Psyllid ID: psy6125

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240--
MSDRINSKYSEELAQECLEWIREITGENIDTSGNMDNFYEILKDGTLLCKTTINSKYSEELAQECLEWIREITGENIDTSGNMDNFYEILKDGTLLCKLVNDLKPNSVKKINVSTMAFKCMENINCFLDVAREMGVPAQETFQTVDLWERQNLNSVVICLQSLGRKASINSRNFNLKAISLLWELSGGNYGKPSIGPKEADKNVRHFTEEQLKAGQTVISLQYGSNKGANQSGINFGNTRHM
ccccccccccHHHHHHHHHHHHHHccccccccccccccccccccccHHHHHHHHccccHHHHHHHHHHHHHHHccccccccccHHHHHHcccHHHHHHHHHHHccccccccccccccccccccHHHHHHHHHHccccccccccccccccccccHHHHHHHHHHHHHHHHccccccHHHHHHHHHHcccccccccccccccccccccccHHHHHccccccccccccccccccccccccccccc
cccccccccHHHHHHHHHHHHHHHccccccccccHHHHHHHHHccHHHHHHHHHHcccHHHHHHHHHHHHHHHcccccccccHHHHHHHHHccHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHHHccccccHEEEHHHHHHcccHHHHHHHHHHHHHHHHHcccccccccHHHcccccccccccccccccccHHccccccHHHHHccccEEEEEcccccccccccccccccccc
MSDRINSKYSEELAQECLEWIREItgenidtsgnmdNFYEILKDGTLLCKTTINSKYSEELAQECLEWIREItgenidtsgnmdNFYEILKDGTLLCKLVndlkpnsvkkINVSTMAFKCMENINCFLDVaremgvpaqetfqTVDLWERQNLNSVVICLQSlgrkasinsrNFNLKAISLLWElsggnygkpsigpkeadknVRHFTEEQLKAGQTVISLqygsnkganqsginfgntrhm
msdrinskySEELAQECLEWIREITGenidtsgnMDNFYEILKDGTLLCKTTINSKYSEELAQECLEWIREITGenidtsgnMDNFYEILKDGTLLCKLVNDLKPNSVKKINVSTMAFKCMENINCFLDVAREMGVPAQETFQTVDLWERQNLNSVVICLQSLGRKASINSRNFNLKAISLLWELSGGNYGKPSIGPKEADKNVRHFTEEQLKAGQTVislqygsnkganqsginfgntrhm
MSDRINSKYSEELAQECLEWIREITGENIDTSGNMDNFYEILKDGTLLCKTTINSKYSEELAQECLEWIREITGENIDTSGNMDNFYEILKDGTLLCKLVNDLKPNSVKKINVSTMAFKCMENINCFLDVAREMGVPAQETFQTVDLWERQNLNSVVICLQSLGRKASINSRNFNLKAISLLWELSGGNYGKPSIGPKEADKNVRHFTEEQLKAGQTVISLQYGSNKGANQSGINFGNTRHM
************LAQECLEWIREITGENIDTSGNMDNFYEILKDGTLLCKTTINSKYSEELAQECLEWIREITGENIDTSGNMDNFYEILKDGTLLCKLVNDLKPNSVKKINVSTMAFKCMENINCFLDVAREMGVPAQETFQTVDLWERQNLNSVVICLQSLGRKASINSRNFNLKAISLLWELSGGNY****************************************************
********************************************************YSEELAQECLEWIREITGENIDTSGNMDNFYEILKDGTLLCKLVNDLKPNSVKKINVSTMAFKCMENINCFLDVAREMGVPAQETFQTVDLWERQNLNSVVICLQSLGRKASINSRNF*********************************************SLQYGSNKGANQS**NFG**R**
*********SEELAQECLEWIREITGENIDTSGNMDNFYEILKDGTLLCKTTINSKYSEELAQECLEWIREITGENIDTSGNMDNFYEILKDGTLLCKLVNDLKPNSVKKINVSTMAFKCMENINCFLDVAREMGVPAQETFQTVDLWERQNLNSVVICLQSLGRKASINSRNFNLKAISLLWELSGGNYGKPSIGPKEADKNVRHFTEEQLKAGQTVISLQYGSNKGANQSGINFGNTRHM
*****NSKYSEELAQECLEWIREITGENIDTSGNMDNFYEILKDGTLLCKTTINSKYSEELAQECLEWIREITGENIDTSGNMDNFYEILKDGTLLCKLVNDLKPNSVKKINVSTMAFKCMENINCFLDVAREMGVPAQETFQTVDLWERQNLNSVVICLQSLGRKASINSRNFNLKAISLLWELSGGNYGKPSIGPKEADKNVRHFTEEQLKAGQTVISLQYGS*K***************
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSDRINSKYSEELAQECLEWIREITGENIDTSGNMDNFYEILKDGTLLCKTTINSKYSEELAQECLEWIREITGENIDTSGNMDNFYEILKDGTLLCKLVNDLKPNSVKKINVSTMAFKCMENINCFLDVAREMGVPAQETFQTVDLWERQNLNSVVICLQSLGRKASINSRNFNLKAISLLWELSGGNYGKPSIGPKEADKNVRHFTEEQLKAGQTVISLQYGSNKGANQSGINFGNTRHM
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query242 2.2.26 [Sep-21-2011]
Q24799190 Myophilin OS=Echinococcus N/A N/A 0.714 0.910 0.443 3e-38
P14318184 Muscle-specific protein 2 no N/A 0.719 0.945 0.422 3e-35
Q9WVA4199 Transgelin-2 OS=Mus muscu yes N/A 0.727 0.884 0.384 5e-27
Q4R5J4199 Transgelin-3 OS=Macaca fa N/A N/A 0.727 0.884 0.389 5e-27
Q9UI15199 Transgelin-3 OS=Homo sapi yes N/A 0.727 0.884 0.389 5e-27
Q5R6R2199 Transgelin-3 OS=Pongo abe yes N/A 0.727 0.884 0.389 6e-27
P37805199 Transgelin-3 OS=Rattus no yes N/A 0.727 0.884 0.389 8e-27
Q9R1Q8199 Transgelin-3 OS=Mus muscu no N/A 0.727 0.884 0.389 8e-27
Q3ZBY2199 Transgelin-3 OS=Bos tauru yes N/A 0.727 0.884 0.389 1e-26
Q5E9F5199 Transgelin-2 OS=Bos tauru no N/A 0.727 0.884 0.379 2e-26
>sp|Q24799|MYPH_ECHGR Myophilin OS=Echinococcus granulosus PE=2 SV=1 Back     alignment and function desciption
 Score =  158 bits (399), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 87/196 (44%), Positives = 116/196 (59%), Gaps = 23/196 (11%)

Query: 49  CKTTINSKYSEELAQECLEWIREITGENIDTSGNMDNFYE-ILKDGTLLCKLVNDLKPNS 107
            K  +  K  ++   E LEWI  +TG  +D S      YE ILKDGT+LCKL+N +KP  
Sbjct: 14  VKKKLEGKRDKDQENEALEWIEALTGLKLDRS----KLYEDILKDGTVLCKLMNSIKPGC 69

Query: 108 VKKINV-STMAFKCMENINCFLDVAREMGVPAQETFQTVDLWERQNLNSVVICLQSLGRK 166
           +KKIN  +TM FK MENI+ FL+  +  GVP  + FQTVDL+E++++  V   L +LGR 
Sbjct: 70  IKKINENATMPFKIMENISAFLEAMKGYGVPVADLFQTVDLFEKKDIAQVTRTLFALGRT 129

Query: 167 ASINSRNFNLKAISLLWELSGGNYGKPSIGPKEADKNVRHFTEEQLKAGQTVISLQYGSN 226
              +                   Y  P +GPK A +N R FTE+QL+ GQ V+SLQYGSN
Sbjct: 130 CQTHPE-----------------YSGPVLGPKLATENKREFTEQQLREGQNVVSLQYGSN 172

Query: 227 KGANQSGINFGNTRHM 242
           KGA+Q+GIN G  R +
Sbjct: 173 KGASQAGINMGKQRMI 188

Echinococcus granulosus (taxid: 6210)
>sp|P14318|MP20_DROME Muscle-specific protein 20 OS=Drosophila melanogaster GN=Mp20 PE=2 SV=2 Back     alignment and function description
>sp|Q9WVA4|TAGL2_MOUSE Transgelin-2 OS=Mus musculus GN=Tagln2 PE=1 SV=4 Back     alignment and function description
>sp|Q4R5J4|TAGL3_MACFA Transgelin-3 OS=Macaca fascicularis GN=TAGLN3 PE=2 SV=1 Back     alignment and function description
>sp|Q9UI15|TAGL3_HUMAN Transgelin-3 OS=Homo sapiens GN=TAGLN3 PE=1 SV=2 Back     alignment and function description
>sp|Q5R6R2|TAGL3_PONAB Transgelin-3 OS=Pongo abelii GN=TAGLN3 PE=2 SV=1 Back     alignment and function description
>sp|P37805|TAGL3_RAT Transgelin-3 OS=Rattus norvegicus GN=Tagln3 PE=1 SV=2 Back     alignment and function description
>sp|Q9R1Q8|TAGL3_MOUSE Transgelin-3 OS=Mus musculus GN=Tagln3 PE=1 SV=1 Back     alignment and function description
>sp|Q3ZBY2|TAGL3_BOVIN Transgelin-3 OS=Bos taurus GN=TAGLN3 PE=2 SV=1 Back     alignment and function description
>sp|Q5E9F5|TAGL2_BOVIN Transgelin-2 OS=Bos taurus GN=TAGLN2 PE=2 SV=3 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query242
48094341188 PREDICTED: myophilin [Apis mellifera] 0.702 0.904 0.773 3e-80
350413114188 PREDICTED: myophilin-like isoform 1 [Bom 0.702 0.904 0.773 2e-79
380022166179 PREDICTED: myophilin-like isoform 1 [Api 0.702 0.949 0.768 4e-79
350413117172 PREDICTED: myophilin-like isoform 2 [Bom 0.702 0.988 0.773 5e-79
340709169188 PREDICTED: myophilin-like isoform 2 [Bom 0.702 0.904 0.768 6e-79
156544887188 PREDICTED: myophilin-like [Nasonia vitri 0.702 0.904 0.773 1e-78
340709167172 PREDICTED: myophilin-like isoform 1 [Bom 0.702 0.988 0.768 2e-78
389611705188 calponin/transgelin [Papilio xuthus] 0.702 0.904 0.752 2e-78
114051357188 transgelin [Bombyx mori] gi|95102666|gb| 0.702 0.904 0.752 1e-77
357625105188 transgelin [Danaus plexippus] 0.702 0.904 0.742 7e-77
>gi|48094341|ref|XP_392114.1| PREDICTED: myophilin [Apis mellifera] Back     alignment and taxonomy information
 Score =  303 bits (777), Expect = 3e-80,   Method: Compositional matrix adjust.
 Identities = 147/190 (77%), Positives = 161/190 (84%), Gaps = 20/190 (10%)

Query: 53  INSKYSEELAQECLEWIREITGENIDTSGNMDNFYEILKDGTLLCKLVNDLKPNSVKKIN 112
           INSKYSEELAQECLEWI+ ITGENI+T+G+MDNFYEILKDG LLCKLVND+K  SVKK+N
Sbjct: 19  INSKYSEELAQECLEWIKTITGENINTNGDMDNFYEILKDGVLLCKLVNDIKEGSVKKVN 78

Query: 113 VSTMAFKCMENINCFLDVAREMGVPAQETFQTVDLWERQNLNSVVICLQSLGRKASINSR 172
            +++AFKCMENIN FL+ AR +GVPAQETFQTVDLWERQNLNSVVICLQSLGRKA     
Sbjct: 79  KTSLAFKCMENINAFLEAARTLGVPAQETFQTVDLWERQNLNSVVICLQSLGRKA----- 133

Query: 173 NFNLKAISLLWELSGGNYGKPSIGPKEADKNVRHFTEEQLKAGQTVISLQYGSNKGANQS 232
                          GNYGKPSIGPKEADKN+R+FTEEQL+AGQ VISLQYGSNKGANQS
Sbjct: 134 ---------------GNYGKPSIGPKEADKNIRNFTEEQLRAGQGVISLQYGSNKGANQS 178

Query: 233 GINFGNTRHM 242
           GINFGNTRHM
Sbjct: 179 GINFGNTRHM 188

Source: Apis mellifera

Species: Apis mellifera

Genus: Apis

Family: Apidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|350413114|ref|XP_003489884.1| PREDICTED: myophilin-like isoform 1 [Bombus impatiens] Back     alignment and taxonomy information
>gi|380022166|ref|XP_003694924.1| PREDICTED: myophilin-like isoform 1 [Apis florea] Back     alignment and taxonomy information
>gi|350413117|ref|XP_003489885.1| PREDICTED: myophilin-like isoform 2 [Bombus impatiens] Back     alignment and taxonomy information
>gi|340709169|ref|XP_003393185.1| PREDICTED: myophilin-like isoform 2 [Bombus terrestris] Back     alignment and taxonomy information
>gi|156544887|ref|XP_001607864.1| PREDICTED: myophilin-like [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|340709167|ref|XP_003393184.1| PREDICTED: myophilin-like isoform 1 [Bombus terrestris] Back     alignment and taxonomy information
>gi|389611705|dbj|BAM19436.1| calponin/transgelin [Papilio xuthus] Back     alignment and taxonomy information
>gi|114051357|ref|NP_001040372.1| transgelin [Bombyx mori] gi|95102666|gb|ABF51271.1| transgelin [Bombyx mori] Back     alignment and taxonomy information
>gi|357625105|gb|EHJ75654.1| transgelin [Danaus plexippus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query242
WB|WBGene00000777192 cpn-1 [Caenorhabditis elegans 0.524 0.661 0.511 1.1e-46
FB|FBgn0035499188 Chd64 "Chd64" [Drosophila mela 0.508 0.654 0.716 6.4e-44
FB|FBgn0002789184 Mp20 "Muscle protein 20" [Dros 0.466 0.614 0.422 5.6e-34
FB|FBgn0038774169 CG5023 [Drosophila melanogaste 0.429 0.615 0.453 2.4e-33
ZFIN|ZDB-GENE-020802-2201 tagln2 "transgelin 2" [Danio r 0.735 0.885 0.409 5e-28
WB|WBGene00000779142 cpn-3 [Caenorhabditis elegans 0.462 0.788 0.508 5.7e-27
UNIPROTKB|Q2HJ38297 CNN1 "Calponin-1" [Bos taurus 0.504 0.410 0.370 9.4e-27
MGI|MGI:104979297 Cnn1 "calponin 1" [Mus musculu 0.504 0.410 0.370 9.4e-27
UNIPROTKB|E2RB32297 CNN1 "Uncharacterized protein" 0.504 0.410 0.370 1.2e-26
UNIPROTKB|Q08092297 CNN1 "Calponin-1" [Sus scrofa 0.504 0.410 0.370 1.2e-26
WB|WBGene00000777 cpn-1 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
 Score = 322 (118.4 bits), Expect = 1.1e-46, Sum P(2) = 1.1e-46
 Identities = 66/129 (51%), Positives = 86/129 (66%)

Query:    43 KDGTLL-CKTTINSKYSEELAQECLEWIREITGENIDTSGNMDNFYEILKDGTLLCKLVN 101
             K G  L  +  I  KY + LA E L+W++ +TG++ DT G+ DN  ++ +DG+LLC L N
Sbjct:    12 KSGIALEAQQKIYEKYDKNLAGEILQWVQNVTGQSFDTQGDADNLVKVFQDGSLLCTLAN 71

Query:   102 DLKPNSVKKINVSTMAFKCMENINCFLDVAREMGVPAQETFQTVDLWERQNLNSVVICLQ 161
              LKP SVKK+N S MAFK MENI+ FL  A E  V   E FQTVDL+E Q+ N+V+ICL 
Sbjct:    72 SLKPGSVKKVNTSAMAFKKMENISFFLKFAEEY-VQKSELFQTVDLYEGQDPNAVLICLA 130

Query:   162 SLGRKASIN 170
             SL RK+  N
Sbjct:   131 SLARKSEKN 139
GO:0007067 "mitosis" evidence=IMP
FB|FBgn0035499 Chd64 "Chd64" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0002789 Mp20 "Muscle protein 20" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0038774 CG5023 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-020802-2 tagln2 "transgelin 2" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
WB|WBGene00000779 cpn-3 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
UNIPROTKB|Q2HJ38 CNN1 "Calponin-1" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
MGI|MGI:104979 Cnn1 "calponin 1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|E2RB32 CNN1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|Q08092 CNN1 "Calponin-1" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9WVA4TAGL2_MOUSENo assigned EC number0.38460.72720.8844yesN/A
P37805TAGL3_RATNo assigned EC number0.38970.72720.8844yesN/A
O14185STG1_SCHPONo assigned EC number0.30580.60740.8448yesN/A
Q5R6R2TAGL3_PONABNo assigned EC number0.38970.72720.8844yesN/A
Q3ZBY2TAGL3_BOVINNo assigned EC number0.38970.72720.8844yesN/A
Q08873SCP1_YEASTNo assigned EC number0.31810.69420.84yesN/A
Q9UI15TAGL3_HUMANNo assigned EC number0.38970.72720.8844yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query242
COG5199178 COG5199, SCP1, Calponin [Cytoskeleton] 1e-31
cd00014107 cd00014, CH, Calponin homology domain; actin-bindi 1e-27
smart00033101 smart00033, CH, Calponin homology domain 3e-21
pfam00307104 pfam00307, CH, Calponin homology (CH) domain 4e-20
COG5261 1054 COG5261, IQG1, Protein involved in regulation of c 6e-12
>gnl|CDD|227526 COG5199, SCP1, Calponin [Cytoskeleton] Back     alignment and domain information 
 Score =  114 bits (286), Expect = 1e-31
 Identities = 60/180 (33%), Positives = 88/180 (48%), Gaps = 22/180 (12%)

Query: 55  SKYSEELAQECLEWIREITGENIDTSGNMDNFYEILKDGTLLCKLVNDLKPNSVKKINVS 114
               ++  +E   WI  + GE  +  G+      +LKDG  LC+++N+  P  +K    S
Sbjct: 8   CPGMDKQQKEVTLWIETVLGEKFEPPGD---LLSLLKDGVRLCRILNEASPLDIK-YKES 63

Query: 115 TMAFKCMENINCFLDVAREMGVPAQETFQTVDLWERQNLNSVVICLQSLGRKASINSRNF 174
            M F  MENI+ F++  +++ VP  E FQT DL+E ++L  VVICL SL R A    R F
Sbjct: 64  KMPFVQMENISSFINGLKKLRVPEYELFQTNDLFEAKDLRQVVICLYSLSRYAQ-KERMF 122

Query: 175 NLKAISLLWELSGGNYGKPSIGPKEADKNVRHFT-EEQLKAGQTVISLQYGSNKGANQSG 233
           +                 P +GP  A K  R F+ +E L   +  I LQYG +  + QS 
Sbjct: 123 SG----------------PFLGPHLATKKPRVFSSQEVLDRSKGAIHLQYGYSDLSEQST 166

Length = 178
>gnl|CDD|237981 cd00014, CH, Calponin homology domain; actin-binding domain which may be present as a single copy or in tandem repeats (which increases binding affinity) Back     alignment and domain information
>gnl|CDD|214479 smart00033, CH, Calponin homology domain Back     alignment and domain information
>gnl|CDD|215849 pfam00307, CH, Calponin homology (CH) domain Back     alignment and domain information
>gnl|CDD|227586 COG5261, IQG1, Protein involved in regulation of cellular morphogenesis/cytokinesis [Cell division and chromosome partitioning / Signal transduction mechanisms] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 242
KOG2046|consensus193 100.0
COG5199178 SCP1 Calponin [Cytoskeleton] 100.0
cd00014107 CH Calponin homology domain; actin-binding domain 99.85
KOG2128|consensus 1401 99.82
COG5261 1054 IQG1 Protein involved in regulation of cellular mo 99.82
KOG2996|consensus 865 99.77
smart00033103 CH Calponin homology domain. Actin binding domains 99.76
PF00307108 CH: Calponin homology (CH) domain; InterPro: IPR00 99.67
KOG0532|consensus722 99.58
PF0040226 Calponin: Calponin family repeat; InterPro: IPR000 99.37
KOG2046|consensus193 99.0
KOG0046|consensus 627 98.77
PF1197185 CAMSAP_CH: CAMSAP CH domain; InterPro: IPR022613 T 98.34
PF0639589 CDC24: CDC24 Calponin; InterPro: IPR010481 This is 98.3
COG5199178 SCP1 Calponin [Cytoskeleton] 97.73
KOG0046|consensus627 96.95
cd00014107 CH Calponin homology domain; actin-binding domain 96.88
COG5069 612 SAC6 Ca2+-binding actin-bundling protein fimbrin/p 96.57
PF00307108 CH: Calponin homology (CH) domain; InterPro: IPR00 96.44
KOG0517|consensus 2473 96.12
smart00033103 CH Calponin homology domain. Actin binding domains 95.82
KOG3631|consensus365 95.53
KOG2128|consensus 1401 94.04
PF06294158 DUF1042: Domain of Unknown Function (DUF1042); Int 93.92
KOG3000|consensus 295 86.63
COG5261 1054 IQG1 Protein involved in regulation of cellular mo 83.27
>KOG2046|consensus Back     alignment and domain information 
Probab=100.00  E-value=2.2e-53  Score=359.67  Aligned_cols=174  Identities=49%  Similarity=0.813  Sum_probs=161.3

Q ss_pred             hhhhhcccccHHHHHHHHHHHHHHhCCCCCCCCChhhHHHHhhhcHHHHHHHHhhcCCCccccccCCccchhhhhHHHHH
Q psy6125          49 CKTTINSKYSEELAQECLEWIREITGENIDTSGNMDNFYEILKDGTLLCKLVNDLKPNSVKKINVSTMAFKCMENINCFL  128 (242)
Q Consensus        49 c~~ki~~Kyd~e~~~e~~~WI~~vlg~~~~~~~~~~~f~~~LrDGvvLCkL~N~l~Pg~i~ki~~~~~~f~~~ENI~~FL  128 (242)
                      ++.|+.+||+++++.++++||+.+.....+   ...+|.+.|+||++||+|+|+|+|++++++++|+++|++||||++|+
T Consensus        14 v~~k~~~k~~~~~~~el~~WI~~~~~~~~~---~~~~f~~~LKDG~iLCkl~N~l~p~~~~~~~~s~~~f~qmEnIs~Fi   90 (193)
T KOG2046|consen   14 VQQKIESKYDDELEKELREWIENVVLTELP---ARGDFQDLLKDGVILCKLINKLYPGVVKKINESKMAFVQMENISNFI   90 (193)
T ss_pred             HHHHhhcccCHHHHHHHHHHHHHhhccCCC---cccCHHHHHcchHHHHHHHHHhCcCcccccccccccHHHHHHHHHHH
Confidence            346899999999999999999997555543   35789999999999999999999988889999999999999999999


Q ss_pred             HHHHHcCCCCcCccccchhhcccChhHHHHHHHHHHHhhhhcccchhhHHHHHHHhhcCCCCCCCCCCCccccccccccc
Q psy6125         129 DVAREMGVPAQETFQTVDLWERQNLNSVVICLQSLGRKASINSRNFNLKAISLLWELSGGNYGKPSIGPKEADKNVRHFT  208 (242)
Q Consensus       129 ~ac~~lGv~~~~lF~t~DL~E~kn~~~Vv~cL~aL~~~a~~~~~~~~~~~~~~~~~~~~~~~~~p~~g~k~~~~~~r~ft  208 (242)
                      ++|+.|||++.++|+|+||||++|+.+|+.||++|++.|                 .....+++|.||||.|++++|+|+
T Consensus        91 ~a~~~ygv~~~d~FqtvDLfE~kd~~~V~vtL~aLa~~a-----------------~~~~~~~~~~~g~k~a~kq~r~f~  153 (193)
T KOG2046|consen   91 KAAKKYGVPEVDLFQTVDLFEGKDMAQVQVTLLALARKA-----------------QKKGLFSGPGIGPKLAEKQPREFT  153 (193)
T ss_pred             HHHHhcCCChhhcccccccccCCCHHHHHHHHHHHHHHH-----------------hhccccCCCCcCCchhhcCcccCC
Confidence            999999999999999999999999999999999999999                 222356799999999999999999


Q ss_pred             HHHhhcccceeeeccccCCCCCcCCCC-CCCCCCC
Q psy6125         209 EEQLKAGQTVISLQYGSNKGANQSGIN-FGNTRHM  242 (242)
Q Consensus       209 ~~~l~~~~~~~~~q~g~~~~asq~g~~-~g~~r~i  242 (242)
                      ++||++|+.||+|||||||+|||+||+ ||++||+
T Consensus       154 ~~~lk~g~~vi~LQmGtnk~asq~g~~~~G~~R~l  188 (193)
T KOG2046|consen  154 DEQLKAGQNVIGLQMGTNKGASQAGMTAYGTRRHL  188 (193)
T ss_pred             HHHHhcccceEEEeeeccchhhccccccccccccc
Confidence            999999999999999999999999999 9999985

>COG5199 SCP1 Calponin [Cytoskeleton] Back     alignment and domain information
>cd00014 CH Calponin homology domain; actin-binding domain which may be present as a single copy or in tandem repeats (which increases binding affinity) Back     alignment and domain information
>KOG2128|consensus Back     alignment and domain information
>COG5261 IQG1 Protein involved in regulation of cellular morphogenesis/cytokinesis [Cell division and chromosome partitioning / Signal transduction mechanisms] Back     alignment and domain information
>KOG2996|consensus Back     alignment and domain information
>smart00033 CH Calponin homology domain Back     alignment and domain information
>PF00307 CH: Calponin homology (CH) domain; InterPro: IPR001715 The calponin homology domain (also known as CH-domain) is a superfamily of actin-binding domains found in both cytoskeletal proteins and signal transduction proteins [] Back     alignment and domain information
>KOG0532|consensus Back     alignment and domain information
>PF00402 Calponin: Calponin family repeat; InterPro: IPR000557 Calponin [, ] is a thin filament-associated protein that is implicated in the regulation and modulation of smooth muscle contraction Back     alignment and domain information
>KOG2046|consensus Back     alignment and domain information
>KOG0046|consensus Back     alignment and domain information
>PF11971 CAMSAP_CH: CAMSAP CH domain; InterPro: IPR022613 This domain is the N-terminal CH domain from calmodulin-regulated spectrin-associated proteins - CAMSAP proteins Back     alignment and domain information
>PF06395 CDC24: CDC24 Calponin; InterPro: IPR010481 This is a calponin homology domain Back     alignment and domain information
>COG5199 SCP1 Calponin [Cytoskeleton] Back     alignment and domain information
>KOG0046|consensus Back     alignment and domain information
>cd00014 CH Calponin homology domain; actin-binding domain which may be present as a single copy or in tandem repeats (which increases binding affinity) Back     alignment and domain information
>COG5069 SAC6 Ca2+-binding actin-bundling protein fimbrin/plastin (EF-Hand superfamily) [Cytoskeleton] Back     alignment and domain information
>PF00307 CH: Calponin homology (CH) domain; InterPro: IPR001715 The calponin homology domain (also known as CH-domain) is a superfamily of actin-binding domains found in both cytoskeletal proteins and signal transduction proteins [] Back     alignment and domain information
>KOG0517|consensus Back     alignment and domain information
>smart00033 CH Calponin homology domain Back     alignment and domain information
>KOG3631|consensus Back     alignment and domain information
>KOG2128|consensus Back     alignment and domain information
>PF06294 DUF1042: Domain of Unknown Function (DUF1042); InterPro: IPR010441 This is a family of proteins of unknown function Back     alignment and domain information
>KOG3000|consensus Back     alignment and domain information
>COG5261 IQG1 Protein involved in regulation of cellular morphogenesis/cytokinesis [Cell division and chromosome partitioning / Signal transduction mechanisms] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query242
1wym_A155 Solution Structure Of The Ch Domain Of Human Transg 1e-17
1wyp_A136 Solution Structure Of The Ch Domain Of Human Calpon 5e-16
1wyn_A146 Solution Structure Of The Ch Domain Of Human Calpon 4e-13
1h67_A108 Nmr Structure Of The Ch Domain Of Calponin Length = 3e-12
1ujo_A144 Solution Structure Of The Ch Domain From Mouse Tran 4e-12
1p5s_A203 Structure And Function Of The Calponin-Homology Dom 8e-10
1p2x_A159 Crystal Structure Of The Calponin-Homology Domain O 1e-09
2d86_A143 Solution Structure Of The Ch Domain From Human Vav- 1e-06
2rr8_A190 Solution Structure Of Calponin Homology Domain Of I 1e-05
3i6x_A193 Crystal Structure Of The Calponin Homology Domain O 1e-05
2l3g_A126 Solution Nmr Structure Of Ch Domain Of Rho Guanine 1e-04
1wyr_A121 Solution Structure Of The Ch Domain Of Human Rho Gu 8e-04
>pdb|1WYM|A Chain A, Solution Structure Of The Ch Domain Of Human Transgelin-2 Length = 155 Back     alignment and structure 
Iteration: 1

 Score = 86.3 bits (212), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 49/116 (42%), Positives = 66/116 (56%), Gaps = 4/116 (3%)
Query: 53  INSKYSEELAQECLEWIREITGENID-TSGNMDNFYEILKDGTLLCKLVNDLKPN---SV 108
           I  +Y  +L Q  ++WI     +++       +NF   LKDGT+LC+L+N L P     V
Sbjct: 10  IEKQYDADLEQILIQWITTQCRKDVGRPQPGRENFQNWLKDGTVLCELINALYPEGQAPV 69
Query: 109 KKINVSTMAFKCMENINCFLDVAREMGVPAQETFQTVDLWERQNLNSVVICLQSLG 164
           KKI  STMAFK ME I+ FL  A   G+   + FQTVDLWE +N+  V   L +LG
Sbjct: 70  KKIQASTMAFKQMEQISQFLQAAERYGINTTDIFQTVDLWEGKNMACVQRTLMNLG 125
>pdb|1WYP|A Chain A, Solution Structure Of The Ch Domain Of Human Calponin 1 Length = 136 Back     alignment and structure
>pdb|1WYN|A Chain A, Solution Structure Of The Ch Domain Of Human Calponin-2 Length = 146 Back     alignment and structure
>pdb|1H67|A Chain A, Nmr Structure Of The Ch Domain Of Calponin Length = 108 Back     alignment and structure
>pdb|1UJO|A Chain A, Solution Structure Of The Ch Domain From Mouse Trangelin Length = 144 Back     alignment and structure
>pdb|1P5S|A Chain A, Structure And Function Of The Calponin-Homology Domain Of An Iqgap Protein From Schizosaccharomyces Pombe Length = 203 Back     alignment and structure
>pdb|1P2X|A Chain A, Crystal Structure Of The Calponin-Homology Domain Of Rng2 From Schizosaccharomyces Pombe Length = 159 Back     alignment and structure
>pdb|2D86|A Chain A, Solution Structure Of The Ch Domain From Human Vav-3 Protein Length = 143 Back     alignment and structure
>pdb|2RR8|A Chain A, Solution Structure Of Calponin Homology Domain Of Iqgap1 Length = 190 Back     alignment and structure
>pdb|3I6X|A Chain A, Crystal Structure Of The Calponin Homology Domain Of Iqgap1 Length = 193 Back     alignment and structure
>pdb|2L3G|A Chain A, Solution Nmr Structure Of Ch Domain Of Rho Guanine Nucleotide Exchange Factor 7 From Homo Sapiens, Northeast Structural Genomics Consortium Target Hr4495e Length = 126 Back     alignment and structure
>pdb|1WYR|A Chain A, Solution Structure Of The Ch Domain Of Human Rho Guanine Nucleotide Exchange Factor 6 Length = 121 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query242
1wyn_A146 Calponin-2; CH domain, F-actin binding, all alpha 7e-49
1p5s_A203 RAS GTPase-activating-like protein RNG2; alpha-hel 3e-46
1p2x_A159 RNG2 protein, RAS GTPase-activating-like protein; 5e-46
1wym_A155 Transgelin-2; CH domain, F-actin binding, all heli 4e-45
1wyp_A136 Calponin 1; CH domain, F-actin binding, all-alpha, 7e-45
1ujo_A144 Transgelin; CH domain, actin binding, structural g 2e-44
1h67_A108 Calponin alpha; cytoskeleton, calponin homology do 1e-43
3i6x_A193 P195, RAS GTPase-activating-like protein iqgap1; a 1e-42
2rr8_A190 Iqgap1 protein; F-actin binding protein, protein b 2e-42
1wyr_A121 RHO guanine nucleotide exchange factor 6; CH domai 7e-38
2l3g_A126 RHO guanine nucleotide exchange factor 7; structur 3e-32
3ky9_A 587 Proto-oncogene VAV; calponin homology domain, DBL 3e-13
1aoa_A275 T-fimbrin; actin-binding protein, calcium-binding, 4e-06
2yrn_A129 Neuron navigator 2 isoform 4; calponin homolgy dom 4e-06
1pxy_A 506 Fimbrin-like protein; calponin homology, F-actin-b 7e-06
1pxy_A506 Fimbrin-like protein; calponin homology, F-actin-b 2e-05
3hoc_A272 Filamin-A; calponin homology domain, actin binding 1e-05
1rt8_A 513 Fimbrin; filamentous actin binding domain (ABD), c 1e-04
2wa7_A245 Filamin-B; disease mutation, skeletal dysplasia, s 2e-04
>1wyn_A Calponin-2; CH domain, F-actin binding, all alpha helix, structural genomics, NPPSFA, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} Length = 146 Back     alignment and structure
 Score =  156 bits (396), Expect = 7e-49
 Identities = 47/157 (29%), Positives = 71/157 (45%), Gaps = 22/157 (14%)

Query: 53  INSKYSEELAQECLEWIREITGENIDTSGNMDNFYEILKDGTLLCKLVNDLKPNSVKKIN 112
           + SKY  +   E   WI  +TG +I       +F + LKDGT+LC L+N L+P SV KIN
Sbjct: 10  LLSKYDPQKEAELRTWIEGLTGLSIG-----PDFQKGLKDGTILCTLMNKLQPGSVPKIN 64

Query: 113 VSTMAFKCMENINCFLDVAREMGVPAQETFQTVDLWERQNLNSVVICLQSLGRKASINSR 172
            S   +  +EN++ F+      G+   + F+  DL+E  N+  V + L +L  KA     
Sbjct: 65  RSMQNWHQLENLSNFIKAMVSYGMNPVDLFEANDLFESGNMTQVQVSLLALAGKAK---- 120

Query: 173 NFNLKAISLLWELSGGNYGKPSIGPKEADKNVRHFTE 209
                        + G      IG K ++K  R    
Sbjct: 121 -------------TKGLQSGVDIGVKYSEKQERSGPS 144
>1p5s_A RAS GTPase-activating-like protein RNG2; alpha-helical bundle, cytokine; 2.22A {Schizosaccharomyces pombe} SCOP: a.40.1.1 Length = 203 Back     alignment and structure
>1p2x_A RNG2 protein, RAS GTPase-activating-like protein; helices, bundle, protein binding; 2.21A {Schizosaccharomyces pombe} SCOP: a.40.1.1 Length = 159 Back     alignment and structure
>1wym_A Transgelin-2; CH domain, F-actin binding, all helix, structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>1wyp_A Calponin 1; CH domain, F-actin binding, all-alpha, structural genomics, NPPSFA, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} Length = 136 Back     alignment and structure
>1ujo_A Transgelin; CH domain, actin binding, structural genomics, riken structural genomics/proteomics initiative, RSGI, structural protein; NMR {Mus musculus} SCOP: a.40.1.1 Length = 144 Back     alignment and structure
>1h67_A Calponin alpha; cytoskeleton, calponin homology domain, actin binding,; NMR {Gallus gallus} SCOP: a.40.1.1 Length = 108 Back     alignment and structure
>3i6x_A P195, RAS GTPase-activating-like protein iqgap1; all helical, calmodulin-binding, cell membrane, membrane, phosphoprotein, protein binding; 2.50A {Homo sapiens} Length = 193 Back     alignment and structure
>2rr8_A Iqgap1 protein; F-actin binding protein, protein binding; NMR {Homo sapiens} Length = 190 Back     alignment and structure
>1wyr_A RHO guanine nucleotide exchange factor 6; CH domain, all-alpha, NPPSFA, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} Length = 121 Back     alignment and structure
>2l3g_A RHO guanine nucleotide exchange factor 7; structural genomics, northeast structural genomics consortiu PSI-biology, calponin-homology domain; NMR {Homo sapiens} Length = 126 Back     alignment and structure
>3ky9_A Proto-oncogene VAV; calponin homology domain, DBL homology domain, pleckst homology domain, C1 domain, guanine-nucleotide releasing FA metal-binding; 2.73A {Homo sapiens} PDB: 2d86_A Length = 587 Back     alignment and structure
>1aoa_A T-fimbrin; actin-binding protein, calcium-binding, phosphorylation; 2.40A {Homo sapiens} SCOP: a.40.1.1 a.40.1.1 Length = 275 Back     alignment and structure
>2yrn_A Neuron navigator 2 isoform 4; calponin homolgy domain, helicase, all alpha, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 129 Back     alignment and structure
>1pxy_A Fimbrin-like protein; calponin homology, F-actin-binding domain (ABD), F-actin- crosslinking, structural genomics; 2.40A {Arabidopsis thaliana} SCOP: a.40.1.1 PDB: 3byh_B Length = 506 Back     alignment and structure
>1pxy_A Fimbrin-like protein; calponin homology, F-actin-binding domain (ABD), F-actin- crosslinking, structural genomics; 2.40A {Arabidopsis thaliana} SCOP: a.40.1.1 PDB: 3byh_B Length = 506 Back     alignment and structure
>3hoc_A Filamin-A; calponin homology domain, actin binding domain, acetylation, actin-binding, alternative splicing, cytoplasm, cytoskeleton; 2.30A {Homo sapiens} PDB: 3hop_A 3hor_A 2wfn_A Length = 272 Back     alignment and structure
>1rt8_A Fimbrin; filamentous actin binding domain (ABD), calponin homology, actin-crosslinking, structural protein; 2.00A {Schizosaccharomyces pombe} SCOP: a.40.1.1 Length = 513 Back     alignment and structure
>2wa7_A Filamin-B; disease mutation, skeletal dysplasia, structural protein, actin-crosslinking, myogenesis, cytoskeleton; 1.85A {Homo sapiens} PDB: 2wa5_A 2wa6_A 3fer_A Length = 245 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query242
1wyn_A146 Calponin-2; CH domain, F-actin binding, all alpha 100.0
2rr8_A190 Iqgap1 protein; F-actin binding protein, protein b 100.0
1wym_A155 Transgelin-2; CH domain, F-actin binding, all heli 100.0
1p5s_A203 RAS GTPase-activating-like protein RNG2; alpha-hel 100.0
1wyp_A136 Calponin 1; CH domain, F-actin binding, all-alpha, 100.0
1p2x_A159 RNG2 protein, RAS GTPase-activating-like protein; 100.0
1ujo_A144 Transgelin; CH domain, actin binding, structural g 100.0
3i6x_A193 P195, RAS GTPase-activating-like protein iqgap1; a 100.0
1h67_A108 Calponin alpha; cytoskeleton, calponin homology do 100.0
1wyr_A121 RHO guanine nucleotide exchange factor 6; CH domai 99.97
2l3g_A126 RHO guanine nucleotide exchange factor 7; structur 99.97
3ky9_A 587 Proto-oncogene VAV; calponin homology domain, DBL 99.93
2yrn_A129 Neuron navigator 2 isoform 4; calponin homolgy dom 99.76
1pxy_A 506 Fimbrin-like protein; calponin homology, F-actin-b 99.6
1aoa_A275 T-fimbrin; actin-binding protein, calcium-binding, 99.59
1rt8_A 513 Fimbrin; filamentous actin binding domain (ABD), c 99.53
1wku_A254 Alpha-actinin 3; calponin homology domain, actin b 99.52
2qjz_A123 Microtubule-associated protein RP/EB family member 99.44
1wyo_A159 Protein EB3, microtubule-associated protein RP/EB 99.42
2wa7_A245 Filamin-B; disease mutation, skeletal dysplasia, s 99.39
1sh5_A245 Plectin 1, PLTN, PCN; actin-binding domain, calpon 99.33
1dxx_A246 Dystrophin; structural protein, muscular dystrophy 99.33
3f7p_A296 Plectin-1; plakin, hemidesmosome, cell adhesion, e 99.28
1wym_A155 Transgelin-2; CH domain, F-actin binding, all heli 99.11
1rt8_A513 Fimbrin; filamentous actin binding domain (ABD), c 99.11
1sjj_A 863 Actinin; 3-helix bundle, calponin homology domain, 99.07
1wyp_A136 Calponin 1; CH domain, F-actin binding, all-alpha, 98.97
3hoc_A272 Filamin-A; calponin homology domain, actin binding 98.96
1wyn_A146 Calponin-2; CH domain, F-actin binding, all alpha 98.93
1aoa_A275 T-fimbrin; actin-binding protein, calcium-binding, 98.9
2vzc_A131 Alpha-parvin; membrane, cytoplasm, cytoskeleton, c 98.84
1ujo_A144 Transgelin; CH domain, actin binding, structural g 98.79
1wku_A254 Alpha-actinin 3; calponin homology domain, actin b 98.73
1pxy_A506 Fimbrin-like protein; calponin homology, F-actin-b 98.73
1sh5_A245 Plectin 1, PLTN, PCN; actin-binding domain, calpon 98.5
4b7l_A 347 Filamin-B; structural protein, FR 1 filamin hinge 98.49
2wa7_A245 Filamin-B; disease mutation, skeletal dysplasia, s 98.48
2rr8_A190 Iqgap1 protein; F-actin binding protein, protein b 98.45
1p5s_A203 RAS GTPase-activating-like protein RNG2; alpha-hel 98.34
3f7p_A296 Plectin-1; plakin, hemidesmosome, cell adhesion, e 98.3
1dxx_A246 Dystrophin; structural protein, muscular dystrophy 98.29
3i6x_A193 P195, RAS GTPase-activating-like protein iqgap1; a 98.28
1h67_A108 Calponin alpha; cytoskeleton, calponin homology do 98.22
1wjo_A124 T-plastin; CH domain, actin binding, structural ge 98.21
1sjj_A 863 Actinin; 3-helix bundle, calponin homology domain, 97.99
1p2x_A159 RNG2 protein, RAS GTPase-activating-like protein; 97.98
2d89_A119 EHBP1 protein; all alpha, calponin homology domain 97.91
1wyl_A116 NEDD9 interacting protein with calponin homology a 97.81
2d87_A128 Smoothelin splice isoform L2; all alpha, calponin 97.74
1wyq_A127 Spectrin beta chain, brain 2; NPPSFA, structural g 97.56
2d88_A121 Protein mical-3; all alpha, calponin homology doma 97.52
2r8u_A268 Microtubule-associated protein RP/EB family member 97.52
1bkr_A109 Spectrin beta chain; filamentous actin-binding dom 97.48
1wyr_A121 RHO guanine nucleotide exchange factor 6; CH domai 97.41
1bhd_A118 Utrophin; calponin homology, actin binding, struct 97.4
2l3g_A126 RHO guanine nucleotide exchange factor 7; structur 97.37
4abo_I145 MAL3, microtubule integrity protein MAL3; structur 97.24
4b7l_A347 Filamin-B; structural protein, FR 1 filamin hinge 97.1
3hoc_A272 Filamin-A; calponin homology domain, actin binding 97.05
2qjx_A127 Protein BIM1; calponin homology domain, protein bi 96.96
2yrn_A129 Neuron navigator 2 isoform 4; calponin homolgy dom 96.94
1wyo_A159 Protein EB3, microtubule-associated protein RP/EB 95.85
2qjz_A123 Microtubule-associated protein RP/EB family member 95.58
3ky9_A 587 Proto-oncogene VAV; calponin homology domain, DBL 94.44
2ee7_A127 Sperm flagellar protein 1; all alpha protein, CH d 94.39
>1wyn_A Calponin-2; CH domain, F-actin binding, all alpha helix, structural genomics, NPPSFA, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} Back     alignment and structure
Probab=100.00  E-value=4.3e-44  Score=293.65  Aligned_cols=139  Identities=34%  Similarity=0.511  Sum_probs=129.7

Q ss_pred             hhhhcccccHHHHHHHHHHHHHHhCCCCCCCCChhhHHHHhhhcHHHHHHHHhhcCCCccccccCCccchhhhhHHHHHH
Q psy6125          50 KTTINSKYSEELAQECLEWIREITGENIDTSGNMDNFYEILKDGTLLCKLVNDLKPNSVKKINVSTMAFKCMENINCFLD  129 (242)
Q Consensus        50 ~~ki~~Kyd~e~~~e~~~WI~~vlg~~~~~~~~~~~f~~~LrDGvvLCkL~N~l~Pg~i~ki~~~~~~f~~~ENI~~FL~  129 (242)
                      ++|++++|++++++++++||+++++++++     ++|.++|+|||+||+|+|++.|++|++|+.++++|+++|||+.||+
T Consensus         7 ~~k~~~ky~~~~~~e~~~WIe~~l~~~i~-----~~l~~~L~DGvvLCkL~N~l~P~~v~kin~~~~~f~~~eNI~~FL~   81 (146)
T 1wyn_A            7 GNRLLSKYDPQKEAELRTWIEGLTGLSIG-----PDFQKGLKDGTILCTLMNKLQPGSVPKINRSMQNWHQLENLSNFIK   81 (146)
T ss_dssp             CCCCCSCCCTTHHHHHHHHHHHHHCCCCC-----SCHHHHHHTTSHHHHHHHHHCTTSCSCCCCSSCHHHHHHHHHHHHH
T ss_pred             HHHHHccCCHHHHHHHHHHHHHHhCCCCc-----HHHHHHHccHHHHHHHHHHhCCCCccccccccccccHHHHHHHHHH
Confidence            46899999999999999999999999983     5899999999999999999999999999999999999999999999


Q ss_pred             HHHHcCCCCcCccccchhhcccChhHHHHHHHHHHHhhhhcccchhhHHHHHHHhhcCCCCCCCCCCCcccccccccccH
Q psy6125         130 VAREMGVPAQETFQTVDLWERQNLNSVVICLQSLGRKASINSRNFNLKAISLLWELSGGNYGKPSIGPKEADKNVRHFTE  209 (242)
Q Consensus       130 ac~~lGv~~~~lF~t~DL~E~kn~~~Vv~cL~aL~~~a~~~~~~~~~~~~~~~~~~~~~~~~~p~~g~k~~~~~~r~ft~  209 (242)
                      +|+.+|||+.++|+|+||||++|+++|+.||++|++.+                 .....+++|.+|||+|++|+|+|||
T Consensus        82 a~~~~Gv~~~~lF~~~DL~e~kn~~~V~~cL~aL~~~a-----------------~~~g~~~~p~~g~k~a~~~~r~f~e  144 (146)
T 1wyn_A           82 AMVSYGMNPVDLFEANDLFESGNMTQVQVSLLALAGKA-----------------KTKGLQSGVDIGVKYSEKQERSGPS  144 (146)
T ss_dssp             HHHHHTCCSSSCCCHHHHHTCSCSHHHHHHHHHHHHHH-----------------GGGTSCCCSCCCCCCCCCCCCCSSC
T ss_pred             HHHHcCCCcccccChhHHHhcCChHHHHHHHHHHHHHH-----------------HhCCCCCCCccceeccccCCCCCCC
Confidence            99999999999999999999999999999999999998                 1112237999999999999999998


Q ss_pred             H
Q psy6125         210 E  210 (242)
Q Consensus       210 ~  210 (242)
                      +
T Consensus       145 ~  145 (146)
T 1wyn_A          145 S  145 (146)
T ss_dssp             C
T ss_pred             C
Confidence            4
>2rr8_A Iqgap1 protein; F-actin binding protein, protein binding; NMR {Homo sapiens} Back     alignment and structure
>1wym_A Transgelin-2; CH domain, F-actin binding, all helix, structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1p5s_A RAS GTPase-activating-like protein RNG2; alpha-helical bundle, cytokine; 2.22A {Schizosaccharomyces pombe} SCOP: a.40.1.1 Back     alignment and structure
>1wyp_A Calponin 1; CH domain, F-actin binding, all-alpha, structural genomics, NPPSFA, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} Back     alignment and structure
>1p2x_A RNG2 protein, RAS GTPase-activating-like protein; helices, bundle, protein binding; 2.21A {Schizosaccharomyces pombe} SCOP: a.40.1.1 Back     alignment and structure
>1ujo_A Transgelin; CH domain, actin binding, structural genomics, riken structural genomics/proteomics initiative, RSGI, structural protein; NMR {Mus musculus} SCOP: a.40.1.1 Back     alignment and structure
>3i6x_A P195, RAS GTPase-activating-like protein iqgap1; all helical, calmodulin-binding, cell membrane, membrane, phosphoprotein, protein binding; 2.50A {Homo sapiens} Back     alignment and structure
>1h67_A Calponin alpha; cytoskeleton, calponin homology domain, actin binding,; NMR {Gallus gallus} SCOP: a.40.1.1 Back     alignment and structure
>1wyr_A RHO guanine nucleotide exchange factor 6; CH domain, all-alpha, NPPSFA, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} Back     alignment and structure
>2l3g_A RHO guanine nucleotide exchange factor 7; structural genomics, northeast structural genomics consortiu PSI-biology, calponin-homology domain; NMR {Homo sapiens} Back     alignment and structure
>3ky9_A Proto-oncogene VAV; calponin homology domain, DBL homology domain, pleckst homology domain, C1 domain, guanine-nucleotide releasing FA metal-binding; 2.73A {Homo sapiens} PDB: 2d86_A Back     alignment and structure
>2yrn_A Neuron navigator 2 isoform 4; calponin homolgy domain, helicase, all alpha, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1pxy_A Fimbrin-like protein; calponin homology, F-actin-binding domain (ABD), F-actin- crosslinking, structural genomics; 2.40A {Arabidopsis thaliana} SCOP: a.40.1.1 PDB: 3byh_B Back     alignment and structure
>1aoa_A T-fimbrin; actin-binding protein, calcium-binding, phosphorylation; 2.40A {Homo sapiens} SCOP: a.40.1.1 a.40.1.1 Back     alignment and structure
>1rt8_A Fimbrin; filamentous actin binding domain (ABD), calponin homology, actin-crosslinking, structural protein; 2.00A {Schizosaccharomyces pombe} SCOP: a.40.1.1 Back     alignment and structure
>1wku_A Alpha-actinin 3; calponin homology domain, actin binding domain, contractIle protein; 1.60A {Homo sapiens} PDB: 1tjt_A 2r0o_A 2eyi_A 2eyn_A 3lue_K Back     alignment and structure
>2qjz_A Microtubule-associated protein RP/EB family member 1; calponin homology domain, microtubule plus END, +TIP, protein binding; 1.25A {Homo sapiens} SCOP: a.40.1.1 PDB: 1pa7_A 1ueg_A 3co1_A 1v5k_A Back     alignment and structure
>1wyo_A Protein EB3, microtubule-associated protein RP/EB family member 3; CH domain, microtubule-binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2wa7_A Filamin-B; disease mutation, skeletal dysplasia, structural protein, actin-crosslinking, myogenesis, cytoskeleton; 1.85A {Homo sapiens} PDB: 2wa5_A 2wa6_A 3fer_A Back     alignment and structure
>1sh5_A Plectin 1, PLTN, PCN; actin-binding domain, calponin-homology domain, structural protein; 2.00A {Mus musculus} SCOP: a.40.1.1 a.40.1.1 PDB: 1sh6_A 1mb8_A Back     alignment and structure
>1dxx_A Dystrophin; structural protein, muscular dystrophy, calponin homology domain, actin-binding, utrophin; 2.6A {Homo sapiens} SCOP: a.40.1.1 a.40.1.1 PDB: 1qag_A Back     alignment and structure
>3f7p_A Plectin-1; plakin, hemidesmosome, cell adhesion, epidermolysis bullosa, actin-binding, alternative splicing, coiled coil, cytoplasm; 2.75A {Homo sapiens} Back     alignment and structure
>1wym_A Transgelin-2; CH domain, F-actin binding, all helix, structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1rt8_A Fimbrin; filamentous actin binding domain (ABD), calponin homology, actin-crosslinking, structural protein; 2.00A {Schizosaccharomyces pombe} SCOP: a.40.1.1 Back     alignment and structure
>1sjj_A Actinin; 3-helix bundle, calponin homology domain, calmodulin-like domain, actin binding protein, contractIle protein; 20.00A {Gallus gallus} SCOP: i.15.1.1 Back     alignment and structure
>1wyp_A Calponin 1; CH domain, F-actin binding, all-alpha, structural genomics, NPPSFA, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} Back     alignment and structure
>3hoc_A Filamin-A; calponin homology domain, actin binding domain, acetylation, actin-binding, alternative splicing, cytoplasm, cytoskeleton; 2.30A {Homo sapiens} PDB: 3hop_A 3hor_A Back     alignment and structure
>1wyn_A Calponin-2; CH domain, F-actin binding, all alpha helix, structural genomics, NPPSFA, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} Back     alignment and structure
>1aoa_A T-fimbrin; actin-binding protein, calcium-binding, phosphorylation; 2.40A {Homo sapiens} SCOP: a.40.1.1 a.40.1.1 Back     alignment and structure
>2vzc_A Alpha-parvin; membrane, cytoplasm, cytoskeleton, cell junction, alternative splicing, calponin homology domain, actin-binding, cell membrane; 1.05A {Homo sapiens} PDB: 2vzd_A* 2vzg_B* 2vzi_B* 2k2r_A 3kmu_B 3kmw_B* 3rep_B* Back     alignment and structure
>1ujo_A Transgelin; CH domain, actin binding, structural genomics, riken structural genomics/proteomics initiative, RSGI, structural protein; NMR {Mus musculus} SCOP: a.40.1.1 Back     alignment and structure
>1wku_A Alpha-actinin 3; calponin homology domain, actin binding domain, contractIle protein; 1.60A {Homo sapiens} PDB: 1tjt_A 2r0o_A 2eyi_A 2eyn_A 3lue_K Back     alignment and structure
>1pxy_A Fimbrin-like protein; calponin homology, F-actin-binding domain (ABD), F-actin- crosslinking, structural genomics; 2.40A {Arabidopsis thaliana} SCOP: a.40.1.1 PDB: 3byh_B Back     alignment and structure
>1sh5_A Plectin 1, PLTN, PCN; actin-binding domain, calponin-homology domain, structural protein; 2.00A {Mus musculus} SCOP: a.40.1.1 a.40.1.1 PDB: 1sh6_A 1mb8_A Back     alignment and structure
>4b7l_A Filamin-B; structural protein, FR 1 filamin hinge ABD-1; 2.05A {Homo sapiens} PDB: 2wfn_A Back     alignment and structure
>2wa7_A Filamin-B; disease mutation, skeletal dysplasia, structural protein, actin-crosslinking, myogenesis, cytoskeleton; 1.85A {Homo sapiens} PDB: 2wa5_A 2wa6_A 3fer_A Back     alignment and structure
>2rr8_A Iqgap1 protein; F-actin binding protein, protein binding; NMR {Homo sapiens} Back     alignment and structure
>1p5s_A RAS GTPase-activating-like protein RNG2; alpha-helical bundle, cytokine; 2.22A {Schizosaccharomyces pombe} SCOP: a.40.1.1 Back     alignment and structure
>3f7p_A Plectin-1; plakin, hemidesmosome, cell adhesion, epidermolysis bullosa, actin-binding, alternative splicing, coiled coil, cytoplasm; 2.75A {Homo sapiens} Back     alignment and structure
>1dxx_A Dystrophin; structural protein, muscular dystrophy, calponin homology domain, actin-binding, utrophin; 2.6A {Homo sapiens} SCOP: a.40.1.1 a.40.1.1 PDB: 1qag_A Back     alignment and structure
>3i6x_A P195, RAS GTPase-activating-like protein iqgap1; all helical, calmodulin-binding, cell membrane, membrane, phosphoprotein, protein binding; 2.50A {Homo sapiens} Back     alignment and structure
>1h67_A Calponin alpha; cytoskeleton, calponin homology domain, actin binding,; NMR {Gallus gallus} SCOP: a.40.1.1 Back     alignment and structure
>1wjo_A T-plastin; CH domain, actin binding, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: a.40.1.1 PDB: 2d85_A Back     alignment and structure
>1sjj_A Actinin; 3-helix bundle, calponin homology domain, calmodulin-like domain, actin binding protein, contractIle protein; 20.00A {Gallus gallus} SCOP: i.15.1.1 Back     alignment and structure
>1p2x_A RNG2 protein, RAS GTPase-activating-like protein; helices, bundle, protein binding; 2.21A {Schizosaccharomyces pombe} SCOP: a.40.1.1 Back     alignment and structure
>2d89_A EHBP1 protein; all alpha, calponin homology domain, actin binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wyl_A NEDD9 interacting protein with calponin homology and LIM domains; CH domain, mical, structural genomics; NMR {Homo sapiens} PDB: 2dk9_A Back     alignment and structure
>2d87_A Smoothelin splice isoform L2; all alpha, calponin homology domain, actin binding, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2jv9_A 2k3s_A Back     alignment and structure
>1wyq_A Spectrin beta chain, brain 2; NPPSFA, structural genomics, riken structural genomics/proteomics initiative, RSGI, structural protein; NMR {Homo sapiens} Back     alignment and structure
>2d88_A Protein mical-3; all alpha, calponin homology domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2e9k_A Back     alignment and structure
>2r8u_A Microtubule-associated protein RP/EB family member 1; cytoskeleton, acetylation, cell cycle, cell division, cytoplasm, mitosis, phosphorylation; 1.35A {Homo sapiens} SCOP: a.40.1.1 PDB: 1vka_A 1txq_B 1wu9_A 2hkq_A 2hl5_A 3tq7_A 3gjo_A 1yib_A 1yig_A Back     alignment and structure
>1bkr_A Spectrin beta chain; filamentous actin-binding domain, cytoskeleton; 1.10A {Homo sapiens} SCOP: a.40.1.1 PDB: 1aa2_A Back     alignment and structure
>1wyr_A RHO guanine nucleotide exchange factor 6; CH domain, all-alpha, NPPSFA, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} Back     alignment and structure
>1bhd_A Utrophin; calponin homology, actin binding, structural protein; 2.00A {Homo sapiens} SCOP: a.40.1.1 Back     alignment and structure
>2l3g_A RHO guanine nucleotide exchange factor 7; structural genomics, northeast structural genomics consortiu PSI-biology, calponin-homology domain; NMR {Homo sapiens} Back     alignment and structure
>4abo_I MAL3, microtubule integrity protein MAL3; structural protein, cytoskeleton, GTPase, END binding; HET: GTP GSP; 8.60A {Schizosaccharomyces pombe} Back     alignment and structure
>4b7l_A Filamin-B; structural protein, FR 1 filamin hinge ABD-1; 2.05A {Homo sapiens} PDB: 2wfn_A Back     alignment and structure
>3hoc_A Filamin-A; calponin homology domain, actin binding domain, acetylation, actin-binding, alternative splicing, cytoplasm, cytoskeleton; 2.30A {Homo sapiens} PDB: 3hop_A 3hor_A Back     alignment and structure
>2qjx_A Protein BIM1; calponin homology domain, protein binding; 1.90A {Saccharomyces cerevisiae} Back     alignment and structure
>2yrn_A Neuron navigator 2 isoform 4; calponin homolgy domain, helicase, all alpha, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wyo_A Protein EB3, microtubule-associated protein RP/EB family member 3; CH domain, microtubule-binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2qjz_A Microtubule-associated protein RP/EB family member 1; calponin homology domain, microtubule plus END, +TIP, protein binding; 1.25A {Homo sapiens} SCOP: a.40.1.1 PDB: 1pa7_A 1ueg_A 3co1_A 1v5k_A Back     alignment and structure
>3ky9_A Proto-oncogene VAV; calponin homology domain, DBL homology domain, pleckst homology domain, C1 domain, guanine-nucleotide releasing FA metal-binding; 2.73A {Homo sapiens} PDB: 2d86_A Back     alignment and structure
>2ee7_A Sperm flagellar protein 1; all alpha protein, CH domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 242
d1ujoa_144 a.40.1.1 (A:) Transgelin {Mouse (Mus musculus) [Ta 6e-39
d1h67a_108 a.40.1.1 (A:) Calponin {Chicken (Gallus gallus) [T 3e-36
d1p2xa_159 a.40.1.1 (A:) Ras GTPase-activating-like protein r 3e-30
d1pxya_ 500 a.40.1.1 (A:) Fimbrin (Plastin), actin-crosslinkin 1e-05
d1pxya_ 500 a.40.1.1 (A:) Fimbrin (Plastin), actin-crosslinkin 2e-04
d1dxxa1111 a.40.1.1 (A:9-119) Dystrophin {Human (Homo sapiens 5e-05
d1sh5a1120 a.40.1.1 (A:8-127) Actin binding domain of plectin 7e-05
d1aoaa2116 a.40.1.1 (A:260-375) Fimbrin (Plastin), actin-cros 1e-04
d1aoaa1131 a.40.1.1 (A:121-251) Fimbrin (Plastin), actin-cros 2e-04
d1sh5a2110 a.40.1.1 (A:128-237) Actin binding domain of plect 8e-04
d1bkra_108 a.40.1.1 (A:) beta-spectrin {Human (Homo sapiens) 0.001
d1rt8a_505 a.40.1.1 (A:) Fimbrin (Plastin), actin-crosslinkin 0.002
d1rt8a_ 505 a.40.1.1 (A:) Fimbrin (Plastin), actin-crosslinkin 0.003
d1rt8a_ 505 a.40.1.1 (A:) Fimbrin (Plastin), actin-crosslinkin 0.004
>d1ujoa_ a.40.1.1 (A:) Transgelin {Mouse (Mus musculus) [TaxId: 10090]} Length = 144 Back     information, alignment and structure

class: All alpha proteins
fold: CH domain-like
superfamily: Calponin-homology domain, CH-domain
family: Calponin-homology domain, CH-domain
domain: Transgelin
species: Mouse (Mus musculus) [TaxId: 10090]

 Score =  130 bits (327), Expect = 6e-39
 Identities = 46/150 (30%), Positives = 65/150 (43%), Gaps = 19/150 (12%)

Query: 56  KYSEELAQECLEWIREITGENIDTSG-NMDNFYEILKDGTLLCKLVNDLKPNSVKKI--- 111
              EEL +  +EWI    G ++         F   LK+G +L KLVN L P   K +   
Sbjct: 5   SSGEELEERLVEWIVVQCGPDVGRPDRGRLGFQVWLKNGVILSKLVNSLYPEGSKPVKVP 64

Query: 112 -NVSTMAFKCMENINCFLDVAREMGVPAQETFQTVDLWERQNLNSVVICLQSLGRKASIN 170
            N  +M FK ME +  FL  A + GV   + FQTVDL+E +++ +V   L +LG  A   
Sbjct: 65  ENPPSMVFKQMEQVAQFLKAAEDYGVIKTDMFQTVDLYEGKDMAAVQRTLMALGSLAV-- 122

Query: 171 SRNFNLKAISLLWELSGGNYGKPSIGPKEA 200
                        +  G   G P+   K  
Sbjct: 123 ------------TKNDGNYRGDPNWFMKSG 140
>d1h67a_ a.40.1.1 (A:) Calponin {Chicken (Gallus gallus) [TaxId: 9031]} Length = 108 Back     information, alignment and structure
>d1p2xa_ a.40.1.1 (A:) Ras GTPase-activating-like protein rng2 {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 159 Back     information, alignment and structure
>d1pxya_ a.40.1.1 (A:) Fimbrin (Plastin), actin-crosslinking domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 500 Back     information, alignment and structure
>d1pxya_ a.40.1.1 (A:) Fimbrin (Plastin), actin-crosslinking domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 500 Back     information, alignment and structure
>d1dxxa1 a.40.1.1 (A:9-119) Dystrophin {Human (Homo sapiens) [TaxId: 9606]} Length = 111 Back     information, alignment and structure
>d1sh5a1 a.40.1.1 (A:8-127) Actin binding domain of plectin {Human (Homo sapiens) [TaxId: 9606]} Length = 120 Back     information, alignment and structure
>d1aoaa2 a.40.1.1 (A:260-375) Fimbrin (Plastin), actin-crosslinking domain {Human (Homo sapiens) [TaxId: 9606]} Length = 116 Back     information, alignment and structure
>d1aoaa1 a.40.1.1 (A:121-251) Fimbrin (Plastin), actin-crosslinking domain {Human (Homo sapiens) [TaxId: 9606]} Length = 131 Back     information, alignment and structure
>d1sh5a2 a.40.1.1 (A:128-237) Actin binding domain of plectin {Human (Homo sapiens) [TaxId: 9606]} Length = 110 Back     information, alignment and structure
>d1bkra_ a.40.1.1 (A:) beta-spectrin {Human (Homo sapiens) [TaxId: 9606]} Length = 108 Back     information, alignment and structure
>d1rt8a_ a.40.1.1 (A:) Fimbrin (Plastin), actin-crosslinking domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 505 Back     information, alignment and structure
>d1rt8a_ a.40.1.1 (A:) Fimbrin (Plastin), actin-crosslinking domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 505 Back     information, alignment and structure
>d1rt8a_ a.40.1.1 (A:) Fimbrin (Plastin), actin-crosslinking domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 505 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query242
d1ujoa_144 Transgelin {Mouse (Mus musculus) [TaxId: 10090]} 100.0
d1h67a_108 Calponin {Chicken (Gallus gallus) [TaxId: 9031]} 100.0
d1p2xa_159 Ras GTPase-activating-like protein rng2 {Fission y 100.0
d1aoaa1131 Fimbrin (Plastin), actin-crosslinking domain {Huma 99.39
d1sh5a1120 Actin binding domain of plectin {Human (Homo sapie 99.08
d1wjoa_124 Fimbrin (Plastin), actin-crosslinking domain {Huma 98.84
d1dxxa1111 Dystrophin {Human (Homo sapiens) [TaxId: 9606]} 98.83
d1aoaa2116 Fimbrin (Plastin), actin-crosslinking domain {Huma 98.6
d1pxya_ 500 Fimbrin (Plastin), actin-crosslinking domain {Thal 98.59
d1ujoa_144 Transgelin {Mouse (Mus musculus) [TaxId: 10090]} 98.5
d1h67a_108 Calponin {Chicken (Gallus gallus) [TaxId: 9031]} 98.34
d2qjza1120 Microtubule-associated protein eb1, N-terminal mic 98.3
d1rt8a_ 505 Fimbrin (Plastin), actin-crosslinking domain {Fiss 98.25
d1rt8a_505 Fimbrin (Plastin), actin-crosslinking domain {Fiss 98.21
d1pxya_500 Fimbrin (Plastin), actin-crosslinking domain {Thal 98.01
d1dxxa2127 Dystrophin {Human (Homo sapiens) [TaxId: 9606]} 97.93
d1sh5a2110 Actin binding domain of plectin {Human (Homo sapie 97.87
d1bhda_108 Utrophin {Human (Homo sapiens) [TaxId: 9606]} 97.86
d1bkra_108 beta-spectrin {Human (Homo sapiens) [TaxId: 9606]} 97.74
d1p2xa_159 Ras GTPase-activating-like protein rng2 {Fission y 97.34
d1aoaa1131 Fimbrin (Plastin), actin-crosslinking domain {Huma 91.06
d1dxxa2127 Dystrophin {Human (Homo sapiens) [TaxId: 9606]} 85.14
d1sh5a2110 Actin binding domain of plectin {Human (Homo sapie 80.12
d1bkra_108 beta-spectrin {Human (Homo sapiens) [TaxId: 9606]} 80.06
>d1ujoa_ a.40.1.1 (A:) Transgelin {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
class: All alpha proteins
fold: CH domain-like
superfamily: Calponin-homology domain, CH-domain
family: Calponin-homology domain, CH-domain
domain: Transgelin
species: Mouse (Mus musculus) [TaxId: 10090]

Probab=100.00  E-value=9.7e-37  Score=247.48  Aligned_cols=132  Identities=35%  Similarity=0.515  Sum_probs=114.4

Q ss_pred             ccccHHHHHHHHHHHHHHhCCCCCCC-CChhhHHHHhhhcHHHHHHHHhhcCCCccccc----cCCccchhhhhHHHHHH
Q psy6125          55 SKYSEELAQECLEWIREITGENIDTS-GNMDNFYEILKDGTLLCKLVNDLKPNSVKKIN----VSTMAFKCMENINCFLD  129 (242)
Q Consensus        55 ~Kyd~e~~~e~~~WI~~vlg~~~~~~-~~~~~f~~~LrDGvvLCkL~N~l~Pg~i~ki~----~~~~~f~~~ENI~~FL~  129 (242)
                      .+|..++++++++||++++|+++..+ .+.++|+++|+||++||+|+|+|+|++|++++    .+.++|++||||+.||+
T Consensus         4 ~~~~~e~e~~~~~WI~~~~g~~~~~~~~~~~~f~~~L~dGvvLCkL~N~l~P~~i~~~~~~~~~~~~~f~~~eNI~~FL~   83 (144)
T d1ujoa_           4 GSSGEELEERLVEWIVVQCGPDVGRPDRGRLGFQVWLKNGVILSKLVNSLYPEGSKPVKVPENPPSMVFKQMEQVAQFLK   83 (144)
T ss_dssp             CCSCCHHHHHHHHHHHHHHCTTTCCCCSSSSSHHHHTTSSHHHHHHHHHHSCTTTCCSCCCSSCCCSHHHHHHHHHHHHH
T ss_pred             ccccHHHHHHHHHHHHHHhCCccCCCCccHHHHHHHHhcChhHHHHHHHHcCCCCCCccccCCCcchhHHHHHHHHHHHH
Confidence            45777899999999999999999643 45678999999999999999999999997764    56778999999999999


Q ss_pred             HHHHcCCCCcCccccchhhcccChhHHHHHHHHHHHhhhhcccchhhHHHHHHHhhcCCCCCC-CCCCCcccc
Q psy6125         130 VAREMGVPAQETFQTVDLWERQNLNSVVICLQSLGRKASINSRNFNLKAISLLWELSGGNYGK-PSIGPKEAD  201 (242)
Q Consensus       130 ac~~lGv~~~~lF~t~DL~E~kn~~~Vv~cL~aL~~~a~~~~~~~~~~~~~~~~~~~~~~~~~-p~~g~k~~~  201 (242)
                      +|+.+||++.++|+|+||||++|+++|+.||++|+|.|               .+...+.|.| |.++||.+.
T Consensus        84 ~c~~~Gv~~~~lF~~~DL~e~kn~~~Vi~cL~~L~r~a---------------~~~~~~~~~g~P~~~pk~~p  141 (144)
T d1ujoa_          84 AAEDYGVIKTDMFQTVDLYEGKDMAAVQRTLMALGSLA---------------VTKNDGNYRGDPNWFMKSGP  141 (144)
T ss_dssp             HHHHHTCCSSSCCCHHHHHTCSCHHHHHHHHHHHHHHH---------------HHHCSSCCSSCSTTTCSSSC
T ss_pred             HHHHhCCCcccccchhHHhhcCCHHHHHHHHHHHHHHH---------------HHccCCCCCCCCCcCCCCCC
Confidence            99999999999999999999999999999999999999               2223355654 788887643
>d1h67a_ a.40.1.1 (A:) Calponin {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1p2xa_ a.40.1.1 (A:) Ras GTPase-activating-like protein rng2 {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1aoaa1 a.40.1.1 (A:121-251) Fimbrin (Plastin), actin-crosslinking domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sh5a1 a.40.1.1 (A:8-127) Actin binding domain of plectin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wjoa_ a.40.1.1 (A:) Fimbrin (Plastin), actin-crosslinking domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dxxa1 a.40.1.1 (A:9-119) Dystrophin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1aoaa2 a.40.1.1 (A:260-375) Fimbrin (Plastin), actin-crosslinking domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pxya_ a.40.1.1 (A:) Fimbrin (Plastin), actin-crosslinking domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1ujoa_ a.40.1.1 (A:) Transgelin {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1h67a_ a.40.1.1 (A:) Calponin {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d2qjza1 a.40.1.1 (A:13-132) Microtubule-associated protein eb1, N-terminal microtubule binding domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rt8a_ a.40.1.1 (A:) Fimbrin (Plastin), actin-crosslinking domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1rt8a_ a.40.1.1 (A:) Fimbrin (Plastin), actin-crosslinking domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1pxya_ a.40.1.1 (A:) Fimbrin (Plastin), actin-crosslinking domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1dxxa2 a.40.1.1 (A:120-246) Dystrophin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sh5a2 a.40.1.1 (A:128-237) Actin binding domain of plectin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bhda_ a.40.1.1 (A:) Utrophin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bkra_ a.40.1.1 (A:) beta-spectrin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p2xa_ a.40.1.1 (A:) Ras GTPase-activating-like protein rng2 {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1aoaa1 a.40.1.1 (A:121-251) Fimbrin (Plastin), actin-crosslinking domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dxxa2 a.40.1.1 (A:120-246) Dystrophin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sh5a2 a.40.1.1 (A:128-237) Actin binding domain of plectin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bkra_ a.40.1.1 (A:) beta-spectrin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure