:0044444, GO:0043228, GO:0043292, GO:0043226
GO:0005634 [CC]nucleusprobableGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0015629 [CC]actin cytoskeletonprobableGO:0005856, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0043228, GO:0044424, GO:0043226
GO:0007015 [BP]actin filament organizationprobableGO:0006996, GO:0007010, GO:0071822, GO:0030029, GO:0043933, GO:0071840, GO:0009987, GO:0030036, GO:0044763, GO:0016043, GO:0008150, GO:0044699

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1P5S, chain A
Confidence level:very confident
Coverage over the Query: 51-168,186-214,225-237
View the alignment between query and template
View the model in PyMOL
Template: 1WYM, chain A
Confidence level:very confident
Coverage over the Query: 1-56
View the alignment between query and template
View the model in PyMOL