Diaphorina citri psyllid: psy6131


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-----
ILYTGKEGKTTQGCPLAKWVIRRASLEEKLLLIVKHRQGHTCSTAWIVVVIVAWEGVPLNQSDGVYAILTNKLNKYGLPTTRRCATNEPRTCACQGLDPDTCGASFSFGCSWSMYYNGCKYARSKTVRKFRLSVRSEEQEIEEKMHLLATTISPLYKALAPGAFTNQCQFEREASECRLGFKPGRPFSGVTACFDFCAHSHRDLHNMNNGCTVSVVLSNPDSLEP
cccccccccccccccHHHHHHHHcccccEEEEEEEEcccccccccEEEEEEEEEccccccccHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccCEEEEEEccccccccccccEEEcccccHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHcccccccccccccccccccEEEcccccHHHHccccccccEEEEEEcccccccc
**Y********QGCPLAKWVIRRASLEEKLLLIVKHRQGHTCSTAWIVVVIVAWEGVPLNQSDGVYAILTNKLNKYGLPTTRRCATNEPRTCACQGLDPDTCGASFSFGCSWSMYYNGCKYARSKTVRKFRLS*******IEEKMHLLATTISPLYKALAPGAFTNQCQFEREASECRLGFKPGRPFSGVTACFDFCAHSHRDLHNMNNGCTVSVVL*N******
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ILYTGKEGKTTQGCPLAKWVIRRASLEEKLLLIVKHRQGHTCSTAWIVVVIVAWEGVPLNQSDGVYAILTNKLNKYGLPTTRRCATNEPRTCACQGLDPDTCGASFSFGCSWSMYYNGCKYARSKTVRKFRLSVRSEEQEIEEKMHLLATTISPLYKALAPGAFTNQCQFEREASECRLGFKPGRPFSGVTACFDFCAHSHRDLHNMNNGCTVSVVLSNPDSLEP

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Methylcytosine dioxygenase TET2 Catalyzes the conversion of methylcytosine (5mC) to 5-hydroxymethylcytosine (hmC). Plays an important role in myelopoiesis. The clear function of 5-hydroxymethylcytosine (hmC) is still unclear but it may influence chromatin structure and recruit specific factors or may constitute an intermediate component in cytosine demethylation.confidentQ6N021
Methylcytosine dioxygenase TET3 Catalyzes the conversion of methylcytosine (5mC) to 5-hydroxymethylcytosine (hmC).confidentQ8BG87

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0055114 [BP]oxidation-reduction processprobableGO:0044710, GO:0008150, GO:0008152
GO:0030154 [BP]cell differentiationprobableGO:0032502, GO:0048869, GO:0009987, GO:0044763, GO:0008150, GO:0044699
GO:0043566 [MF]structure-specific DNA bindingprobableGO:0097159, GO:0003674, GO:0005488, GO:0003676, GO:0003677, GO:1901363
GO:0005634 [CC]nucleusprobableGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0005506 [MF]iron ion bindingprobableGO:0043169, GO:0046914, GO:0043167, GO:0003674, GO:0005488, GO:0046872
GO:0070579 [MF]methylcytosine dioxygenase activityprobableGO:0051213, GO:0016706, GO:0016705, GO:0003824, GO:0003674, GO:0016491
GO:0006493 [BP]protein O-linked glycosylationprobableGO:0044249, GO:0044237, GO:0034645, GO:0009100, GO:0009101, GO:0044267, GO:0044260, GO:0071704, GO:1901576, GO:0009987, GO:0070085, GO:0006464, GO:0009058, GO:0036211, GO:0008150, GO:0008152, GO:0044723, GO:0044238, GO:0005975, GO:0006486, GO:1901137, GO:1901135, GO:0043412, GO:0009059, GO:0043170, GO:0019538, GO:0043413
GO:0080111 [BP]DNA demethylationprobableGO:0019222, GO:0035510, GO:0090304, GO:0034641, GO:0006807, GO:0050789, GO:1901360, GO:0006139, GO:0044710, GO:0006304, GO:0044260, GO:0040029, GO:0071704, GO:0065007, GO:0010468, GO:0060255, GO:0009987, GO:0006725, GO:0043412, GO:0044728, GO:0008150, GO:0008152, GO:0046483, GO:0070988, GO:0044238, GO:0044237, GO:0043170, GO:0006259
GO:0045944 [BP]positive regulation of transcription from RNA polymerase II promoterprobableGO:0009893, GO:0019222, GO:0031328, GO:0031326, GO:0031325, GO:2001141, GO:0031323, GO:0010628, GO:0050789, GO:0080090, GO:0010604, GO:0051171, GO:0009891, GO:2000112, GO:0019219, GO:0010556, GO:0065007, GO:0048518, GO:0010468, GO:0045935, GO:0060255, GO:0009889, GO:0050794, GO:0008150, GO:0045893, GO:0051173, GO:0051252, GO:0051254, GO:0006355, GO:0010557, GO:0006357, GO:0048522
GO:0005515 [MF]protein bindingprobableGO:0003674, GO:0005488
GO:0030097 [BP]hemopoiesisprobableGO:0032502, GO:0002376, GO:0032501, GO:0044707, GO:0048856, GO:0044767, GO:0048513, GO:0008150, GO:0048731, GO:0048534, GO:0007275, GO:0044699, GO:0002520
GO:0080182 [BP]histone H3-K4 trimethylationprobableGO:0006479, GO:0018023, GO:0018022, GO:0008213, GO:0016043, GO:0051568, GO:0044699, GO:0044267, GO:0044260, GO:0006325, GO:0071840, GO:0018193, GO:0071704, GO:0034968, GO:0016571, GO:0016570, GO:0032259, GO:0009987, GO:0006464, GO:0043412, GO:0036211, GO:0043414, GO:0008152, GO:0006996, GO:0044238, GO:0051276, GO:0018205, GO:0044763, GO:0044237, GO:0043170, GO:0019538, GO:0008150, GO:0016568, GO:0016569
GO:0090310 [BP]negative regulation of methylation-dependent chromatin silencingprobableGO:0031936, GO:0033044, GO:0031935, GO:0009893, GO:0019222, GO:0033043, GO:0031326, GO:0031325, GO:0051173, GO:0031323, GO:0051129, GO:0051254, GO:0010628, GO:0031328, GO:0090308, GO:0050789, GO:0044699, GO:0080090, GO:0010604, GO:0051171, GO:0009891, GO:2000112, GO:0040029, GO:0019219, GO:0065007, GO:0048518, GO:0048519, GO:0045815, GO:0010468, GO:0045935, GO:0060255, GO:0009987, GO:0009889, GO:0050794, GO:0044763, GO:0045893, GO:2001141, GO:0051128, GO:0060969, GO:0060968, GO:0051252, GO:0010639, GO:0006355, GO:0010557, GO:0010556, GO:0008150, GO:0048522, GO:0048523, GO:2001251

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

No confident structure templates for the query are predicted