Diaphorina citri psyllid: psy6126


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210----
MSPFRRPSTVRNATAVFIINLSVSDLMFCCFNLPLAASTFWQRAWTHGHLLCQLFPLLRYGLLAVSLFTVLGITINRYVMIGHPTLYPKLYSSKFLAFMVACTWLFGFGALVPTWLGVWGRFGLEPSIGSCSILPDDYGHSPKEFLFLVAFVIPCISIVVCYARIFYIVRKTAMKSRAMNMKNMNANKGQYDTMKPPGYGKKYMKATVSTDDSP
cEEEEcccccccHHHHHHHHHHHHHHHHHHccccHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHcEEEccccccccccHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccCEECccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccc
MSPFRRPSTVRNATAVFIINLSVSDLMFCCFNLPLAASTFWQRAWTHGHLLCQLFPLLRYGLLAVSLFTVLGITINRYVMIGHPTLYPKLYSSKFLAFMVACTWLFGFGALVPTWLGVWGRFGLEPSIGSCSILPDDYGHSPKEFLFLVAFVIPCISIVVCYARIFYIVRKTA*****************************************
xxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSPFRRPSTVRNATAVFIINLSVSDLMFCCFNLPLAASTFWQRAWTHGHLLCQLFPLLRYGLLAVSLFTVLGITINRYVMIGHPTLYPKLYSSKFLAFMVACTWLFGFGALVPTWLGVWGRFGLEPSIGSCSILPDDYGHSPKEFLFLVAFVIPCISIVVCYARIFYIVRKTAMKSRAMNMKNMNANKGQYDTMKPPGYGKKYMKATVSTDDSP

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0050794 [BP]regulation of cellular processprobableGO:0008150, GO:0065007, GO:0050789
GO:0005886 [CC]plasma membraneprobableGO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3UON, chain A
Confidence level:very confident
Coverage over the Query: 2-180
View the alignment between query and template
View the model in PyMOL
Template: 3KJ6, chain A
Confidence level:probable
Coverage over the Query: 4-37,54-109,144-186
View the alignment between query and template
View the model in PyMOL