Diaphorina citri psyllid: psy6172


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130
MSDDLWRECAAWLTRCGVLREDHKANWSEASMSDLALTLRDGVVICNLLNNLDPACIDMREVNQKPQLAQFLCLRNIRIFIQICRNYFDIAENDLFEPSMLFDFGDFFKVLHTLSKLSLCPKVQKQKNIK
ccHHHHHHHHHHHHHccccccccccccccccHHHHHHHcccHHHHHHHHHHccccccccccccccccHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccHHHHHHHHHHHcccHHHHHccccc
**DDLWRECAAWLTRCGVLREDHKANWSEASMSDLALTLRDGVVICNLLNNLDPACIDMREVNQKPQLAQFLCLRNIRIFIQICRNYFDIAENDLFEPSMLFDFGDFFKVLHTLSKLSLCPK********
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSDDLWRECAAWLTRCGVLREDHKANWSEASMSDLALTLRDGVVICNLLNNLDPACIDMREVNQKPQLAQFLCLRNIRIFIQICRNYFDIAENDLFEPSMLFDFGDFFKVLHTLSKLSLCPKVQKQKNIK

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005737 [CC]cytoplasmprobableGO:0044424, GO:0005575, GO:0044464, GO:0005623, GO:0005622
GO:0042995 [CC]cell projectionprobableGO:0005575, GO:0044464, GO:0005623
GO:0043232 [CC]intracellular non-membrane-bounded organelleprobableGO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0043228, GO:0044424, GO:0043226
GO:0050794 [BP]regulation of cellular processprobableGO:0008150, GO:0065007, GO:0050789
GO:0031532 [BP]actin cytoskeleton reorganizationprobableGO:0006996, GO:0007010, GO:0030029, GO:0071840, GO:0009987, GO:0030036, GO:0044763, GO:0016043, GO:0008150, GO:0044699
GO:0003674 [MF]molecular_functionprobable
GO:0044446 [CC]intracellular organelle partprobableGO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043226, GO:0044422

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3KY9, chain A
Confidence level:very confident
Coverage over the Query: 4-130
View the alignment between query and template
View the model in PyMOL