Psyllid ID: psy6184

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150------
MGKAEWTIVPSHALASIKKKLTNSNPHIVLYALLVLESCVKNCGNLIHDEVGTKAFMEQMKELVRGTQHEEVKAKILELIQAWAHAFRNSPKYRAVPTKSWMTDKGFKNPSKSSDSLGLELQIFRICHIHFSEIKGIDQIVDSSSSVALWLRHFAW
cccccccccHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHcHHHHHHHHcHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHcccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHcc
cccccccccHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHccHHHHHHHccHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHccccccccccccccccccccccEEEcccccccccccccHHHHHHHHHHHHcc
mgkaewtivPSHALASIKKKLTNSNPHIVLYALLVLESCVKNcgnlihdeVGTKAFMEQMKELVRGTQHEEVKAKILELIQAWAHAFrnspkyravptkswmtdkgfknpskssdslgLELQIFRICHihfseikgidqivdSSSSVALWLRHFAW
mgkaewtivpSHALASIKKKLTNSNPHIVLYALLVLESCVKNCGNLIHDEVGTKAFMEQMKELVRGTQHEEVKAKILELIQAWAHAfrnspkyravptkswmtdkGFKNPSKSSDSLGLELQIFRICHIHFSEIKGIDQIVDSSSSVALWLRHFAW
MGKAEWTIVPSHALASIKKKLTNSNPHIVLYALLVLESCVKNCGNLIHDEVGTKAFMEQMKELVRGTQHEEVKAKILELIQAWAHAFRNSPKYRAVPTKSWMTDKGFKNPSKSSDSLGLELQIFRICHIHFSEIKGIDQIVDSSSSVALWLRHFAW
*****WTIVPSHALASIKKKLTNSNPHIVLYALLVLESCVKNCGNLIHDEVGTKAFMEQMKELVRGTQHEEVKAKILELIQAWAHAFRNSPKYRAVPTKSW***************LGLELQIFRICHIHFSEIKGIDQIVDSSSSVALWLRHFA*
******T*VPSHALASIKKKLTNSNPHIVLYALLVLESCVKNCGNLIHDEVGTKAFMEQMKELVRGTQHEEVKAKILELIQAWAHAFRNSPKYRAVPTKSWMTDKGF****************************************ALWLRHFAW
MGKAEWTIVPSHALASIKKKLTNSNPHIVLYALLVLESCVKNCGNLIHDEVGTKAFMEQMKELVRGTQHEEVKAKILELIQAWAHAFRNSPKYRAVPTKSWMTDKGFKNPSKSSDSLGLELQIFRICHIHFSEIKGIDQIVDSSSSVALWLRHFAW
********VPSHALASIKKKLTNSNPHIVLYALLVLESCVKNCGNLIHDEVGTKAFMEQMKELVRGTQHEEVKAKILELIQAWAHAFRNSPKYRAVPTKSWMTDKGFKNPSKSSDSLGLELQIFRICHIHFSEIKGIDQI*DSSSSV**WLRHFAW
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGKAEWTIVPSHALASIKKKLTNSNPHIVLYALLVLESCVKNCGNLIHDEVGTKAFMEQMKELVRGTQHEEVKAKILELIQAWAHAFRNSPKYRAVPTKSWMTDKGFKNPSKSSDSLGLELQIFRICHIHFSEIKGIDQIVDSSSSVALWLRHFAW
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query156 2.2.26 [Sep-21-2011]
Q9JJ50 776 Hepatocyte growth factor- yes N/A 0.679 0.136 0.527 3e-24
Q99LI8 775 Hepatocyte growth factor- yes N/A 0.679 0.136 0.527 3e-24
Q0V8S0 777 Hepatocyte growth factor- yes N/A 0.679 0.136 0.518 5e-24
O14964 777 Hepatocyte growth factor- yes N/A 0.679 0.136 0.518 8e-24
Q960X8 760 Hepatocyte growth factor- yes N/A 0.705 0.144 0.455 1e-21
Q2GS33 737 Vacuolar protein sorting- N/A N/A 0.512 0.108 0.440 8e-13
O60784 492 Target of Myb protein 1 O no N/A 0.679 0.215 0.408 2e-12
O88746 492 Target of Myb protein 1 O no N/A 0.679 0.215 0.391 2e-11
O12940 515 Target of Myb protein 1 O no N/A 0.544 0.165 0.440 2e-11
Q0CJV3 556 Vacuolar protein sorting- N/A N/A 0.705 0.197 0.350 2e-11
>sp|Q9JJ50|HGS_RAT Hepatocyte growth factor-regulated tyrosine kinase substrate OS=Rattus norvegicus GN=Hgs PE=1 SV=1 Back     alignment and function desciption
 Score =  110 bits (276), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 57/108 (52%), Positives = 73/108 (67%), Gaps = 2/108 (1%)

Query: 12  HALASIKKKLTNSNPHIVLYALLVLESCVKNCGNLIHDEVGTKAFMEQMKELVRGTQHEE 71
           +A+ SIKKK+ + NPH+ LYAL V+ES VKNCG  +HDEV  K  ME++KEL++      
Sbjct: 44  YAVNSIKKKVNDKNPHVALYALEVMESVVKNCGQTVHDEVANKQTMEELKELLKRQVEVN 103

Query: 72  VKAKILELIQAWAHAFRNSPKYRAVP-TKSWMTDKGFKNPS-KSSDSL 117
           V+ KIL LIQAWAHAFRN PKY+ V  T   M  +G   P  K SD++
Sbjct: 104 VRNKILYLIQAWAHAFRNEPKYKVVQDTYQIMKVEGHVFPEFKESDAM 151
Involved in intracellular signal transduction mediated by cytokines and growth factors. When associated with STAM, it suppresses DNA signaling upon stimulation by IL-2 and GM-CSF. Could be a direct effector of PI3-kinase in vesicular pathway via early endosomes and may regulate trafficking to early and late endosomes by recruiting clathrin. May concentrate ubiquitinated receptors within clathrin-coated regions. Involved in down-regulation of receptor tyrosine kinase via multivesicular body (MVBs) when complexed with STAM (ESCRT-0 complex). The ESCRT-0 complex binds ubiquitin and acts as sorting machinery that recognizes ubiquitinated receptors and transfers them to further sequential lysosomal sorting/trafficking processes. Involved in receptor recycling via its association with the CART complex, a multiprotein complex required for efficient transferrin receptor recycling but not for EGFR degradation (By similarity). May contribute to the efficient recruitment of SMADs to the activin receptor complex.
Rattus norvegicus (taxid: 10116)
>sp|Q99LI8|HGS_MOUSE Hepatocyte growth factor-regulated tyrosine kinase substrate OS=Mus musculus GN=Hgs PE=1 SV=2 Back     alignment and function description
>sp|Q0V8S0|HGS_BOVIN Hepatocyte growth factor-regulated tyrosine kinase substrate OS=Bos taurus GN=HGS PE=2 SV=1 Back     alignment and function description
>sp|O14964|HGS_HUMAN Hepatocyte growth factor-regulated tyrosine kinase substrate OS=Homo sapiens GN=HGS PE=1 SV=1 Back     alignment and function description
>sp|Q960X8|HRS_DROME Hepatocyte growth factor-regulated tyrosine kinase substrate OS=Drosophila melanogaster GN=Hrs PE=1 SV=1 Back     alignment and function description
>sp|Q2GS33|VPS27_CHAGB Vacuolar protein sorting-associated protein 27 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=VPS27 PE=3 SV=2 Back     alignment and function description
>sp|O60784|TOM1_HUMAN Target of Myb protein 1 OS=Homo sapiens GN=TOM1 PE=1 SV=2 Back     alignment and function description
>sp|O88746|TOM1_MOUSE Target of Myb protein 1 OS=Mus musculus GN=Tom1 PE=1 SV=1 Back     alignment and function description
>sp|O12940|TOM1_CHICK Target of Myb protein 1 OS=Gallus gallus GN=TOM1 PE=2 SV=2 Back     alignment and function description
>sp|Q0CJV3|VPS27_ASPTN Vacuolar protein sorting-associated protein 27 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=vps27 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query156
307201531 833 Hepatocyte growth factor-regulated tyros 0.705 0.132 0.651 1e-35
383865655 825 PREDICTED: hepatocyte growth factor-regu 0.705 0.133 0.660 9e-35
383865653 831 PREDICTED: hepatocyte growth factor-regu 0.705 0.132 0.660 9e-35
350398309 817 PREDICTED: hepatocyte growth factor-regu 0.705 0.134 0.651 2e-34
307169356 827 Hepatocyte growth factor-regulated tyros 0.705 0.133 0.633 1e-33
332029107 835 Hepatocyte growth factor-regulated tyros 0.705 0.131 0.625 4e-33
322796370 830 hypothetical protein SINV_09655 [Solenop 0.705 0.132 0.607 2e-32
328782914 822 PREDICTED: hepatocyte growth factor-regu 0.705 0.133 0.678 1e-31
380021056 827 PREDICTED: LOW QUALITY PROTEIN: hepatocy 0.705 0.133 0.678 1e-31
427778467 860 Putative membrane trafficking and cell s 0.705 0.127 0.535 8e-29
>gi|307201531|gb|EFN81294.1| Hepatocyte growth factor-regulated tyrosine kinase substrate [Harpegnathos saltator] Back     alignment and taxonomy information
 Score =  154 bits (388), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 73/112 (65%), Positives = 91/112 (81%), Gaps = 2/112 (1%)

Query: 8   IVPSHALASIKKKLTNSNPHIVLYALLVLESCVKNCGNLIHDEVGTKAFMEQMKELVRGT 67
           + P  ALA+IKKK+TN+NPH+ LYALLVLESCVKNCG LIHDE+ TK +MEQ+K+LV+ +
Sbjct: 39  VQPKVALAAIKKKITNTNPHVALYALLVLESCVKNCGTLIHDEIATKQYMEQLKDLVKTS 98

Query: 68  QHEEVKAKILELIQAWAHAFRNSPKYRAVP-TKSWMTDKGFKNPS-KSSDSL 117
           QHE V+ K LELIQAWAHAFRNSPKYRAV  T + M  +G++ P  K SD++
Sbjct: 99  QHENVRQKTLELIQAWAHAFRNSPKYRAVQDTLNIMKTEGYQFPVLKESDAM 150

Source: Harpegnathos saltator

Species: Harpegnathos saltator

Genus: Harpegnathos

Family: Formicidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|383865655|ref|XP_003708288.1| PREDICTED: hepatocyte growth factor-regulated tyrosine kinase substrate-like isoform 2 [Megachile rotundata] Back     alignment and taxonomy information
>gi|383865653|ref|XP_003708287.1| PREDICTED: hepatocyte growth factor-regulated tyrosine kinase substrate-like isoform 1 [Megachile rotundata] Back     alignment and taxonomy information
>gi|350398309|ref|XP_003485155.1| PREDICTED: hepatocyte growth factor-regulated tyrosine kinase substrate-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|307169356|gb|EFN62077.1| Hepatocyte growth factor-regulated tyrosine kinase substrate [Camponotus floridanus] Back     alignment and taxonomy information
>gi|332029107|gb|EGI69120.1| Hepatocyte growth factor-regulated tyrosine kinase substrate [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|322796370|gb|EFZ18911.1| hypothetical protein SINV_09655 [Solenopsis invicta] Back     alignment and taxonomy information
>gi|328782914|ref|XP_393989.4| PREDICTED: hepatocyte growth factor-regulated tyrosine kinase substrate [Apis mellifera] Back     alignment and taxonomy information
>gi|380021056|ref|XP_003694390.1| PREDICTED: LOW QUALITY PROTEIN: hepatocyte growth factor-regulated tyrosine kinase substrate-like [Apis florea] Back     alignment and taxonomy information
>gi|427778467|gb|JAA54685.1| Putative membrane trafficking and cell signaling protein hrs [Rhipicephalus pulchellus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query156
ZFIN|ZDB-GENE-030131-6107 773 hgs "hepatocyte growth factor- 0.679 0.137 0.555 6.9e-24
UNIPROTKB|E2QWE3 782 HGS "Uncharacterized protein" 0.679 0.135 0.527 4e-23
UNIPROTKB|E1C396 705 HGS "Uncharacterized protein" 0.679 0.150 0.509 5.3e-23
MGI|MGI:104681 775 Hgs "HGF-regulated tyrosine ki 0.679 0.136 0.527 8.2e-23
RGD|69225 776 Hgs "hepatocyte growth factor- 0.679 0.136 0.527 8.2e-23
UNIPROTKB|Q0V8S0 777 HGS "Hepatocyte growth factor- 0.679 0.136 0.518 8.3e-23
UNIPROTKB|O14964 777 HGS "Hepatocyte growth factor- 0.679 0.136 0.518 1.7e-22
WB|WBGene00004101 729 hgrs-1 [Caenorhabditis elegans 0.698 0.149 0.464 2.3e-21
FB|FBgn0031450 760 Hrs "Hepatocyte growth factor 0.705 0.144 0.455 6.8e-21
UNIPROTKB|I3L1P5263 HGS "Hepatocyte growth factor- 0.576 0.342 0.453 3.2e-17
ZFIN|ZDB-GENE-030131-6107 hgs "hepatocyte growth factor-regulated tyrosine kinase substrate" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
 Score = 284 (105.0 bits), Expect = 6.9e-24, P = 6.9e-24
 Identities = 60/108 (55%), Positives = 73/108 (67%)

Query:    12 HALASIKKKLTNSNPHIVLYALLVLESCVKNCGNLIHDEVGTKAFMEQMKELVRGTQHEE 71
             +A+ +IKKKL + NPH+ LYAL VLES VKNCG  IHDEV +K  ME++KEL +      
Sbjct:    44 YAIGAIKKKLNDKNPHVALYALEVLESVVKNCGQTIHDEVASKQTMEELKELFKKQPEPN 103

Query:    72 VKAKILELIQAWAHAFRNSPKYRAVP-TKSWMTDKGFKNPS-KSSDSL 117
             VK KIL LIQAWAHAFRN PKY+ V  T   M  +G   P  K SD++
Sbjct:   104 VKNKILYLIQAWAHAFRNEPKYKVVQDTYQIMKVEGHVFPEFKESDAM 151
GO:0046872 "metal ion binding" evidence=IEA
GO:0006886 "intracellular protein transport" evidence=IEA
GO:0016301 "kinase activity" evidence=IEA
GO:0016310 "phosphorylation" evidence=IEA
UNIPROTKB|E2QWE3 HGS "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|E1C396 HGS "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
MGI|MGI:104681 Hgs "HGF-regulated tyrosine kinase substrate" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|69225 Hgs "hepatocyte growth factor-regulated tyrosine kinase substrate" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q0V8S0 HGS "Hepatocyte growth factor-regulated tyrosine kinase substrate" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|O14964 HGS "Hepatocyte growth factor-regulated tyrosine kinase substrate" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
WB|WBGene00004101 hgrs-1 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
FB|FBgn0031450 Hrs "Hepatocyte growth factor regulated tyrosine kinase substrate" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|I3L1P5 HGS "Hepatocyte growth factor-regulated tyrosine kinase substrate" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q99LI8HGS_MOUSENo assigned EC number0.52770.67940.1367yesN/A
Q9JJ50HGS_RATNo assigned EC number0.52770.67940.1365yesN/A
Q0V8S0HGS_BOVINNo assigned EC number0.51850.67940.1364yesN/A
O14964HGS_HUMANNo assigned EC number0.51850.67940.1364yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query156
cd03569142 cd03569, VHS_Hrs_Vps27p, VHS domain family, Hrs an 6e-46
smart00288133 smart00288, VHS, Domain present in VPS-27, Hrs and 8e-28
pfam00790136 pfam00790, VHS, VHS domain 3e-27
cd03561133 cd03561, VHS, VHS domain family; The VHS domain is 2e-21
cd03568144 cd03568, VHS_STAM, VHS domain family, STAM subfami 1e-19
cd00197115 cd00197, VHS_ENTH_ANTH, VHS, ENTH and ANTH domain 3e-17
cd03565141 cd03565, VHS_Tom1, VHS domain family, Tom1 subfami 4e-16
cd03567139 cd03567, VHS_GGA, VHS domain family, GGA subfamily 1e-11
>gnl|CDD|239626 cd03569, VHS_Hrs_Vps27p, VHS domain family, Hrs and Vps27p subfamily; composed of Hrs (Hepatocyte growth factor-regulated tyrosine kinase substrate) and its yeast homolog Vps27p (vacuolar protein sorting) Back     alignment and domain information 
 Score =  146 bits (370), Expect = 6e-46
 Identities = 53/107 (49%), Positives = 78/107 (72%), Gaps = 1/107 (0%)

Query: 7   TIVPSHALASIKKKLTNSNPHIVLYALLVLESCVKNCGNLIHDEVGTKAFMEQMKELVRG 66
            + P +A+ ++KK+L + NP++ LYALL+LESCVKNCG   HDEV ++ FM+++K+L++ 
Sbjct: 36  DVQPKYAMRALKKRLLSKNPNVQLYALLLLESCVKNCGTHFHDEVASREFMDELKDLIKT 95

Query: 67  TQHEEVKAKILELIQAWAHAFRNSPKYRAVP-TKSWMTDKGFKNPSK 112
           T++EEV+ KILELIQAWA AFRN P+ + V  T   +  +G K P  
Sbjct: 96  TKNEEVRQKILELIQAWALAFRNKPQLKYVVDTYQILKAEGHKFPEL 142

The VHS domain, an essential part of Hrs/Vps27p, has a superhelical structure similar to the structure of ARM (Armadillo) repeats and is present at the N-termini of proteins. Hrs also contains a FYVE (Fab1p, YOTB, Vac1p, and EEA1) zinc finger domain C-terminal to VHS, as well as two coiled-coil domains. Hrs has been proposed to play a role in at least three vesicle trafficking events: exocytosis, endocytosis, and endosome to lysosome trafficking. Hrs is involved in promoting rapid recycling of endocytosed signaling receptors to the plasma membrane. Length = 142
>gnl|CDD|197630 smart00288, VHS, Domain present in VPS-27, Hrs and STAM Back     alignment and domain information
>gnl|CDD|216121 pfam00790, VHS, VHS domain Back     alignment and domain information
>gnl|CDD|239620 cd03561, VHS, VHS domain family; The VHS domain is present in Vps27 (Vacuolar Protein Sorting), Hrs (Hepatocyte growth factor-regulated tyrosine kinase substrate) and STAM (Signal Transducing Adaptor Molecule) Back     alignment and domain information
>gnl|CDD|239625 cd03568, VHS_STAM, VHS domain family, STAM subfamily; members include STAM (Signal Transducing Adaptor Molecule), EAST (EGFR-associated protein with SH3 and TAM domains) and Hbp (Hrs-binding protein) Back     alignment and domain information
>gnl|CDD|238118 cd00197, VHS_ENTH_ANTH, VHS, ENTH and ANTH domain superfamily; composed of proteins containing a VHS, ENTH or ANTH domain Back     alignment and domain information
>gnl|CDD|239623 cd03565, VHS_Tom1, VHS domain family, Tom1 subfamily; The VHS domain is an essential part of Tom1 (Target of myb1 - retroviral oncogene) protein Back     alignment and domain information
>gnl|CDD|239624 cd03567, VHS_GGA, VHS domain family, GGA subfamily; GGA (Golgi-localized, Gamma-ear-containing, Arf-binding) comprise a subfamily of ubiquitously expressed, monomeric, motif-binding cargo/clathrin adaptor proteins Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 156
cd03568144 VHS_STAM VHS domain family, STAM subfamily; member 100.0
cd03569142 VHS_Hrs_Vps27p VHS domain family, Hrs and Vps27p s 100.0
cd03565141 VHS_Tom1 VHS domain family, Tom1 subfamily; The VH 100.0
cd03567139 VHS_GGA VHS domain family, GGA subfamily; GGA (Gol 100.0
smart00288133 VHS Domain present in VPS-27, Hrs and STAM. Unpubl 100.0
PF00790140 VHS: VHS domain; InterPro: IPR002014 The VHS domai 100.0
KOG1087|consensus 470 99.97
KOG2199|consensus 462 99.97
cd03561133 VHS VHS domain family; The VHS domain is present i 99.97
KOG1818|consensus 634 99.9
KOG1086|consensus 594 99.88
cd00197115 VHS_ENTH_ANTH VHS, ENTH and ANTH domain superfamil 99.82
cd03562114 CID CID (CTD-Interacting Domain) domain family; CI 97.89
PF01417125 ENTH: ENTH domain; InterPro: IPR001026 The ENTH (E 97.21
cd03572122 ENTH_epsin_related ENTH domain, Epsin Related fami 97.15
smart00582121 RPR domain present in proteins, which are involved 96.89
cd03571123 ENTH_epsin ENTH domain, Epsin family; The epsin (E 96.78
KOG2056|consensus 336 96.32
cd03564117 ANTH_AP180_CALM ANTH domain family; composed of ad 95.69
smart00273127 ENTH Epsin N-terminal homology (ENTH) domain. 94.99
PF12348228 CLASP_N: CLASP N terminal; InterPro: IPR024395 Thi 92.56
PF0481864 CTD_bind: RNA polymerase II-binding domain.; Inter 89.89
PF08167165 RIX1: rRNA processing/ribosome biogenesis 89.27
cd00020120 ARM Armadillo/beta-catenin-like repeats. An approx 89.2
PF1364688 HEAT_2: HEAT repeats; PDB: 1OYZ_A 3FGA_A 2PF4_C 2I 88.85
PF1364688 HEAT_2: HEAT repeats; PDB: 1OYZ_A 3FGA_A 2PF4_C 2I 87.81
KOG2160|consensus342 86.41
cd00020120 ARM Armadillo/beta-catenin-like repeats. An approx 83.49
PF11707330 Npa1: Ribosome 60S biogenesis N-terminal; InterPro 82.01
KOG2057|consensus 499 80.52
>cd03568 VHS_STAM VHS domain family, STAM subfamily; members include STAM (Signal Transducing Adaptor Molecule), EAST (EGFR-associated protein with SH3 and TAM domains) and Hbp (Hrs-binding protein) Back     alignment and domain information 
Probab=100.00  E-value=2.4e-38  Score=241.36  Aligned_cols=105  Identities=29%  Similarity=0.583  Sum_probs=103.1

Q ss_pred             CCChHHHHHHHHHHhcCCCHHHHHHHHHHHHHHHHccchhHHhhhccHHHHHHHHHhhccCCcHHHHHHHHHHHHHHHHH
Q psy6184           7 TIVPSHALASIKKKLTNSNPHIVLYALLVLESCVKNCGNLIHDEVGTKAFMEQMKELVRGTQHEEVKAKILELIQAWAHA   86 (156)
Q Consensus         7 ~~~~k~AvraL~KrL~~~n~~v~l~AL~LLe~~vkNCG~~fh~eIask~Fl~~l~kl~~~~~~~~Vk~kil~li~~Wa~~   86 (156)
                      +++||+|+++|+|||+|+|||+|++||+|||+||||||.+||.||++++|+++|+++++++++..||+||+++|++|+.+
T Consensus        32 ~~~~k~a~ral~KRl~~~n~~v~l~AL~LLe~~vkNCG~~fh~evask~Fl~eL~kl~~~~~~~~Vk~kil~li~~W~~~  111 (144)
T cd03568          32 ENGAKDCLKAIMKRLNHKDPNVQLRALTLLDACAENCGKRFHQEVASRDFTQELKKLINDRVHPTVKEKLREVVKQWADE  111 (144)
T ss_pred             CccHHHHHHHHHHHHcCCCHHHHHHHHHHHHHHHHHCCHHHHHHHhhHHHHHHHHHHhcccCCHHHHHHHHHHHHHHHHH
Confidence            78999999999999999999999999999999999999999999999999999999998879999999999999999999


Q ss_pred             hhCCCCCcchH-HHHHhhhCCCCCCC
Q psy6184          87 FRNSPKYRAVP-TKSWMTDKGFKNPS  111 (156)
Q Consensus        87 F~~~~~l~~i~-~Y~~Lk~~Gi~FP~  111 (156)
                      |+++|+|++|. +|++|+++||.||.
T Consensus       112 f~~~~~l~~i~~~y~~L~~~G~~f~~  137 (144)
T cd03568         112 FKNDPSLSLMSDLYKKLKNEGPDLVT  137 (144)
T ss_pred             hCCCcccHHHHHHHHHHHHcCCCCCC
Confidence            99999999999 99999999999996

Collectively, they are referred to as STAM. All STAMs have at their N-termini a VHS domain, which is involved in cytokine-mediated intracellular signal transduction and has a superhelical structure similar to the structure of ARM (Armadillo) repeats, followed by a SH3 (Src homology 3) domain, a well-established protein-protein interaction domain. At the C-termini of most vertebrate STAMS, an ITAM (Immunoreceptor Tyrosine-based Activation) motif is present, which mediates the binding of HRS (hepatocyte growth factor-regulated tyrosine kinase substrate) in endocytic and exocytic machineries.
>cd03569 VHS_Hrs_Vps27p VHS domain family, Hrs and Vps27p subfamily; composed of Hrs (Hepatocyte growth factor-regulated tyrosine kinase substrate) and its yeast homolog Vps27p (vacuolar protein sorting) Back     alignment and domain information
>cd03565 VHS_Tom1 VHS domain family, Tom1 subfamily; The VHS domain is an essential part of Tom1 (Target of myb1 - retroviral oncogene) protein Back     alignment and domain information
>cd03567 VHS_GGA VHS domain family, GGA subfamily; GGA (Golgi-localized, Gamma-ear-containing, Arf-binding) comprise a subfamily of ubiquitously expressed, monomeric, motif-binding cargo/clathrin adaptor proteins Back     alignment and domain information
>smart00288 VHS Domain present in VPS-27, Hrs and STAM Back     alignment and domain information
>PF00790 VHS: VHS domain; InterPro: IPR002014 The VHS domain is a ~140 residues long domain, whose name is derived from its occurrence in VPS-27, Hrs and STAM Back     alignment and domain information
>KOG1087|consensus Back     alignment and domain information
>KOG2199|consensus Back     alignment and domain information
>cd03561 VHS VHS domain family; The VHS domain is present in Vps27 (Vacuolar Protein Sorting), Hrs (Hepatocyte growth factor-regulated tyrosine kinase substrate) and STAM (Signal Transducing Adaptor Molecule) Back     alignment and domain information
>KOG1818|consensus Back     alignment and domain information
>KOG1086|consensus Back     alignment and domain information
>cd00197 VHS_ENTH_ANTH VHS, ENTH and ANTH domain superfamily; composed of proteins containing a VHS, ENTH or ANTH domain Back     alignment and domain information
>cd03562 CID CID (CTD-Interacting Domain) domain family; CID is present in several RNA-processing factors such as Pcf11 and Nrd1 Back     alignment and domain information
>PF01417 ENTH: ENTH domain; InterPro: IPR001026 The ENTH (Epsin N-terminal homology) domain is approximately 150 amino acids in length and is always found located at the N-termini of proteins Back     alignment and domain information
>cd03572 ENTH_epsin_related ENTH domain, Epsin Related family; composed of hypothetical proteins containing an ENTH-like domain Back     alignment and domain information
>smart00582 RPR domain present in proteins, which are involved in regulation of nuclear pre-mRNA Back     alignment and domain information
>cd03571 ENTH_epsin ENTH domain, Epsin family; The epsin (Eps15 interactor) N-terminal homology (ENTH) domain is an evolutionarily conserved protein module found primarily in proteins that participate in clathrin-mediated endocytosis Back     alignment and domain information
>KOG2056|consensus Back     alignment and domain information
>cd03564 ANTH_AP180_CALM ANTH domain family; composed of adaptor protein 180 (AP180), clathrin assembly lymphoid myeloid leukemia protein (CALM) and similar proteins Back     alignment and domain information
>smart00273 ENTH Epsin N-terminal homology (ENTH) domain Back     alignment and domain information
>PF12348 CLASP_N: CLASP N terminal; InterPro: IPR024395 This domain is found in the N-terminal region of CLIP-associated proteins (CLASPs), which are widely conserved microtubule plus-end-tracking proteins that regulate the stability of dynamic microtubules [, ] Back     alignment and domain information
>PF04818 CTD_bind: RNA polymerase II-binding domain Back     alignment and domain information
>PF08167 RIX1: rRNA processing/ribosome biogenesis Back     alignment and domain information
>cd00020 ARM Armadillo/beta-catenin-like repeats Back     alignment and domain information
>PF13646 HEAT_2: HEAT repeats; PDB: 1OYZ_A 3FGA_A 2PF4_C 2IAE_A 3B2A_A Back     alignment and domain information
>PF13646 HEAT_2: HEAT repeats; PDB: 1OYZ_A 3FGA_A 2PF4_C 2IAE_A 3B2A_A Back     alignment and domain information
>KOG2160|consensus Back     alignment and domain information
>cd00020 ARM Armadillo/beta-catenin-like repeats Back     alignment and domain information
>PF11707 Npa1: Ribosome 60S biogenesis N-terminal; InterPro: IPR021714 Npa1p is required for ribosome biogenesis and operates in the same functional environment as Rsa3p and Dbp6p during early maturation of 60S ribosomal subunits [] Back     alignment and domain information
>KOG2057|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query156
3zyq_A226 Crystal Structure Of The Tandem Vhs And Fyve Domain 2e-24
1dvp_A220 Crystal Structure Of The Vhs And Fyve Tandem Domain 4e-22
1elk_A157 Vhs Domain Of Tom1 Protein From H. Sapiens Length = 8e-13
1x5b_A163 The Solution Structure Of The Vhs Domain Of Human S 5e-11
3ldz_A140 Crystal Structure Of Human Stam1 Vhs Domain In Comp 2e-09
1lf8_A171 Complex Of Gga3-Vhs Domain And Ci-Mpr C-Terminal Ph 5e-07
1jpl_A171 Gga3 Vhs Domain Complexed With C-Terminal Peptide F 8e-07
1py1_A158 Complex Of Gga1-Vhs Domain And Beta-Secretase C-Ter 1e-06
3g2s_A149 Vhs Domain Of Human Gga1 Complexed With Sorla C-Ter 2e-06
1jwf_A147 Crystal Structure Of Human Gga1 Vhs Domain. Length 2e-06
1mhq_A148 Crystal Structure Of Human Gga2 Vhs Domain Length = 6e-05
>pdb|3ZYQ|A Chain A, Crystal Structure Of The Tandem Vhs And Fyve Domains Of Hepatocyte Growth Factor-Regulated Tyrosine Kinase Substrate (Hgs-Hrs) At 1.48 A Resolution Length = 226 Back     alignment and structure 
Iteration: 1

 Score =  107 bits (268), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 56/108 (51%), Positives = 73/108 (67%), Gaps = 2/108 (1%)
Query: 12  HALASIKKKLTNSNPHIVLYALLVLESCVKNCGNLIHDEVGTKAFMEQMKELVRGTQHEE 71
           +A+ SIKKK+ + NPH+ LYAL V+ES VKNCG  +HDEV  K  ME++K+L++      
Sbjct: 45  YAVNSIKKKVNDKNPHVALYALEVMESVVKNCGQTVHDEVANKQTMEELKDLLKRQVEVN 104
Query: 72  VKAKILELIQAWAHAFRNSPKYRAV-PTKSWMTDKGFKNPS-KSSDSL 117
           V+ KIL LIQAWAHAFRN PKY+ V  T   M  +G   P  K SD++
Sbjct: 105 VRNKILYLIQAWAHAFRNEPKYKVVQDTYQIMKVEGHVFPEFKESDAM 152
>pdb|1DVP|A Chain A, Crystal Structure Of The Vhs And Fyve Tandem Domains Of Hrs, A Protein Involved In Membrane Trafficking And Signal Transduction Length = 220 Back     alignment and structure
>pdb|1ELK|A Chain A, Vhs Domain Of Tom1 Protein From H. Sapiens Length = 157 Back     alignment and structure
>pdb|1X5B|A Chain A, The Solution Structure Of The Vhs Domain Of Human Signal Transducing Adaptor Molecule 2 Length = 163 Back     alignment and structure
>pdb|3LDZ|A Chain A, Crystal Structure Of Human Stam1 Vhs Domain In Complex With Ubiquitin Length = 140 Back     alignment and structure
>pdb|1LF8|A Chain A, Complex Of Gga3-Vhs Domain And Ci-Mpr C-Terminal Phosphopeptide Length = 171 Back     alignment and structure
>pdb|1JPL|A Chain A, Gga3 Vhs Domain Complexed With C-Terminal Peptide From Cation-Independent Mannose 6-Phosphate Receptor Length = 171 Back     alignment and structure
>pdb|1PY1|A Chain A, Complex Of Gga1-Vhs Domain And Beta-Secretase C-Terminal Phosphopeptide Length = 158 Back     alignment and structure
>pdb|3G2S|A Chain A, Vhs Domain Of Human Gga1 Complexed With Sorla C-Terminal Peptide Length = 149 Back     alignment and structure
>pdb|1JWF|A Chain A, Crystal Structure Of Human Gga1 Vhs Domain. Length = 147 Back     alignment and structure
>pdb|1MHQ|A Chain A, Crystal Structure Of Human Gga2 Vhs Domain Length = 148 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query156
1x5b_A163 Signal transducing adaptor molecule 2; VHS domain, 4e-31
1mhq_A148 ADP-ribosylation factor binding protein GGA2; supe 3e-29
3zyq_A226 Hepatocyte growth factor-regulated tyrosine kinas 1e-28
1dvp_A220 HRS, hepatocyte growth factor-regulated tyrosine k 1e-27
1juq_A171 ADP-ribosylation factor binding protein GGA3; prot 1e-27
3g2s_A149 C-terminal fragment of sortilin-related receptor; 2e-27
3ldz_A140 STAM-1, signal transducing adapter molecule 1; ubi 2e-26
1elk_A157 Target of MYB1; superhelix of helices, endocytosis 3e-26
3rru_A152 TOM1L1 protein; structural genomics, PSI-biology, 2e-23
>1x5b_A Signal transducing adaptor molecule 2; VHS domain, ubiquitin binding, STAM2, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2l0t_B Length = 163 Back     alignment and structure
 Score =  108 bits (272), Expect = 4e-31
 Identities = 30/110 (27%), Positives = 57/110 (51%), Gaps = 1/110 (0%)

Query: 10  PSHALASIKKKLTNSNPHIVLYALLVLESCVKNCGNLIHDEVGTKAFMEQMKELVRGTQH 69
               L +I K++ +  PH+ L AL +L +CV NCG + H EV ++ F  +++ +++   H
Sbjct: 50  AKDCLKAIMKRVNHKVPHVALQALTLLGACVANCGKIFHLEVCSRDFATEVRAVIKNKAH 109

Query: 70  EEVKAKILELIQAWAHAFRNSPKYRAVPTK-SWMTDKGFKNPSKSSDSLG 118
            +V  K+  L+  W+  F+  P++  +      M ++G   P   S + G
Sbjct: 110 PKVCEKLKSLMVEWSEEFQKDPQFSLISATIKSMKEEGITFPPAGSQTSG 159
>1mhq_A ADP-ribosylation factor binding protein GGA2; super helix, protein transport; 2.20A {Homo sapiens} SCOP: a.118.9.2 Length = 148 Back     alignment and structure
>3zyq_A Hepatocyte growth factor-regulated tyrosine kinas substrate; signaling; 1.48A {Homo sapiens} PDB: 4avx_A* Length = 226 Back     alignment and structure
>1dvp_A HRS, hepatocyte growth factor-regulated tyrosine kinase substrate; VHS, FYVE, zinc finger, superhelix, transferase; HET: CIT; 2.00A {Drosophila melanogaster} SCOP: a.118.9.2 g.50.1.1 Length = 220 Back     alignment and structure
>1juq_A ADP-ribosylation factor binding protein GGA3; protein-peptide compelx, VHS domain, DXXLL sorting signal, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.9.2 PDB: 1jpl_A 1lf8_A* Length = 171 Back     alignment and structure
>3g2s_A C-terminal fragment of sortilin-related receptor; ADP-ribosylation factor binding protein GGA1, VHS, acidic- cluster dileucine signal, sorla; 1.70A {Homo sapiens} PDB: 3g2t_A* 3g2u_A 3g2v_A* 3g2w_A 1ujk_A* 1jwf_A 1ujj_A 1jwg_A* 1py1_A* Length = 149 Back     alignment and structure
>3ldz_A STAM-1, signal transducing adapter molecule 1; ubiquitin-binding, cytoplasm, UBL conjugation, endosome, membrane, protein transport, SH3 domain; 2.60A {Homo sapiens} Length = 140 Back     alignment and structure
>1elk_A Target of MYB1; superhelix of helices, endocytosis/exocytosis complex; 1.50A {Homo sapiens} SCOP: a.118.9.2 Length = 157 Back     alignment and structure
>3rru_A TOM1L1 protein; structural genomics, PSI-biology, northeast structural genom consortium, NESG, super-helical protein; 3.00A {Homo sapiens} Length = 152 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query156
3zyq_A226 Hepatocyte growth factor-regulated tyrosine kinas 100.0
1x5b_A163 Signal transducing adaptor molecule 2; VHS domain, 100.0
3ldz_A140 STAM-1, signal transducing adapter molecule 1; ubi 100.0
1juq_A171 ADP-ribosylation factor binding protein GGA3; prot 100.0
1mhq_A148 ADP-ribosylation factor binding protein GGA2; supe 100.0
1elk_A157 Target of MYB1; superhelix of helices, endocytosis 100.0
1dvp_A220 HRS, hepatocyte growth factor-regulated tyrosine k 100.0
3g2s_A149 C-terminal fragment of sortilin-related receptor; 100.0
3rru_A152 TOM1L1 protein; structural genomics, PSI-biology, 100.0
1sz9_A144 PCF11 protein; RNA polymerase II CTD interacting d 98.45
1vdy_A140 Hypothetical protein (RAFL09-17-B18); structural g 97.48
4flb_A132 Regulation of nuclear PRE-mRNA domain-containing; 97.09
3d9j_A145 RNA-binding protein 16; SCAF8, RNA polymerase II C 97.03
1inz_A148 EPS15-interacting portein(epsin); alpha-helix, rik 96.71
1xgw_A176 Epsin 4; ENTH, enthoprotin, clathrin-associated, e 96.71
1eyh_A144 Epsin; superhelix of helices, cell cycle; 1.56A {R 96.19
3onk_A150 Epsin-3, ENT3; helix, protein transport; 2.09A {Sa 96.16
4fu3_A135 Regulation of nuclear PRE-mRNA domain-containing 1 96.05
2km4_A142 Regulator of TY1 transposition protein 103; CTD-in 94.55
2qk2_A242 LP04448P; mini spindles, MSPS, XMAP215, DIS1, STU2 93.87
3clj_A157 Protein NRD1; CTD-interacting domain, nucleus, pho 93.06
2qk2_A242 LP04448P; mini spindles, MSPS, XMAP215, DIS1, STU2 92.7
2qk1_A249 Protein STU2; STU2P, XMAP215, DIS1, TOG, CH-TOG, h 90.5
4db6_A210 Armadillo repeat protein; solenoid repeat, armadil 90.29
2qk1_A249 Protein STU2; STU2P, XMAP215, DIS1, TOG, CH-TOG, h 88.63
4ffb_C278 Protein STU2; tubulin fold, heat repeats, cytoskel 88.19
4ffb_C278 Protein STU2; tubulin fold, heat repeats, cytoskel 87.6
4hxt_A252 De novo protein OR329; structural genomics, PSI-bi 87.04
3b2a_A265 TON_1937, putative uncharacterized protein; heat-r 86.44
4hxt_A 252 De novo protein OR329; structural genomics, PSI-bi 85.99
3zyl_A271 Phosphatidylinositol-binding clathrin assembly PR; 85.7
4db8_A252 Armadillo-repeat protein; solenoid repeat, de novo 85.57
3zym_A 310 Phosphatidylinositol-binding clathrin assembly PR 85.1
3dad_A339 FH1/FH2 domain-containing protein 1; formin, FHOD1 84.71
1xqr_A296 HSPBP1 protein; armadillo repeat, superhelical twi 83.96
1hx8_A299 Synapse-enriched clathrin adaptor protein LAP; all 83.94
1ibr_B462 P95, importin beta-1 subunit, nuclear factor; smal 81.69
3nmw_A354 APC variant protein; ARMADIILO repeats domain, cel 81.59
1xqr_A296 HSPBP1 protein; armadillo repeat, superhelical twi 81.41
4db6_A210 Armadillo repeat protein; solenoid repeat, armadil 80.93
2jdq_A 450 Importin alpha-1 subunit; transport, PB2 subunit, 80.87
4b8j_A 528 Importin subunit alpha-1A; transport protein, nucl 80.64
>3zyq_A Hepatocyte growth factor-regulated tyrosine kinas substrate; signaling; 1.48A {Homo sapiens} PDB: 4avx_A* Back     alignment and structure
Probab=100.00  E-value=4.6e-39  Score=259.34  Aligned_cols=131  Identities=44%  Similarity=0.680  Sum_probs=121.9

Q ss_pred             CCCChHHHHHHHHHHhcCCCHHHHHHHHHHHHHHHHccchhHHhhhccHHHHHHHHHhhccCCcHHHHHHHHHHHHHHHH
Q psy6184           6 WTIVPSHALASIKKKLTNSNPHIVLYALLVLESCVKNCGNLIHDEVGTKAFMEQMKELVRGTQHEEVKAKILELIQAWAH   85 (156)
Q Consensus         6 ~~~~~k~AvraL~KrL~~~n~~v~l~AL~LLe~~vkNCG~~fh~eIask~Fl~~l~kl~~~~~~~~Vk~kil~li~~Wa~   85 (156)
                      .+++|+||+++|+|||+++||++|++||+|||+||||||.+||.||++++|+++|++++++.++.+||+||+++|+.|++
T Consensus        39 ~~~~~k~a~ral~krl~~~n~~v~l~aL~LLe~~vkNcG~~f~~eias~~fl~~l~~l~~~~~~~~Vk~kil~li~~W~~  118 (226)
T 3zyq_A           39 GDTQAKYAVNSIKKKVNDKNPHVALYALEVMESVVKNCGQTVHDEVANKQTMEELKDLLKRQVEVNVRNKILYLIQAWAH  118 (226)
T ss_dssp             TSSCHHHHHHHHHHHHTCSSHHHHHHHHHHHHHHHHHHCHHHHHHHSSHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHH
T ss_pred             CCccHHHHHHHHHHHHcCCCHHHHHHHHHHHHHHHHhcchHHHHhhccHHHHHHHHHHhccCCCHHHHHHHHHHHHHHHH
Confidence            46899999999999999999999999999999999999999999999999999999999888999999999999999999


Q ss_pred             HhhCCCCCcchH-HHHHhhhCCCCCCC-CCCCCCCChhh--------hhhhhhccccccCC
Q psy6184          86 AFRNSPKYRAVP-TKSWMTDKGFKNPS-KSSDSLGLELQ--------IFRICHIHFSEIKG  136 (156)
Q Consensus        86 ~F~~~~~l~~i~-~Y~~Lk~~Gi~FP~-~~~~a~f~~~~--------~~~~~~~~~~~~~~  136 (156)
                      +|+++|+|++|. +|++|+++||+||+ +++++||+.+.        .|+.|...|+.+..
T Consensus       119 ~f~~~~~l~~i~~~Y~~Lk~~G~~FP~~~~~damf~~~~~p~W~~~~~C~~C~~~F~~~~R  179 (226)
T 3zyq_A          119 AFRNEPKYKVVQDTYQIMKVEGHVFPEFKESDAMFAAERAPDWVDAEECHRCRVQFGVMTR  179 (226)
T ss_dssp             HTTTCGGGHHHHHHHHHHHHHTCCCCCCCGGGGCCCCCCCCCCCCCSBCTTTCCBCBTTBC
T ss_pred             HhCCCcchHHHHHHHHHHHhcCCCcccchhHHHhhhcccccccccCCCCcCcCCCCCcccc
Confidence            999999999999 99999999999999 67888886553        67888888886643
>1x5b_A Signal transducing adaptor molecule 2; VHS domain, ubiquitin binding, STAM2, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2l0t_B Back     alignment and structure
>3ldz_A STAM-1, signal transducing adapter molecule 1; ubiquitin-binding, cytoplasm, UBL conjugation, endosome, membrane, protein transport, SH3 domain; 2.60A {Homo sapiens} SCOP: a.118.9.0 Back     alignment and structure
>1juq_A ADP-ribosylation factor binding protein GGA3; protein-peptide compelx, VHS domain, DXXLL sorting signal, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.9.2 PDB: 1jpl_A 1lf8_A* Back     alignment and structure
>1mhq_A ADP-ribosylation factor binding protein GGA2; super helix, protein transport; 2.20A {Homo sapiens} SCOP: a.118.9.2 Back     alignment and structure
>1elk_A Target of MYB1; superhelix of helices, endocytosis/exocytosis complex; 1.50A {Homo sapiens} SCOP: a.118.9.2 Back     alignment and structure
>1dvp_A HRS, hepatocyte growth factor-regulated tyrosine kinase substrate; VHS, FYVE, zinc finger, superhelix, transferase; HET: CIT; 2.00A {Drosophila melanogaster} SCOP: a.118.9.2 g.50.1.1 Back     alignment and structure
>3g2s_A C-terminal fragment of sortilin-related receptor; ADP-ribosylation factor binding protein GGA1, VHS, acidic- cluster dileucine signal, sorla; 1.70A {Homo sapiens} SCOP: a.118.9.2 PDB: 3g2t_A* 3g2u_A 3g2v_A* 3g2w_A 1ujk_A* 1jwf_A 1ujj_A 1jwg_A* 1py1_A* Back     alignment and structure
>3rru_A TOM1L1 protein; structural genomics, PSI-biology, northeast structural genom consortium, NESG, super-helical protein; 3.00A {Homo sapiens} Back     alignment and structure
>1sz9_A PCF11 protein; RNA polymerase II CTD interacting domain, arm repeats, transcription; 2.10A {Saccharomyces cerevisiae} SCOP: a.118.9.4 PDB: 1sza_A* 2bf0_X Back     alignment and structure
>1vdy_A Hypothetical protein (RAFL09-17-B18); structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Arabidopsis thaliana} PDB: 2dcp_A Back     alignment and structure
>4flb_A Regulation of nuclear PRE-mRNA domain-containing; structural genomics consortium, SGC, protein binding; 1.80A {Homo sapiens} Back     alignment and structure
>3d9j_A RNA-binding protein 16; SCAF8, RNA polymerase II CTD interacting domain, arm repeats phospho-CTD, phosphoprotein, transcription; 1.60A {Homo sapiens} PDB: 3d9k_A* 3d9l_A* 3d9m_A* 3d9n_A* 3d9p_A* 3d9i_A 3d9o_A* 2diw_A Back     alignment and structure
>1inz_A EPS15-interacting portein(epsin); alpha-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.118.9.1 Back     alignment and structure
>1xgw_A Epsin 4; ENTH, enthoprotin, clathrin-associated, endocytosis; 1.90A {Homo sapiens} PDB: 2qy7_A 2v8s_E Back     alignment and structure
>1eyh_A Epsin; superhelix of helices, cell cycle; 1.56A {Rattus norvegicus} SCOP: a.118.9.1 PDB: 1h0a_A* 1edu_A Back     alignment and structure
>3onk_A Epsin-3, ENT3; helix, protein transport; 2.09A {Saccharomyces cerevisiae} PDB: 3onl_A Back     alignment and structure
>4fu3_A Regulation of nuclear PRE-mRNA domain-containing 1B; structural genomics consortium, SGC, domain swapping, transc; HET: MSE; 1.90A {Homo sapiens} PDB: 4fld_A* Back     alignment and structure
>2km4_A Regulator of TY1 transposition protein 103; CTD-interacting domain, RNA polymerase II binding protein, phosphoprotein; NMR {Saccharomyces cerevisiae} PDB: 2l0i_A* Back     alignment and structure
>2qk2_A LP04448P; mini spindles, MSPS, XMAP215, DIS1, STU2, heat repeat, micro plus END, +TIP, protein binding; 2.10A {Drosophila melanogaster} Back     alignment and structure
>3clj_A Protein NRD1; CTD-interacting domain, nucleus, phosphoprotein, RNA polymer binding protein, RNA binding protein; 2.10A {Saccharomyces cerevisiae} Back     alignment and structure
>2qk2_A LP04448P; mini spindles, MSPS, XMAP215, DIS1, STU2, heat repeat, micro plus END, +TIP, protein binding; 2.10A {Drosophila melanogaster} Back     alignment and structure
>2qk1_A Protein STU2; STU2P, XMAP215, DIS1, TOG, CH-TOG, heat repeat, microtubule plus END, +TIP, protein binding; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>4db6_A Armadillo repeat protein; solenoid repeat, armadillo repeat motif, de novo protein; 1.80A {Synthetic construct} PDB: 4db9_A 4dba_A Back     alignment and structure
>2qk1_A Protein STU2; STU2P, XMAP215, DIS1, TOG, CH-TOG, heat repeat, microtubule plus END, +TIP, protein binding; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>4ffb_C Protein STU2; tubulin fold, heat repeats, cytoskeleton, microtubule, tubul domain, hydrolase; HET: GTP; 2.88A {Saccharomyces cerevisiae} Back     alignment and structure
>4ffb_C Protein STU2; tubulin fold, heat repeats, cytoskeleton, microtubule, tubul domain, hydrolase; HET: GTP; 2.88A {Saccharomyces cerevisiae} Back     alignment and structure
>4hxt_A De novo protein OR329; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG; 1.95A {Artificial gene} Back     alignment and structure
>3b2a_A TON_1937, putative uncharacterized protein; heat-repeats, hypothetical, unknown function; 2.20A {Thermococcus onnurineus} Back     alignment and structure
>4hxt_A De novo protein OR329; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG; 1.95A {Artificial gene} Back     alignment and structure
>3zyl_A Phosphatidylinositol-binding clathrin assembly PR; endocytosis, endobrevin, synaptobrevin, VAMP2, VAMP3, AP180, membrane, adaptor protein; 1.70A {Rattus norvegicus} PDB: 3zyk_A 1hf8_A 1hfa_A* 1hg2_A* 1hg5_A* Back     alignment and structure
>4db8_A Armadillo-repeat protein; solenoid repeat, de novo protein; 2.50A {Synthetic construct} Back     alignment and structure
>3zym_A Phosphatidylinositol-binding clathrin assembly PR vesicle-associated membrane protein...; endocytosis, synaptobrevin, VAMP2, VAMP3, AP180; HET: PO4; 2.03A {Rattus norvegicus} Back     alignment and structure
>3dad_A FH1/FH2 domain-containing protein 1; formin, FHOD1, GTPase-binding domain, ubiquitin-superfold, armadillo repeats, actin-binding, coiled coil; 2.30A {Homo sapiens} Back     alignment and structure
>1xqr_A HSPBP1 protein; armadillo repeat, superhelical twist, chaperone; 2.10A {Homo sapiens} SCOP: a.118.1.21 PDB: 1xqs_A* Back     alignment and structure
>1hx8_A Synapse-enriched clathrin adaptor protein LAP; all alpha, alpha helices repeats, coiled-coil, endocytosis/exocytosis complex; 2.20A {Drosophila melanogaster} SCOP: a.7.8.2 a.118.9.3 Back     alignment and structure
>1ibr_B P95, importin beta-1 subunit, nuclear factor; small GTPase, nuclear transport receptor, cell cycle, translation; HET: GNP; 2.30A {Homo sapiens} SCOP: a.118.1.1 PDB: 1m5n_S 1gcj_A 1f59_A 1o6o_A 1o6p_A Back     alignment and structure
>3nmw_A APC variant protein; ARMADIILO repeats domain, cell adhesion-cell cycle complex; 1.60A {Homo sapiens} PDB: 3nmx_A 3t7u_A 3au3_A 3qhe_A Back     alignment and structure
>1xqr_A HSPBP1 protein; armadillo repeat, superhelical twist, chaperone; 2.10A {Homo sapiens} SCOP: a.118.1.21 PDB: 1xqs_A* Back     alignment and structure
>4db6_A Armadillo repeat protein; solenoid repeat, armadillo repeat motif, de novo protein; 1.80A {Synthetic construct} PDB: 4db9_A 4dba_A Back     alignment and structure
>2jdq_A Importin alpha-1 subunit; transport, PB2 subunit, nuclear protein, protein transport, armadillo repeats; 2.2A {Homo sapiens} PDB: 3tj3_A Back     alignment and structure
>4b8j_A Importin subunit alpha-1A; transport protein, nuclear localization signal; 2.00A {Oryza sativa japonica group} PDB: 4b8o_A 2yns_A 4b8p_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 156
d1dvpa1145 a.118.9.2 (A:1-145) Hrs {Fruit fly (Drosophila mel 8e-29
d1mhqa_143 a.118.9.2 (A:) ADP-ribosylation factor binding pro 1e-28
d1juqa_151 a.118.9.2 (A:) ADP-ribosylation factor binding pro 1e-27
d1elka_153 a.118.9.2 (A:) Tom1 protein {Human (Homo sapiens) 2e-26
d1ujka_145 a.118.9.2 (A:) ADP-ribosylation factor binding pro 4e-26
>d1dvpa1 a.118.9.2 (A:1-145) Hrs {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 145 Back     information, alignment and structure

class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: ENTH/VHS domain
family: VHS domain
domain: Hrs
species: Fruit fly (Drosophila melanogaster) [TaxId: 7227]

 Score =  101 bits (252), Expect = 8e-29
 Identities = 50/102 (49%), Positives = 67/102 (65%), Gaps = 1/102 (0%)

Query: 10  PSHALASIKKKLTNSNPHIVLYALLVLESCVKNCGNLIHDEVGTKAFMEQMKELVRGTQH 69
           P +A A+IKKK+ + NPH   Y+LLVLES VKNCG  +H+EV TK   E     +  T H
Sbjct: 40  PKNAFAAIKKKMNSPNPHSSCYSLLVLESIVKNCGAPVHEEVFTKENCEMFSSFLESTPH 99

Query: 70  EEVKAKILELIQAWAHAFRNSPKYRAVP-TKSWMTDKGFKNP 110
           E V+ K+LEL+Q WA+AFR+S KY+A+  T + +  KG   P
Sbjct: 100 ENVRQKMLELVQTWAYAFRSSDKYQAIKDTMTILKAKGHTFP 141
>d1mhqa_ a.118.9.2 (A:) ADP-ribosylation factor binding protein Gga2 {Human (Homo sapiens) [TaxId: 9606]} Length = 143 Back     information, alignment and structure
>d1juqa_ a.118.9.2 (A:) ADP-ribosylation factor binding protein Gga3 {Human (Homo sapiens) [TaxId: 9606]} Length = 151 Back     information, alignment and structure
>d1elka_ a.118.9.2 (A:) Tom1 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 153 Back     information, alignment and structure
>d1ujka_ a.118.9.2 (A:) ADP-ribosylation factor binding protein Gga1 {Human (Homo sapiens) [TaxId: 9606]} Length = 145 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query156
d1dvpa1145 Hrs {Fruit fly (Drosophila melanogaster) [TaxId: 7 100.0
d1elka_153 Tom1 protein {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1juqa_151 ADP-ribosylation factor binding protein Gga3 {Huma 100.0
d1mhqa_143 ADP-ribosylation factor binding protein Gga2 {Huma 100.0
d1ujka_145 ADP-ribosylation factor binding protein Gga1 {Huma 100.0
d1hf8a2131 Clathrin assembly lymphoid myeloid leukaemia prote 98.12
d1szaa_144 PCF11 protein {Baker's yeast (Saccharomyces cerevi 97.88
d1hx8a2140 AP180 (Lap) {Fruit fly (Drosophila melanogaster) [ 96.54
d1eyha_144 Epsin 1 {Rat (Rattus norvegicus) [TaxId: 10116]} 96.14
d1q1sc_ 434 Importin alpha {Mouse (Mus musculus) [TaxId: 10090 87.48
d1xm9a1 457 Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} 87.11
d1te4a_111 MTH187 {Archaeon Methanobacterium thermoautotrophi 86.53
d1jdha_ 529 beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} 84.37
d1xqra1264 Hsp70-binding protein 1 (HspBP1) {Human (Homo sapi 83.17
d1xqra1264 Hsp70-binding protein 1 (HspBP1) {Human (Homo sapi 81.78
>d1dvpa1 a.118.9.2 (A:1-145) Hrs {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: ENTH/VHS domain
family: VHS domain
domain: Hrs
species: Fruit fly (Drosophila melanogaster) [TaxId: 7227]

Probab=100.00  E-value=3e-37  Score=231.95  Aligned_cols=106  Identities=47%  Similarity=0.741  Sum_probs=103.6

Q ss_pred             CCCChHHHHHHHHHHhcCCCHHHHHHHHHHHHHHHHccchhHHhhhccHHHHHHHHHhhccCCcHHHHHHHHHHHHHHHH
Q psy6184           6 WTIVPSHALASIKKKLTNSNPHIVLYALLVLESCVKNCGNLIHDEVGTKAFMEQMKELVRGTQHEEVKAKILELIQAWAH   85 (156)
Q Consensus         6 ~~~~~k~AvraL~KrL~~~n~~v~l~AL~LLe~~vkNCG~~fh~eIask~Fl~~l~kl~~~~~~~~Vk~kil~li~~Wa~   85 (156)
                      .+++|++|+++|+|||+|+||++|++||.|||+||+|||..||.+|++++|+++|.+++++.++..|++|++++|+.|++
T Consensus        36 ~~~~~k~a~ral~krl~~~n~~v~l~aL~LLd~~vkNcG~~f~~~i~s~~fl~~l~~l~~~~~~~~Vk~kil~li~~W~~  115 (145)
T d1dvpa1          36 KDVTPKNAFAAIKKKMNSPNPHSSCYSLLVLESIVKNCGAPVHEEVFTKENCEMFSSFLESTPHENVRQKMLELVQTWAY  115 (145)
T ss_dssp             TSSCHHHHHHHHHHHHTCSSHHHHHHHHHHHHHHHHHSHHHHHHHHSSHHHHHHHHHHHHHCSCHHHHHHHHHHHHHHHH
T ss_pred             CCccHHHHHHHHHHHHcCCCHHHHHHHHHHHHHHHHccchHHHHHHhhHHHHHHHHHHhcCCCCHHHHHHHHHHHHHHHH
Confidence            46789999999999999999999999999999999999999999999999999999999888899999999999999999


Q ss_pred             HhhCCCCCcchH-HHHHhhhCCCCCCC
Q psy6184          86 AFRNSPKYRAVP-TKSWMTDKGFKNPS  111 (156)
Q Consensus        86 ~F~~~~~l~~i~-~Y~~Lk~~Gi~FP~  111 (156)
                      +|+++|+|+++. +|+.||++||.||+
T Consensus       116 ~f~~~~~~~~i~~~y~~Lk~~G~~FP~  142 (145)
T d1dvpa1         116 AFRSSDKYQAIKDTMTILKAKGHTFPE  142 (145)
T ss_dssp             HTTTCSSCCHHHHHHHHHHHTTCCCCC
T ss_pred             HhCCCccchHHHHHHHHHHHCCCCCcC
Confidence            999999999999 99999999999997
>d1elka_ a.118.9.2 (A:) Tom1 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1juqa_ a.118.9.2 (A:) ADP-ribosylation factor binding protein Gga3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mhqa_ a.118.9.2 (A:) ADP-ribosylation factor binding protein Gga2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ujka_ a.118.9.2 (A:) ADP-ribosylation factor binding protein Gga1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hf8a2 a.118.9.3 (A:19-149) Clathrin assembly lymphoid myeloid leukaemia protein, Calm {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1szaa_ a.118.9.4 (A:) PCF11 protein {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1hx8a2 a.118.9.3 (A:22-161) AP180 (Lap) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1eyha_ a.118.9.1 (A:) Epsin 1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1q1sc_ a.118.1.1 (C:) Importin alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1xm9a1 a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1te4a_ a.118.1.16 (A:) MTH187 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1jdha_ a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xqra1 a.118.1.21 (A:87-350) Hsp70-binding protein 1 (HspBP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xqra1 a.118.1.21 (A:87-350) Hsp70-binding protein 1 (HspBP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure