Psyllid ID: psy6172

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130
MSDDLWRECAAWLTRCGVLREDHKANWSEASMSDLALTLRDGVVICNLLNNLDPACIDMREVNQKPQLAQFLCLRNIRIFIQICRNYFDIAENDLFEPSMLFDFGDFFKVLHTLSKLSLCPKVQKQKNIK
ccHHHHHHHHHHHHHHcccccccccccccccHHHHHHHcccHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccHHHHHHHHHHHcccHHHHHccccc
ccHHHHHHHHHHHHHcccccccccccccccHHHHHHHHHHccHHHHHHHHHcccccccHHHccccccHHHHHHHHHHHHHHHHHHHHccccHHHHccccHHHccccHHHHHHHHHHHcccHHHHHccccc
MSDDLWRECAAWLTRcgvlredhkanwseasMSDLALTLRDGVVICNLlnnldpacidmrevnqkpqLAQFLCLRNIRIFIQICRNYFdiaendlfepsmlfdfGDFFKVLHTLsklslcpkvqkqknik
MSDDLWRECAAWLTRCGVLREDHKANWSEASMSDLALTLRDGVVICNLLNNLDPACIDMREVNQKPQLAQFLCLRNIRIFIQICRNYFDIAENDLFEPSMLFDFGDFFKVLHTLsklslcpkvqkqknik
MSDDLWRECAAWLTRCGVLREDHKANWSEASMSDLALTLRDGVVICNLLNNLDPACIDMREVNQKPQLAQFLCLRNIRIFIQICRNYFDIAENDLFEPSMLFDFGDFFKVLHTLSKLSLCPKVQKQKNIK
****LWRECAAWLTRCGVLREDHKANWSEASMSDLALTLRDGVVICNLLNNLDPACIDMREVNQKPQLAQFLCLRNIRIFIQICRNYFDIAENDLFEPSMLFDFGDFFKVLHTLSKLSLCP*********
**DDLWRECAAWLTRCGVLREDHKANWSEASMSDLALTLRDGVVICNLLNNLDPACI****************LRNIRIFIQICRNYFDIAENDLFEPSMLFDFGDFFKVLHTLSKLSLCPK********
MSDDLWRECAAWLTRCGVLREDHKANWSEASMSDLALTLRDGVVICNLLNNLDPACIDMREVNQKPQLAQFLCLRNIRIFIQICRNYFDIAENDLFEPSMLFDFGDFFKVLHTLSKLSLCP*********
*SDDLWRECAAWLTRCGVLREDHKANWSEASMSDLALTLRDGVVICNLLNNLDPACIDMREVNQKPQLAQFLCLRNIRIFIQICRNYFDIAENDLFEPSMLFDFGDFFKVLHTLSKLSLCPKVQK*****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSDDLWRECAAWLTRCGVLREDHKANWSEASMSDLALTLRDGVVICNLLNNLDPACIDMREVNQKPQLAQFLCLRNIRIFIQICRNYFDIAENDLFEPSMLFDFGDFFKVLHTLSKLSLCPKVQKQKNIK
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query130 2.2.26 [Sep-21-2011]
Q9NHV9 793 Protein vav OS=Drosophila no N/A 0.961 0.157 0.576 1e-38
Q9R0C8 847 Guanine nucleotide exchan yes N/A 0.892 0.136 0.5 2e-29
P52735 878 Guanine nucleotide exchan yes N/A 0.876 0.129 0.482 3e-29
Q60992 868 Guanine nucleotide exchan no N/A 0.876 0.131 0.482 3e-29
Q9UKW4 847 Guanine nucleotide exchan no N/A 0.892 0.136 0.5 3e-29
P27870 845 Proto-oncogene vav OS=Mus no N/A 0.946 0.145 0.495 3e-26
P54100 843 Proto-oncogene vav OS=Rat no N/A 0.946 0.145 0.495 4e-26
Q08DN7 844 Proto-oncogene vav OS=Bos no N/A 0.946 0.145 0.495 6e-26
P15498 845 Proto-oncogene vav OS=Hom no N/A 0.930 0.143 0.504 2e-25
Q45FX5 1007 Protein vav-1 OS=Caenorha yes N/A 0.846 0.109 0.4 1e-16
>sp|Q9NHV9|VAV_DROME Protein vav OS=Drosophila melanogaster GN=vav PE=2 SV=2 Back     alignment and function desciption
 Score =  157 bits (398), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 72/125 (57%), Positives = 97/125 (77%)

Query: 1   MSDDLWRECAAWLTRCGVLREDHKANWSEASMSDLALTLRDGVVICNLLNNLDPACIDMR 60
           ++ DLWREC AWLTRC V+  DHKA   +A +  LA+TLRDGV++CNL+ +LDP+ +D R
Sbjct: 16  VNGDLWRECVAWLTRCKVIPPDHKAAQPDAEIRILAMTLRDGVLLCNLVIHLDPSSLDPR 75

Query: 61  EVNQKPQLAQFLCLRNIRIFIQICRNYFDIAENDLFEPSMLFDFGDFFKVLHTLSKLSLC 120
           E N+KPQ+AQFLC +NI++F+ +C N F I + DLFEP+ML+D  +F +VL TLSKLS C
Sbjct: 76  EFNRKPQMAQFLCSKNIKLFLDVCHNNFGIRDADLFEPTMLYDLTNFHRVLITLSKLSQC 135

Query: 121 PKVQK 125
            KVQ+
Sbjct: 136 RKVQQ 140
Couples tyrosine kinase signals with the activation of the Rho/Rac GTPases. Probably plays a pivotal role as a signal transducer protein during fruit fly development.
Drosophila melanogaster (taxid: 7227)
>sp|Q9R0C8|VAV3_MOUSE Guanine nucleotide exchange factor VAV3 OS=Mus musculus GN=Vav3 PE=1 SV=2 Back     alignment and function description
>sp|P52735|VAV2_HUMAN Guanine nucleotide exchange factor VAV2 OS=Homo sapiens GN=VAV2 PE=1 SV=2 Back     alignment and function description
>sp|Q60992|VAV2_MOUSE Guanine nucleotide exchange factor VAV2 OS=Mus musculus GN=Vav2 PE=1 SV=1 Back     alignment and function description
>sp|Q9UKW4|VAV3_HUMAN Guanine nucleotide exchange factor VAV3 OS=Homo sapiens GN=VAV3 PE=1 SV=1 Back     alignment and function description
>sp|P27870|VAV_MOUSE Proto-oncogene vav OS=Mus musculus GN=Vav1 PE=1 SV=1 Back     alignment and function description
>sp|P54100|VAV_RAT Proto-oncogene vav OS=Rattus norvegicus GN=Vav1 PE=2 SV=1 Back     alignment and function description
>sp|Q08DN7|VAV_BOVIN Proto-oncogene vav OS=Bos taurus GN=VAV1 PE=2 SV=1 Back     alignment and function description
>sp|P15498|VAV_HUMAN Proto-oncogene vav OS=Homo sapiens GN=VAV1 PE=1 SV=4 Back     alignment and function description
>sp|Q45FX5|VAV_CAEEL Protein vav-1 OS=Caenorhabditis elegans GN=vav-1 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query130
357623523 888 hypothetical protein KGM_04810 [Danaus p 0.923 0.135 0.658 3e-47
340711588 766 PREDICTED: protein vav-like [Bombus terr 0.930 0.157 0.644 2e-45
350416055 766 PREDICTED: protein vav-like [Bombus impa 0.930 0.157 0.636 5e-45
328789163 766 PREDICTED: protein vav-like [Apis mellif 0.930 0.157 0.636 2e-43
380030241 795 PREDICTED: protein vav-like [Apis florea 0.930 0.152 0.636 2e-43
307183368 773 Protein vav [Camponotus floridanus] 0.930 0.156 0.636 9e-42
383865423 766 PREDICTED: LOW QUALITY PROTEIN: protein 0.953 0.161 0.612 9e-42
328701737 813 PREDICTED: protein vav-like isoform 1 [A 0.961 0.153 0.584 1e-41
307195349205 Protein vav [Harpegnathos saltator] 0.930 0.590 0.619 2e-41
322791334 794 hypothetical protein SINV_04187 [Solenop 0.930 0.152 0.611 6e-41
>gi|357623523|gb|EHJ74634.1| hypothetical protein KGM_04810 [Danaus plexippus] Back     alignment and taxonomy information
 Score =  192 bits (489), Expect = 3e-47,   Method: Composition-based stats.
 Identities = 79/120 (65%), Positives = 100/120 (83%)

Query: 3   DDLWRECAAWLTRCGVLREDHKANWSEASMSDLALTLRDGVVICNLLNNLDPACIDMREV 62
           +DLWRECA WLTRCG+LR DHKANW  +++ DLA TLRDGV++CNLLN L P CIDM++V
Sbjct: 6   EDLWRECATWLTRCGLLRPDHKANWETSTIHDLAYTLRDGVLLCNLLNTLYPGCIDMKDV 65

Query: 63  NQKPQLAQFLCLRNIRIFIQICRNYFDIAENDLFEPSMLFDFGDFFKVLHTLSKLSLCPK 122
           NQ+PQ+AQFLC+RNI++F++ C   F++ E DLF+PSMLFD  DF +VL TL+KLS CPK
Sbjct: 66  NQRPQMAQFLCMRNIKVFLRTCHEVFELRETDLFDPSMLFDLSDFHRVLCTLAKLSQCPK 125

Source: Danaus plexippus

Species: Danaus plexippus

Genus: Danaus

Family: Nymphalidae

Order: Lepidoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|340711588|ref|XP_003394357.1| PREDICTED: protein vav-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|350416055|ref|XP_003490828.1| PREDICTED: protein vav-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|328789163|ref|XP_396932.3| PREDICTED: protein vav-like [Apis mellifera] Back     alignment and taxonomy information
>gi|380030241|ref|XP_003698761.1| PREDICTED: protein vav-like [Apis florea] Back     alignment and taxonomy information
>gi|307183368|gb|EFN70226.1| Protein vav [Camponotus floridanus] Back     alignment and taxonomy information
>gi|383865423|ref|XP_003708173.1| PREDICTED: LOW QUALITY PROTEIN: protein vav-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|328701737|ref|XP_001946064.2| PREDICTED: protein vav-like isoform 1 [Acyrthosiphon pisum] gi|328701739|ref|XP_003241697.1| PREDICTED: protein vav-like isoform 2 [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|307195349|gb|EFN77269.1| Protein vav [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|322791334|gb|EFZ15824.1| hypothetical protein SINV_04187 [Solenopsis invicta] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query130
FB|FBgn0040068 793 Vav "Vav ortholog (H. sapiens) 0.961 0.157 0.576 3.7e-36
ZFIN|ZDB-GENE-070912-251 822 vav3b "vav 3 guanine nucleotid 0.969 0.153 0.496 8.9e-29
UNIPROTKB|Q08DN7 844 VAV1 "Proto-oncogene vav" [Bos 0.946 0.145 0.495 1.2e-28
MGI|MGI:98923 845 Vav1 "vav 1 oncogene" [Mus mus 0.946 0.145 0.495 1.2e-28
RGD|3951 843 Vav1 "vav 1 guanine nucleotide 0.946 0.145 0.495 1.5e-28
UNIPROTKB|E2RGT8 845 VAV1 "Uncharacterized protein" 0.946 0.145 0.495 1.5e-28
UNIPROTKB|P15498 845 VAV1 "Proto-oncogene vav" [Hom 0.946 0.145 0.495 1.5e-28
MGI|MGI:102718 868 Vav2 "vav 2 oncogene" [Mus mus 0.953 0.142 0.456 5.6e-28
RGD|1306285 868 Vav2 "vav 2 guanine nucleotide 0.953 0.142 0.456 5.6e-28
UNIPROTKB|P52735 878 VAV2 "Guanine nucleotide excha 0.953 0.141 0.456 5.8e-28
FB|FBgn0040068 Vav "Vav ortholog (H. sapiens)" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 398 (145.2 bits), Expect = 3.7e-36, P = 3.7e-36
 Identities = 72/125 (57%), Positives = 97/125 (77%)

Query:     1 MSDDLWRECAAWLTRCGVLREDHKANWSEASMSDLALTLRDGVVICNLLNNLDPACIDMR 60
             ++ DLWREC AWLTRC V+  DHKA   +A +  LA+TLRDGV++CNL+ +LDP+ +D R
Sbjct:    16 VNGDLWRECVAWLTRCKVIPPDHKAAQPDAEIRILAMTLRDGVLLCNLVIHLDPSSLDPR 75

Query:    61 EVNQKPQLAQFLCLRNIRIFIQICRNYFDIAENDLFEPSMLFDFGDFFKVLHTLSKLSLC 120
             E N+KPQ+AQFLC +NI++F+ +C N F I + DLFEP+ML+D  +F +VL TLSKLS C
Sbjct:    76 EFNRKPQMAQFLCSKNIKLFLDVCHNNFGIRDADLFEPTMLYDLTNFHRVLITLSKLSQC 135

Query:   121 PKVQK 125
              KVQ+
Sbjct:   136 RKVQQ 140
GO:0005085 "guanyl-nucleotide exchange factor activity" evidence=ISS;IDA
GO:0019992 "diacylglycerol binding" evidence=ISS
GO:0007266 "Rho protein signal transduction" evidence=ISS
GO:0008360 "regulation of cell shape" evidence=IMP
GO:0007155 "cell adhesion" evidence=IMP
GO:0007015 "actin filament organization" evidence=IMP
GO:0005543 "phospholipid binding" evidence=IEA
GO:0005622 "intracellular" evidence=IEA
GO:0035023 "regulation of Rho protein signal transduction" evidence=IEA
GO:0005089 "Rho guanyl-nucleotide exchange factor activity" evidence=IEA
GO:0016477 "cell migration" evidence=IMP
GO:0007391 "dorsal closure" evidence=IMP
GO:0007424 "open tracheal system development" evidence=IMP
GO:0007411 "axon guidance" evidence=IMP
GO:0007520 "myoblast fusion" evidence=IMP
GO:0031532 "actin cytoskeleton reorganization" evidence=IDA
GO:0007417 "central nervous system development" evidence=IGI
GO:0007409 "axonogenesis" evidence=IMP
GO:0072499 "photoreceptor cell axon guidance" evidence=IMP
GO:0035011 "melanotic encapsulation of foreign target" evidence=IMP
ZFIN|ZDB-GENE-070912-251 vav3b "vav 3 guanine nucleotide exchange factor b" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|Q08DN7 VAV1 "Proto-oncogene vav" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
MGI|MGI:98923 Vav1 "vav 1 oncogene" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|3951 Vav1 "vav 1 guanine nucleotide exchange factor" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|E2RGT8 VAV1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|P15498 VAV1 "Proto-oncogene vav" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
MGI|MGI:102718 Vav2 "vav 2 oncogene" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|1306285 Vav2 "vav 2 guanine nucleotide exchange factor" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|P52735 VAV2 "Guanine nucleotide exchange factor VAV2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query130
pfam00307104 pfam00307, CH, Calponin homology (CH) domain 1e-09
smart00033101 smart00033, CH, Calponin homology domain 3e-09
pfam1197185 pfam11971, CAMSAP_CH, CAMSAP CH domain 8e-09
cd00014107 cd00014, CH, Calponin homology domain; actin-bindi 4e-08
COG5199178 COG5199, SCP1, Calponin [Cytoskeleton] 1e-06
>gnl|CDD|215849 pfam00307, CH, Calponin homology (CH) domain Back     alignment and domain information 
 Score = 51.9 bits (125), Expect = 1e-09
 Identities = 26/115 (22%), Positives = 48/115 (41%), Gaps = 13/115 (11%)

Query: 6   WRECAAWLTRCGVLREDHKANWSEASMSDLALTLRDGVVICNLLNNLDPACIDMREVNQK 65
            +    W+                  +++    LRDG+ +C LLN L P  ID+++VN+ 
Sbjct: 1   EKALLRWINEVLGEYGGLP-------VTNFFEDLRDGLALCALLNKLRPGLIDLKKVNKN 53

Query: 66  PQLAQFLCLRNIRIFIQICRNYFDIAENDLFEPSMLFDFGDFFKVLHTLSKLSLC 120
                F  L N+ + ++       + +  + EP  L + G+   VL  L++L   
Sbjct: 54  R----FDKLENLNLALEFAEKKLGVPK--VLEPEDLVEDGNEKLVLTLLAQLFRR 102

The CH domain is found in both cytoskeletal proteins and signal transduction proteins. The CH domain is involved in actin binding in some members of the family. However in calponins there is evidence that the CH domain is not involved in its actin binding activity. Most member proteins have from two to four copies of the CH domain, however some proteins such as calponin have only a single copy. Length = 104
>gnl|CDD|214479 smart00033, CH, Calponin homology domain Back     alignment and domain information
>gnl|CDD|221350 pfam11971, CAMSAP_CH, CAMSAP CH domain Back     alignment and domain information
>gnl|CDD|237981 cd00014, CH, Calponin homology domain; actin-binding domain which may be present as a single copy or in tandem repeats (which increases binding affinity) Back     alignment and domain information
>gnl|CDD|227526 COG5199, SCP1, Calponin [Cytoskeleton] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 130
KOG2046|consensus193 99.97
KOG2996|consensus 865 99.97
COG5199178 SCP1 Calponin [Cytoskeleton] 99.95
cd00014107 CH Calponin homology domain; actin-binding domain 99.88
smart00033103 CH Calponin homology domain. Actin binding domains 99.84
PF00307108 CH: Calponin homology (CH) domain; InterPro: IPR00 99.8
KOG2128|consensus 1401 99.78
COG5261 1054 IQG1 Protein involved in regulation of cellular mo 99.77
KOG0532|consensus722 99.73
KOG0046|consensus 627 99.47
PF1197185 CAMSAP_CH: CAMSAP CH domain; InterPro: IPR022613 T 99.29
PF0639589 CDC24: CDC24 Calponin; InterPro: IPR010481 This is 98.98
KOG0046|consensus 627 98.85
COG5069 612 SAC6 Ca2+-binding actin-bundling protein fimbrin/p 97.54
KOG0517|consensus 2473 97.38
KOG3631|consensus 365 97.18
COG5069 612 SAC6 Ca2+-binding actin-bundling protein fimbrin/p 95.48
PF06294158 DUF1042: Domain of Unknown Function (DUF1042); Int 95.12
KOG3000|consensus 295 93.16
PF05622 713 HOOK: HOOK protein; InterPro: IPR008636 This famil 84.37
>KOG2046|consensus Back     alignment and domain information 
Probab=99.97  E-value=5.1e-32  Score=199.93  Aligned_cols=111  Identities=28%  Similarity=0.525  Sum_probs=96.3

Q ss_pred             CChHHHHHHHHHHHHhcCCCCCCccccccccHhhHHHHccchHHHHHHhhhhcCCCCCcccccCCcccchhhhhhhHHHH
Q psy6172           1 MSDDLWRECAAWLTRCGVLREDHKANWSEASMSDLALTLRDGVVICNLLNNLDPACIDMREVNQKPQLAQFLCLRNIRIF   80 (130)
Q Consensus         1 ~~~~~e~e~~~WI~~~~~~~~~~~~~~~~~~~~~l~~~L~dGvvLC~L~N~l~P~~v~~~~i~~~~~~~~f~~~eNI~~F   80 (130)
                      +|+++|.++++||+.+...+.        +...+|.+.|+||++||+|+|+|.|+.++  ++| .|.+ .|+++|||++|
T Consensus        22 ~~~~~~~el~~WI~~~~~~~~--------~~~~~f~~~LKDG~iLCkl~N~l~p~~~~--~~~-~s~~-~f~qmEnIs~F   89 (193)
T KOG2046|consen   22 YDDELEKELREWIENVVLTEL--------PARGDFQDLLKDGVILCKLINKLYPGVVK--KIN-ESKM-AFVQMENISNF   89 (193)
T ss_pred             cCHHHHHHHHHHHHHhhccCC--------CcccCHHHHHcchHHHHHHHHHhCcCccc--ccc-cccc-cHHHHHHHHHH
Confidence            578999999999999733332        23469999999999999999999997774  555 4555 79999999999


Q ss_pred             HHHHHhhcCCCccCCCCccccccccChHHHHHHHHHHhCchhhh
Q psy6172          81 IQICRNYFDIAENDLFEPSMLFDFGDFFKVLHTLSKLSLCPKVQ  124 (130)
Q Consensus        81 l~~c~~~~Gl~~~~lF~~~DL~e~~n~~~V~~~L~~L~~~~~~~  124 (130)
                      +++|+. +|+++.++|+++||||++|+.+|+.||++|++.+...
T Consensus        90 i~a~~~-ygv~~~d~FqtvDLfE~kd~~~V~vtL~aLa~~a~~~  132 (193)
T KOG2046|consen   90 IKAAKK-YGVPEVDLFQTVDLFEGKDMAQVQVTLLALARKAQKK  132 (193)
T ss_pred             HHHHHh-cCCChhhcccccccccCCCHHHHHHHHHHHHHHHhhc
Confidence            999995 9999999999999999999999999999999987543

>KOG2996|consensus Back     alignment and domain information
>COG5199 SCP1 Calponin [Cytoskeleton] Back     alignment and domain information
>cd00014 CH Calponin homology domain; actin-binding domain which may be present as a single copy or in tandem repeats (which increases binding affinity) Back     alignment and domain information
>smart00033 CH Calponin homology domain Back     alignment and domain information
>PF00307 CH: Calponin homology (CH) domain; InterPro: IPR001715 The calponin homology domain (also known as CH-domain) is a superfamily of actin-binding domains found in both cytoskeletal proteins and signal transduction proteins [] Back     alignment and domain information
>KOG2128|consensus Back     alignment and domain information
>COG5261 IQG1 Protein involved in regulation of cellular morphogenesis/cytokinesis [Cell division and chromosome partitioning / Signal transduction mechanisms] Back     alignment and domain information
>KOG0532|consensus Back     alignment and domain information
>KOG0046|consensus Back     alignment and domain information
>PF11971 CAMSAP_CH: CAMSAP CH domain; InterPro: IPR022613 This domain is the N-terminal CH domain from calmodulin-regulated spectrin-associated proteins - CAMSAP proteins Back     alignment and domain information
>PF06395 CDC24: CDC24 Calponin; InterPro: IPR010481 This is a calponin homology domain Back     alignment and domain information
>KOG0046|consensus Back     alignment and domain information
>COG5069 SAC6 Ca2+-binding actin-bundling protein fimbrin/plastin (EF-Hand superfamily) [Cytoskeleton] Back     alignment and domain information
>KOG0517|consensus Back     alignment and domain information
>KOG3631|consensus Back     alignment and domain information
>COG5069 SAC6 Ca2+-binding actin-bundling protein fimbrin/plastin (EF-Hand superfamily) [Cytoskeleton] Back     alignment and domain information
>PF06294 DUF1042: Domain of Unknown Function (DUF1042); InterPro: IPR010441 This is a family of proteins of unknown function Back     alignment and domain information
>KOG3000|consensus Back     alignment and domain information
>PF05622 HOOK: HOOK protein; InterPro: IPR008636 This family consists of several HOOK1, 2 and 3 proteins from different eukaryotic organisms Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query130
2d86_A143 Solution Structure Of The Ch Domain From Human Vav- 7e-30
3ky9_A 587 Autoinhibited Vav1 Length = 587 1e-26
2l3g_A126 Solution Nmr Structure Of Ch Domain Of Rho Guanine 3e-06
1wyp_A136 Solution Structure Of The Ch Domain Of Human Calpon 2e-05
1wyr_A121 Solution Structure Of The Ch Domain Of Human Rho Gu 5e-05
1h67_A108 Nmr Structure Of The Ch Domain Of Calponin Length = 1e-04
1wyn_A146 Solution Structure Of The Ch Domain Of Human Calpon 5e-04
>pdb|2D86|A Chain A, Solution Structure Of The Ch Domain From Human Vav-3 Protein Length = 143 Back     alignment and structure 
Iteration: 1

 Score =  125 bits (314), Expect = 7e-30,   Method: Compositional matrix adjust.
 Identities = 58/116 (50%), Positives = 80/116 (68%)
Query: 6   WRECAAWLTRCGVLREDHKANWSEASMSDLALTLRDGVVICNLLNNLDPACIDMREVNQK 65
           W++CA WL  C VL  +H+  W  A + DLA TLRDGV++C LLNNL    I+++E+N +
Sbjct: 11  WKQCAQWLIHCKVLPTNHRVTWDSAQVFDLAQTLRDGVLLCQLLNNLRAHSINLKEINLR 70
Query: 66  PQLAQFLCLRNIRIFIQICRNYFDIAENDLFEPSMLFDFGDFFKVLHTLSKLSLCP 121
           PQ++QFLCL+NIR F+  C   F + +++LFE   LFD  DF KV+ TLS+LS  P
Sbjct: 71  PQMSQFLCLKNIRTFLTACCETFGMRKSELFEAFDLFDVRDFGKVIETLSRLSRTP 126
>pdb|3KY9|A Chain A, Autoinhibited Vav1 Length = 587 Back     alignment and structure
>pdb|2L3G|A Chain A, Solution Nmr Structure Of Ch Domain Of Rho Guanine Nucleotide Exchange Factor 7 From Homo Sapiens, Northeast Structural Genomics Consortium Target Hr4495e Length = 126 Back     alignment and structure
>pdb|1WYP|A Chain A, Solution Structure Of The Ch Domain Of Human Calponin 1 Length = 136 Back     alignment and structure
>pdb|1WYR|A Chain A, Solution Structure Of The Ch Domain Of Human Rho Guanine Nucleotide Exchange Factor 6 Length = 121 Back     alignment and structure
>pdb|1H67|A Chain A, Nmr Structure Of The Ch Domain Of Calponin Length = 108 Back     alignment and structure
>pdb|1WYN|A Chain A, Solution Structure Of The Ch Domain Of Human Calponin-2 Length = 146 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query130
3ky9_A 587 Proto-oncogene VAV; calponin homology domain, DBL 4e-40
1wyr_A121 RHO guanine nucleotide exchange factor 6; CH domai 7e-27
2l3g_A126 RHO guanine nucleotide exchange factor 7; structur 4e-26
1ujo_A144 Transgelin; CH domain, actin binding, structural g 3e-25
1wym_A155 Transgelin-2; CH domain, F-actin binding, all heli 5e-21
1p5s_A203 RAS GTPase-activating-like protein RNG2; alpha-hel 1e-18
1p2x_A159 RNG2 protein, RAS GTPase-activating-like protein; 6e-18
2rr8_A190 Iqgap1 protein; F-actin binding protein, protein b 8e-18
1h67_A108 Calponin alpha; cytoskeleton, calponin homology do 8e-18
3i6x_A193 P195, RAS GTPase-activating-like protein iqgap1; a 9e-18
1wyn_A146 Calponin-2; CH domain, F-actin binding, all alpha 3e-17
1wyp_A136 Calponin 1; CH domain, F-actin binding, all-alpha, 2e-16
1pxy_A 506 Fimbrin-like protein; calponin homology, F-actin-b 4e-05
1pxy_A 506 Fimbrin-like protein; calponin homology, F-actin-b 1e-04
1aoa_A 275 T-fimbrin; actin-binding protein, calcium-binding, 4e-04
>3ky9_A Proto-oncogene VAV; calponin homology domain, DBL homology domain, pleckst homology domain, C1 domain, guanine-nucleotide releasing FA metal-binding; 2.73A {Homo sapiens} PDB: 2d86_A Length = 587 Back     alignment and structure
 Score =  139 bits (352), Expect = 4e-40
 Identities = 61/123 (49%), Positives = 82/123 (66%)

Query: 4   DLWRECAAWLTRCGVLREDHKANWSEASMSDLALTLRDGVVICNLLNNLDPACIDMREVN 63
           +LWR+C  WL +C VL   H+  W  A + +LA  LRDGV++C LLNNL P  I++REVN
Sbjct: 5   ELWRQCTHWLIQCRVLPPSHRVTWEGAQVCELAQALRDGVLLCQLLNNLLPHAINLREVN 64

Query: 64  QKPQLAQFLCLRNIRIFIQICRNYFDIAENDLFEPSMLFDFGDFFKVLHTLSKLSLCPKV 123
            +PQ++QFLCL+NIR F+  C   F +  ++LFE   LFD  DF KV++TLS LS  P  
Sbjct: 65  LRPQMSQFLCLKNIRTFLSTCCEKFGLKRSELFEAFDLFDVQDFGKVIYTLSALSWTPIA 124

Query: 124 QKQ 126
           Q +
Sbjct: 125 QNR 127
>1wyr_A RHO guanine nucleotide exchange factor 6; CH domain, all-alpha, NPPSFA, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} Length = 121 Back     alignment and structure
>2l3g_A RHO guanine nucleotide exchange factor 7; structural genomics, northeast structural genomics consortiu PSI-biology, calponin-homology domain; NMR {Homo sapiens} Length = 126 Back     alignment and structure
>1ujo_A Transgelin; CH domain, actin binding, structural genomics, riken structural genomics/proteomics initiative, RSGI, structural protein; NMR {Mus musculus} SCOP: a.40.1.1 Length = 144 Back     alignment and structure
>1wym_A Transgelin-2; CH domain, F-actin binding, all helix, structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>1p5s_A RAS GTPase-activating-like protein RNG2; alpha-helical bundle, cytokine; 2.22A {Schizosaccharomyces pombe} SCOP: a.40.1.1 Length = 203 Back     alignment and structure
>1p2x_A RNG2 protein, RAS GTPase-activating-like protein; helices, bundle, protein binding; 2.21A {Schizosaccharomyces pombe} SCOP: a.40.1.1 Length = 159 Back     alignment and structure
>2rr8_A Iqgap1 protein; F-actin binding protein, protein binding; NMR {Homo sapiens} Length = 190 Back     alignment and structure
>1h67_A Calponin alpha; cytoskeleton, calponin homology domain, actin binding,; NMR {Gallus gallus} SCOP: a.40.1.1 Length = 108 Back     alignment and structure
>3i6x_A P195, RAS GTPase-activating-like protein iqgap1; all helical, calmodulin-binding, cell membrane, membrane, phosphoprotein, protein binding; 2.50A {Homo sapiens} Length = 193 Back     alignment and structure
>1wyn_A Calponin-2; CH domain, F-actin binding, all alpha helix, structural genomics, NPPSFA, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} Length = 146 Back     alignment and structure
>1wyp_A Calponin 1; CH domain, F-actin binding, all-alpha, structural genomics, NPPSFA, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} Length = 136 Back     alignment and structure
>1pxy_A Fimbrin-like protein; calponin homology, F-actin-binding domain (ABD), F-actin- crosslinking, structural genomics; 2.40A {Arabidopsis thaliana} SCOP: a.40.1.1 PDB: 3byh_B Length = 506 Back     alignment and structure
>1pxy_A Fimbrin-like protein; calponin homology, F-actin-binding domain (ABD), F-actin- crosslinking, structural genomics; 2.40A {Arabidopsis thaliana} SCOP: a.40.1.1 PDB: 3byh_B Length = 506 Back     alignment and structure
>1aoa_A T-fimbrin; actin-binding protein, calcium-binding, phosphorylation; 2.40A {Homo sapiens} SCOP: a.40.1.1 a.40.1.1 Length = 275 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query130
1h67_A108 Calponin alpha; cytoskeleton, calponin homology do 100.0
1ujo_A144 Transgelin; CH domain, actin binding, structural g 100.0
1wym_A155 Transgelin-2; CH domain, F-actin binding, all heli 100.0
1wyp_A136 Calponin 1; CH domain, F-actin binding, all-alpha, 100.0
1wyr_A121 RHO guanine nucleotide exchange factor 6; CH domai 100.0
1wyn_A146 Calponin-2; CH domain, F-actin binding, all alpha 100.0
2l3g_A126 RHO guanine nucleotide exchange factor 7; structur 100.0
3ky9_A 587 Proto-oncogene VAV; calponin homology domain, DBL 100.0
1p2x_A159 RNG2 protein, RAS GTPase-activating-like protein; 100.0
2rr8_A190 Iqgap1 protein; F-actin binding protein, protein b 100.0
3i6x_A193 P195, RAS GTPase-activating-like protein iqgap1; a 100.0
1p5s_A203 RAS GTPase-activating-like protein RNG2; alpha-hel 100.0
2yrn_A129 Neuron navigator 2 isoform 4; calponin homolgy dom 99.83
1pxy_A 506 Fimbrin-like protein; calponin homology, F-actin-b 99.76
1aoa_A 275 T-fimbrin; actin-binding protein, calcium-binding, 99.74
1rt8_A 513 Fimbrin; filamentous actin binding domain (ABD), c 99.67
2qjz_A123 Microtubule-associated protein RP/EB family member 99.57
1wku_A 254 Alpha-actinin 3; calponin homology domain, actin b 99.57
2wa7_A 245 Filamin-B; disease mutation, skeletal dysplasia, s 99.56
1wyo_A159 Protein EB3, microtubule-associated protein RP/EB 99.56
1rt8_A 513 Fimbrin; filamentous actin binding domain (ABD), c 99.5
1sh5_A 245 Plectin 1, PLTN, PCN; actin-binding domain, calpon 99.46
1dxx_A 246 Dystrophin; structural protein, muscular dystrophy 99.45
2vzc_A131 Alpha-parvin; membrane, cytoplasm, cytoskeleton, c 99.4
3f7p_A 296 Plectin-1; plakin, hemidesmosome, cell adhesion, e 99.39
3hoc_A 272 Filamin-A; calponin homology domain, actin binding 99.32
1pxy_A 506 Fimbrin-like protein; calponin homology, F-actin-b 99.29
1sjj_A 863 Actinin; 3-helix bundle, calponin homology domain, 99.19
4b7l_A 347 Filamin-B; structural protein, FR 1 filamin hinge 99.09
1wjo_A124 T-plastin; CH domain, actin binding, structural ge 98.9
1wyl_A116 NEDD9 interacting protein with calponin homology a 98.58
2d89_A119 EHBP1 protein; all alpha, calponin homology domain 98.55
2d87_A128 Smoothelin splice isoform L2; all alpha, calponin 98.55
1bkr_A109 Spectrin beta chain; filamentous actin-binding dom 98.52
1wyq_A127 Spectrin beta chain, brain 2; NPPSFA, structural g 98.45
1bhd_A118 Utrophin; calponin homology, actin binding, struct 98.42
2d88_A121 Protein mical-3; all alpha, calponin homology doma 98.38
1wku_A254 Alpha-actinin 3; calponin homology domain, actin b 98.32
2r8u_A 268 Microtubule-associated protein RP/EB family member 98.21
1sh5_A245 Plectin 1, PLTN, PCN; actin-binding domain, calpon 98.15
2wa7_A245 Filamin-B; disease mutation, skeletal dysplasia, s 98.04
4abo_I145 MAL3, microtubule integrity protein MAL3; structur 98.02
1dxx_A246 Dystrophin; structural protein, muscular dystrophy 98.0
3f7p_A296 Plectin-1; plakin, hemidesmosome, cell adhesion, e 97.88
3hoc_A272 Filamin-A; calponin homology domain, actin binding 97.87
4b7l_A347 Filamin-B; structural protein, FR 1 filamin hinge 97.83
1aoa_A275 T-fimbrin; actin-binding protein, calcium-binding, 97.76
2qjx_A127 Protein BIM1; calponin homology domain, protein bi 97.75
1sjj_A 863 Actinin; 3-helix bundle, calponin homology domain, 97.63
2ee7_A127 Sperm flagellar protein 1; all alpha protein, CH d 97.15
1wix_A164 HOOK homolog 1, RSGI RUH-026; structural genomics, 95.01
>1h67_A Calponin alpha; cytoskeleton, calponin homology domain, actin binding,; NMR {Gallus gallus} SCOP: a.40.1.1 Back     alignment and structure
Probab=100.00  E-value=1.6e-37  Score=211.69  Aligned_cols=106  Identities=26%  Similarity=0.478  Sum_probs=96.0

Q ss_pred             hHHHHHHHHHHHHhcCCCCCCccccccccHhhHHHHccchHHHHHHhhhhcCCCCCcccccCCcccchhhhhhhHHHHHH
Q psy6172           3 DDLWRECAAWLTRCGVLREDHKANWSEASMSDLALTLRDGVVICNLLNNLDPACIDMREVNQKPQLAQFLCLRNIRIFIQ   82 (130)
Q Consensus         3 ~~~e~e~~~WI~~~~~~~~~~~~~~~~~~~~~l~~~L~dGvvLC~L~N~l~P~~v~~~~i~~~~~~~~f~~~eNI~~Fl~   82 (130)
                      ++.|+|+++||+++++.+.+          ++|+++||||++||+|+|++.||+|+  +|+.++  .+|+++|||+.||+
T Consensus         2 ~~~e~e~~~WIe~~l~~~~~----------~~l~~~L~dGvvLCkL~N~l~P~~v~--ki~~~~--~~f~~~eNI~~Fl~   67 (108)
T 1h67_A            2 PQTERQLRVWIEGATGRRIG----------DNFMDGLKDGVILCELINKLQPGSVQ--KVNDPV--QNWHKLENIGNFLR   67 (108)
T ss_dssp             CCSSHHHHHHHHHHHSCCCC----------SCHHHHHHHCSHHHHHHHHHSTTSST--TCCCTT--SSHHHHHHHHHHHH
T ss_pred             hHHHHHHHHHHHHHhCCCCc----------HHHHHHHccHHHHHHHHHHhCCCCcc--cccccc--cchHHHHHHHHHHH
Confidence            46789999999999987642          48999999999999999999999997  788553  37999999999999


Q ss_pred             HHHhhcCCCccCCCCccccccccChHHHHHHHHHHhCchhh
Q psy6172          83 ICRNYFDIAENDLFEPSMLFDFGDFFKVLHTLSKLSLCPKV  123 (130)
Q Consensus        83 ~c~~~~Gl~~~~lF~~~DL~e~~n~~~V~~~L~~L~~~~~~  123 (130)
                      +|++ +|+|+.++|++.||||++|+.+|+.||++|++.+..
T Consensus        68 a~~~-~Gv~~~~lF~~~DL~e~kn~~~V~~~l~aL~~~a~~  107 (108)
T 1h67_A           68 AIKH-YGVKPHDIFEANDLFENTNHTQVQSTLIALASQAKT  107 (108)
T ss_dssp             HHHH-HTSCGGGSCCHHHHHHTCCSHHHHHHHHHHHHHHHH
T ss_pred             HHHH-cCCCcccccChhHHHhCCChHHHHHHHHHHHHHHcc
Confidence            9995 999999999999999999999999999999998753
>1ujo_A Transgelin; CH domain, actin binding, structural genomics, riken structural genomics/proteomics initiative, RSGI, structural protein; NMR {Mus musculus} SCOP: a.40.1.1 Back     alignment and structure
>1wym_A Transgelin-2; CH domain, F-actin binding, all helix, structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wyp_A Calponin 1; CH domain, F-actin binding, all-alpha, structural genomics, NPPSFA, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} Back     alignment and structure
>1wyr_A RHO guanine nucleotide exchange factor 6; CH domain, all-alpha, NPPSFA, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} Back     alignment and structure
>1wyn_A Calponin-2; CH domain, F-actin binding, all alpha helix, structural genomics, NPPSFA, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} Back     alignment and structure
>2l3g_A RHO guanine nucleotide exchange factor 7; structural genomics, northeast structural genomics consortiu PSI-biology, calponin-homology domain; NMR {Homo sapiens} Back     alignment and structure
>3ky9_A Proto-oncogene VAV; calponin homology domain, DBL homology domain, pleckst homology domain, C1 domain, guanine-nucleotide releasing FA metal-binding; 2.73A {Homo sapiens} PDB: 2d86_A Back     alignment and structure
>1p2x_A RNG2 protein, RAS GTPase-activating-like protein; helices, bundle, protein binding; 2.21A {Schizosaccharomyces pombe} SCOP: a.40.1.1 Back     alignment and structure
>2rr8_A Iqgap1 protein; F-actin binding protein, protein binding; NMR {Homo sapiens} Back     alignment and structure
>3i6x_A P195, RAS GTPase-activating-like protein iqgap1; all helical, calmodulin-binding, cell membrane, membrane, phosphoprotein, protein binding; 2.50A {Homo sapiens} Back     alignment and structure
>1p5s_A RAS GTPase-activating-like protein RNG2; alpha-helical bundle, cytokine; 2.22A {Schizosaccharomyces pombe} SCOP: a.40.1.1 Back     alignment and structure
>2yrn_A Neuron navigator 2 isoform 4; calponin homolgy domain, helicase, all alpha, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1pxy_A Fimbrin-like protein; calponin homology, F-actin-binding domain (ABD), F-actin- crosslinking, structural genomics; 2.40A {Arabidopsis thaliana} SCOP: a.40.1.1 PDB: 3byh_B Back     alignment and structure
>1aoa_A T-fimbrin; actin-binding protein, calcium-binding, phosphorylation; 2.40A {Homo sapiens} SCOP: a.40.1.1 a.40.1.1 Back     alignment and structure
>1rt8_A Fimbrin; filamentous actin binding domain (ABD), calponin homology, actin-crosslinking, structural protein; 2.00A {Schizosaccharomyces pombe} SCOP: a.40.1.1 Back     alignment and structure
>2qjz_A Microtubule-associated protein RP/EB family member 1; calponin homology domain, microtubule plus END, +TIP, protein binding; 1.25A {Homo sapiens} SCOP: a.40.1.1 PDB: 1pa7_A 1ueg_A 3co1_A 1v5k_A Back     alignment and structure
>1wku_A Alpha-actinin 3; calponin homology domain, actin binding domain, contractIle protein; 1.60A {Homo sapiens} PDB: 1tjt_A 2r0o_A 2eyi_A 2eyn_A 3lue_K Back     alignment and structure
>2wa7_A Filamin-B; disease mutation, skeletal dysplasia, structural protein, actin-crosslinking, myogenesis, cytoskeleton; 1.85A {Homo sapiens} PDB: 2wa5_A 2wa6_A 3fer_A Back     alignment and structure
>1wyo_A Protein EB3, microtubule-associated protein RP/EB family member 3; CH domain, microtubule-binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1rt8_A Fimbrin; filamentous actin binding domain (ABD), calponin homology, actin-crosslinking, structural protein; 2.00A {Schizosaccharomyces pombe} SCOP: a.40.1.1 Back     alignment and structure
>1sh5_A Plectin 1, PLTN, PCN; actin-binding domain, calponin-homology domain, structural protein; 2.00A {Mus musculus} SCOP: a.40.1.1 a.40.1.1 PDB: 1sh6_A 1mb8_A Back     alignment and structure
>1dxx_A Dystrophin; structural protein, muscular dystrophy, calponin homology domain, actin-binding, utrophin; 2.6A {Homo sapiens} SCOP: a.40.1.1 a.40.1.1 PDB: 1qag_A Back     alignment and structure
>2vzc_A Alpha-parvin; membrane, cytoplasm, cytoskeleton, cell junction, alternative splicing, calponin homology domain, actin-binding, cell membrane; 1.05A {Homo sapiens} PDB: 2vzd_A* 2vzg_B* 2vzi_B* 2k2r_A 3kmu_B 3kmw_B* 3rep_B* Back     alignment and structure
>3f7p_A Plectin-1; plakin, hemidesmosome, cell adhesion, epidermolysis bullosa, actin-binding, alternative splicing, coiled coil, cytoplasm; 2.75A {Homo sapiens} Back     alignment and structure
>3hoc_A Filamin-A; calponin homology domain, actin binding domain, acetylation, actin-binding, alternative splicing, cytoplasm, cytoskeleton; 2.30A {Homo sapiens} PDB: 3hop_A 3hor_A Back     alignment and structure
>1pxy_A Fimbrin-like protein; calponin homology, F-actin-binding domain (ABD), F-actin- crosslinking, structural genomics; 2.40A {Arabidopsis thaliana} SCOP: a.40.1.1 PDB: 3byh_B Back     alignment and structure
>1sjj_A Actinin; 3-helix bundle, calponin homology domain, calmodulin-like domain, actin binding protein, contractIle protein; 20.00A {Gallus gallus} SCOP: i.15.1.1 Back     alignment and structure
>4b7l_A Filamin-B; structural protein, FR 1 filamin hinge ABD-1; 2.05A {Homo sapiens} PDB: 2wfn_A Back     alignment and structure
>1wjo_A T-plastin; CH domain, actin binding, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: a.40.1.1 PDB: 2d85_A Back     alignment and structure
>1wyl_A NEDD9 interacting protein with calponin homology and LIM domains; CH domain, mical, structural genomics; NMR {Homo sapiens} PDB: 2dk9_A Back     alignment and structure
>2d89_A EHBP1 protein; all alpha, calponin homology domain, actin binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2d87_A Smoothelin splice isoform L2; all alpha, calponin homology domain, actin binding, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2jv9_A 2k3s_A Back     alignment and structure
>1bkr_A Spectrin beta chain; filamentous actin-binding domain, cytoskeleton; 1.10A {Homo sapiens} SCOP: a.40.1.1 PDB: 1aa2_A Back     alignment and structure
>1wyq_A Spectrin beta chain, brain 2; NPPSFA, structural genomics, riken structural genomics/proteomics initiative, RSGI, structural protein; NMR {Homo sapiens} Back     alignment and structure
>1bhd_A Utrophin; calponin homology, actin binding, structural protein; 2.00A {Homo sapiens} SCOP: a.40.1.1 Back     alignment and structure
>2d88_A Protein mical-3; all alpha, calponin homology domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2e9k_A Back     alignment and structure
>1wku_A Alpha-actinin 3; calponin homology domain, actin binding domain, contractIle protein; 1.60A {Homo sapiens} PDB: 1tjt_A 2r0o_A 2eyi_A 2eyn_A 3lue_K Back     alignment and structure
>2r8u_A Microtubule-associated protein RP/EB family member 1; cytoskeleton, acetylation, cell cycle, cell division, cytoplasm, mitosis, phosphorylation; 1.35A {Homo sapiens} SCOP: a.40.1.1 PDB: 1vka_A 1txq_B 1wu9_A 2hkq_A 2hl5_A 3tq7_A 3gjo_A 1yib_A 1yig_A Back     alignment and structure
>1sh5_A Plectin 1, PLTN, PCN; actin-binding domain, calponin-homology domain, structural protein; 2.00A {Mus musculus} SCOP: a.40.1.1 a.40.1.1 PDB: 1sh6_A 1mb8_A Back     alignment and structure
>2wa7_A Filamin-B; disease mutation, skeletal dysplasia, structural protein, actin-crosslinking, myogenesis, cytoskeleton; 1.85A {Homo sapiens} PDB: 2wa5_A 2wa6_A 3fer_A Back     alignment and structure
>4abo_I MAL3, microtubule integrity protein MAL3; structural protein, cytoskeleton, GTPase, END binding; HET: GTP GSP; 8.60A {Schizosaccharomyces pombe} Back     alignment and structure
>1dxx_A Dystrophin; structural protein, muscular dystrophy, calponin homology domain, actin-binding, utrophin; 2.6A {Homo sapiens} SCOP: a.40.1.1 a.40.1.1 PDB: 1qag_A Back     alignment and structure
>3f7p_A Plectin-1; plakin, hemidesmosome, cell adhesion, epidermolysis bullosa, actin-binding, alternative splicing, coiled coil, cytoplasm; 2.75A {Homo sapiens} Back     alignment and structure
>3hoc_A Filamin-A; calponin homology domain, actin binding domain, acetylation, actin-binding, alternative splicing, cytoplasm, cytoskeleton; 2.30A {Homo sapiens} PDB: 3hop_A 3hor_A Back     alignment and structure
>4b7l_A Filamin-B; structural protein, FR 1 filamin hinge ABD-1; 2.05A {Homo sapiens} PDB: 2wfn_A Back     alignment and structure
>1aoa_A T-fimbrin; actin-binding protein, calcium-binding, phosphorylation; 2.40A {Homo sapiens} SCOP: a.40.1.1 a.40.1.1 Back     alignment and structure
>2qjx_A Protein BIM1; calponin homology domain, protein binding; 1.90A {Saccharomyces cerevisiae} Back     alignment and structure
>1sjj_A Actinin; 3-helix bundle, calponin homology domain, calmodulin-like domain, actin binding protein, contractIle protein; 20.00A {Gallus gallus} SCOP: i.15.1.1 Back     alignment and structure
>2ee7_A Sperm flagellar protein 1; all alpha protein, CH domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wix_A HOOK homolog 1, RSGI RUH-026; structural genomics, mouse cDNA, riken structural genomics/proteomics initiative, unknown function; NMR {Mus musculus} SCOP: a.40.3.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 130
d1ujoa_144 a.40.1.1 (A:) Transgelin {Mouse (Mus musculus) [Ta 2e-21
d1h67a_108 a.40.1.1 (A:) Calponin {Chicken (Gallus gallus) [T 6e-13
d1p2xa_159 a.40.1.1 (A:) Ras GTPase-activating-like protein r 3e-10
d1pxya_ 500 a.40.1.1 (A:) Fimbrin (Plastin), actin-crosslinkin 2e-05
d1rt8a_ 505 a.40.1.1 (A:) Fimbrin (Plastin), actin-crosslinkin 7e-04
>d1ujoa_ a.40.1.1 (A:) Transgelin {Mouse (Mus musculus) [TaxId: 10090]} Length = 144 Back     information, alignment and structure

class: All alpha proteins
fold: CH domain-like
superfamily: Calponin-homology domain, CH-domain
family: Calponin-homology domain, CH-domain
domain: Transgelin
species: Mouse (Mus musculus) [TaxId: 10090]

 Score = 81.2 bits (200), Expect = 2e-21
 Identities = 25/130 (19%), Positives = 51/130 (39%), Gaps = 7/130 (5%)

Query: 2   SDDLWRECAAWLTR-CGVLREDHKANWSEASMSDLALTLRDGVVICNLLNNLDPACIDMR 60
            ++L      W+   CG           +       + L++GV++  L+N+L P      
Sbjct: 7   GEELEERLVEWIVVQCG-----PDVGRPDRGRLGFQVWLKNGVILSKLVNSLYPEGSKPV 61

Query: 61  EVNQKPQLAQFLCLRNIRIFIQICRNYFDIAENDLFEPSMLFDFGDFFKVLHTLSKLSLC 120
           +V + P    F  +  +  F++   +Y  + + D+F+   L++  D   V  TL  L   
Sbjct: 62  KVPENPPSMVFKQMEQVAQFLKAAEDY-GVIKTDMFQTVDLYEGKDMAAVQRTLMALGSL 120

Query: 121 PKVQKQKNIK 130
              +   N +
Sbjct: 121 AVTKNDGNYR 130
>d1h67a_ a.40.1.1 (A:) Calponin {Chicken (Gallus gallus) [TaxId: 9031]} Length = 108 Back     information, alignment and structure
>d1p2xa_ a.40.1.1 (A:) Ras GTPase-activating-like protein rng2 {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 159 Back     information, alignment and structure
>d1pxya_ a.40.1.1 (A:) Fimbrin (Plastin), actin-crosslinking domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 500 Back     information, alignment and structure
>d1rt8a_ a.40.1.1 (A:) Fimbrin (Plastin), actin-crosslinking domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 505 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query130
d1ujoa_144 Transgelin {Mouse (Mus musculus) [TaxId: 10090]} 100.0
d1h67a_108 Calponin {Chicken (Gallus gallus) [TaxId: 9031]} 100.0
d1p2xa_159 Ras GTPase-activating-like protein rng2 {Fission y 99.97
d1aoaa1131 Fimbrin (Plastin), actin-crosslinking domain {Huma 99.67
d1sh5a1120 Actin binding domain of plectin {Human (Homo sapie 99.36
d1wjoa_124 Fimbrin (Plastin), actin-crosslinking domain {Huma 99.31
d1pxya_ 500 Fimbrin (Plastin), actin-crosslinking domain {Thal 99.28
d1dxxa1111 Dystrophin {Human (Homo sapiens) [TaxId: 9606]} 99.17
d1rt8a_ 505 Fimbrin (Plastin), actin-crosslinking domain {Fiss 99.08
d1rt8a_ 505 Fimbrin (Plastin), actin-crosslinking domain {Fiss 99.06
d1aoaa2116 Fimbrin (Plastin), actin-crosslinking domain {Huma 99.03
d1pxya_ 500 Fimbrin (Plastin), actin-crosslinking domain {Thal 99.0
d2qjza1120 Microtubule-associated protein eb1, N-terminal mic 98.79
d1bhda_108 Utrophin {Human (Homo sapiens) [TaxId: 9606]} 98.67
d1sh5a2110 Actin binding domain of plectin {Human (Homo sapie 98.63
d1dxxa2127 Dystrophin {Human (Homo sapiens) [TaxId: 9606]} 98.61
d1bkra_108 beta-spectrin {Human (Homo sapiens) [TaxId: 9606]} 98.54
d1wixa_164 Hook homolog 1, Hook1 {Mouse (Mus musculus) [TaxId 94.03
>d1ujoa_ a.40.1.1 (A:) Transgelin {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
class: All alpha proteins
fold: CH domain-like
superfamily: Calponin-homology domain, CH-domain
family: Calponin-homology domain, CH-domain
domain: Transgelin
species: Mouse (Mus musculus) [TaxId: 10090]

Probab=100.00  E-value=7.3e-38  Score=221.43  Aligned_cols=120  Identities=18%  Similarity=0.322  Sum_probs=103.4

Q ss_pred             ChHHHHHHHHHHHHhcCCCCCCccccccccHhhHHHHccchHHHHHHhhhhcCCCCCcccccCCcccchhhhhhhHHHHH
Q psy6172           2 SDDLWRECAAWLTRCGVLREDHKANWSEASMSDLALTLRDGVVICNLLNNLDPACIDMREVNQKPQLAQFLCLRNIRIFI   81 (130)
Q Consensus         2 ~~~~e~e~~~WI~~~~~~~~~~~~~~~~~~~~~l~~~L~dGvvLC~L~N~l~P~~v~~~~i~~~~~~~~f~~~eNI~~Fl   81 (130)
                      +.++|+++++||+++++++.+.    +++..++|.++|+||++||+|+|++.|++|+..++...+...+|+++|||+.||
T Consensus         7 ~~e~e~~~~~WI~~~~g~~~~~----~~~~~~~f~~~L~dGvvLCkL~N~l~P~~i~~~~~~~~~~~~~f~~~eNI~~FL   82 (144)
T d1ujoa_           7 GEELEERLVEWIVVQCGPDVGR----PDRGRLGFQVWLKNGVILSKLVNSLYPEGSKPVKVPENPPSMVFKQMEQVAQFL   82 (144)
T ss_dssp             CCHHHHHHHHHHHHHHCTTTCC----CCSSSSSHHHHTTSSHHHHHHHHHHSCTTTCCSCCCSSCCCSHHHHHHHHHHHH
T ss_pred             cHHHHHHHHHHHHHHhCCccCC----CCccHHHHHHHHhcChhHHHHHHHHcCCCCCCccccCCCcchhHHHHHHHHHHH
Confidence            4689999999999999887642    345667999999999999999999999999733333233334799999999999


Q ss_pred             HHHHhhcCCCccCCCCccccccccChHHHHHHHHHHhCchhhhhh
Q psy6172          82 QICRNYFDIAENDLFEPSMLFDFGDFFKVLHTLSKLSLCPKVQKQ  126 (130)
Q Consensus        82 ~~c~~~~Gl~~~~lF~~~DL~e~~n~~~V~~~L~~L~~~~~~~~~  126 (130)
                      ++|++ +||++.++|+++||||++|+.+|+.||++|++.+.+++.
T Consensus        83 ~~c~~-~Gv~~~~lF~~~DL~e~kn~~~Vi~cL~~L~r~a~~~~~  126 (144)
T d1ujoa_          83 KAAED-YGVIKTDMFQTVDLYEGKDMAAVQRTLMALGSLAVTKND  126 (144)
T ss_dssp             HHHHH-HTCCSSSCCCHHHHHTCSCHHHHHHHHHHHHHHHHHHCS
T ss_pred             HHHHH-hCCCcccccchhHHhhcCCHHHHHHHHHHHHHHHHHccC
Confidence            99995 999999999999999999999999999999999887754
>d1h67a_ a.40.1.1 (A:) Calponin {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1p2xa_ a.40.1.1 (A:) Ras GTPase-activating-like protein rng2 {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1aoaa1 a.40.1.1 (A:121-251) Fimbrin (Plastin), actin-crosslinking domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sh5a1 a.40.1.1 (A:8-127) Actin binding domain of plectin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wjoa_ a.40.1.1 (A:) Fimbrin (Plastin), actin-crosslinking domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pxya_ a.40.1.1 (A:) Fimbrin (Plastin), actin-crosslinking domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1dxxa1 a.40.1.1 (A:9-119) Dystrophin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rt8a_ a.40.1.1 (A:) Fimbrin (Plastin), actin-crosslinking domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1rt8a_ a.40.1.1 (A:) Fimbrin (Plastin), actin-crosslinking domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1aoaa2 a.40.1.1 (A:260-375) Fimbrin (Plastin), actin-crosslinking domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pxya_ a.40.1.1 (A:) Fimbrin (Plastin), actin-crosslinking domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2qjza1 a.40.1.1 (A:13-132) Microtubule-associated protein eb1, N-terminal microtubule binding domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bhda_ a.40.1.1 (A:) Utrophin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sh5a2 a.40.1.1 (A:128-237) Actin binding domain of plectin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dxxa2 a.40.1.1 (A:120-246) Dystrophin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bkra_ a.40.1.1 (A:) beta-spectrin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wixa_ a.40.3.1 (A:) Hook homolog 1, Hook1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure