Diaphorina citri psyllid: psy6184


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150------
MGKAEWTIVPSHALASIKKKLTNSNPHIVLYALLVLESCVKNCGNLIHDEVGTKAFMEQMKELVRGTQHEEVKAKILELIQAWAHAFRNSPKYRAVPTKSWMTDKGFKNPSKSSDSLGLELQIFRICHIHFSEIKGIDQIVDSSSSVALWLRHFAW
cccccccccHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHccHHHHHHHHcHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHcccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHcc
******T*VPSHALASIKKKLTNSNPHIVLYALLVLESCVKNCGNLIHDEVGTKAFMEQMKELVRGTQHEEVKAKILELIQAWAHAFRNSPKYRAVPTKSWMTDKGF*********LGLELQIFRICHIHFSEIKGIDQI*DSSSSVALWLRHFAW
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGKAEWTIVPSHALASIKKKLTNSNPHIVLYALLVLESCVKNCGNLIHDEVGTKAFMEQMKELVRGTQHEEVKAKILELIQAWAHAFRNSPKYRAVPTKSWMTDKGFKNPSKSSDSLGLELQIFRICHIHFSEIKGIDQIVDSSSSVALWLRHFAW

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Hepatocyte growth factor-regulated tyrosine kinase substrate Involved in intracellular signal transduction mediated by cytokines and growth factors. When associated with STAM, it suppresses DNA signaling upon stimulation by IL-2 and GM-CSF. Could be a direct effector of PI3-kinase in vesicular pathway via early endosomes and may regulate trafficking to early and late endosomes by recruiting clathrin. May concentrate ubiquitinated receptors within clathrin-coated regions. Involved in down-regulation of receptor tyrosine kinase via multivesicular body (MVBs) when complexed with STAM (ESCRT-0 complex). The ESCRT-0 complex binds ubiquitin and acts as sorting machinery that recognizes ubiquitinated receptors and transfers them to further sequential lysosomal sorting/trafficking processes. May contribute to the efficient recruitment of SMADs to the activin receptor complex. Involved in receptor recycling via its association with the CART complex, a multiprotein complex required for efficient transferrin receptor recycling but not for EGFR degradation.confidentQ99LI8
Hepatocyte growth factor-regulated tyrosine kinase substrate Involved in intracellular signal transduction mediated by cytokines and growth factors. When associated with STAM it suppresses DNA signaling upon stimulation by IL-2 and GM-CSF. Could be a direct effector of PI3-kinase in vesicular pathway via early endosomes and may regulate trafficking to early and late endosomes by recruiting clathrin. May concentrate ubiquitinated receptors within clathrin-coated regions. Involved in down-regulation of receptor tyrosine kinase via multivesicular body (MVBs) when complexed with STAM (ESCRT-0 complex). The ESCRT-0 complex binds ubiquitin and acts as sorting machinery that recognizes ubiquitinated receptors and transfers them to further sequential lysosomal sorting/trafficking processes. May contribute to the efficient recruitment of SMADs to the activin receptor complex. Involved in receptor recycling via its association with the CART complex, a multiprotein complex required for efficient transferrin receptor recycling but not for EGFR degradation.confidentQ0V8S0
Hepatocyte growth factor-regulated tyrosine kinase substrate Involved in intracellular signal transduction mediated by cytokines and growth factors. When associated with STAM, it suppresses DNA signaling upon stimulation by IL-2 and GM-CSF. Could be a direct effector of PI3-kinase in vesicular pathway via early endosomes and may regulate trafficking to early and late endosomes by recruiting clathrin. May concentrate ubiquitinated receptors within clathrin-coated regions. Involved in down-regulation of receptor tyrosine kinase via multivesicular body (MVBs) when complexed with STAM (ESCRT-0 complex). The ESCRT-0 complex binds ubiquitin and acts as sorting machinery that recognizes ubiquitinated receptors and transfers them to further sequential lysosomal sorting/trafficking processes. Involved in receptor recycling via its association with the CART complex, a multiprotein complex required for efficient transferrin receptor recycling but not for EGFR degradation (By similarity). May contribute to the efficient recruitment of SMADs to the activin receptor complex.confidentQ9JJ50

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0044763 [BP]single-organism cellular processprobableGO:0009987, GO:0008150, GO:0044699
GO:0005769 [CC]early endosomeprobableGO:0005737, GO:0043231, GO:0043227, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0005768, GO:0043226
GO:0016020 [CC]membraneprobableGO:0005575
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0030141 [CC]secretory granuleprobableGO:0005737, GO:0031982, GO:0016023, GO:0031410, GO:0044464, GO:0044444, GO:0005623, GO:0031988, GO:0005575, GO:0043229, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0043231
GO:0005515 [MF]protein bindingprobableGO:0003674, GO:0005488
GO:0046426 [BP]negative regulation of JAK-STAT cascadeprobableGO:0009968, GO:0046425, GO:0009966, GO:0048585, GO:0048583, GO:0050794, GO:0050789, GO:0023057, GO:0065007, GO:0010648, GO:0008150, GO:0023051, GO:0048519, GO:0010646, GO:0010627, GO:0010741, GO:0048523

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3ZYQ, chain A
Confidence level:very confident
Coverage over the Query: 6-136
View the alignment between query and template
View the model in PyMOL