Diaphorina citri psyllid: psy6190


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80-------
MKNYVEANISHKSHTTVKYAMKMLSSSSETIIFMFLGISTISDAHVCWTCDVDRPYKYVIEEVWTVRLTSMNGRSTTHLYSRSNHNR
ccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEEEHEEHHHHHHHHHHHHHHHHHEEcccccEEcccccccc
*KNYVEANISHKSHTTVKYAMKMLSSSSETIIFMFLGISTISDAHVCWTCDVDRPYKYVIEEVWTVRLTSMNGRSTTHL*S******
xxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKNYVEANISHKSHTTVKYAMKMLSSSSETIIFMFLGISTISDAHVCWTCDVDRPYKYVIEEVWTVRLTSMNGRSTTHLYSRSNHNR

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Sodium/hydrogen exchanger 1 Involved in pH regulation to eliminate acids generated by active metabolism or to counter adverse environmental conditions. Major proton extruding system driven by the inward sodium ion chemical gradient. Plays an important role in signal transduction.confidentQ28036
Probable Na(+)/H(+) antiporter nhx-9 Serves some physiological function other than regulation of cellular pH.confidentP35449
Sodium/hydrogen exchanger 1 Involved in pH regulation to eliminate acids generated by active metabolism or to counter adverse environmental conditions. Major proton extruding system driven by the inward sodium ion chemical gradient. Plays an important role in signal transduction.confidentP26431

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Templates for Structure Prediction

ID ?Alignment Graph ?Confidence Level ? View Alignment and Template ?
Query
2kbv, chain Aprobable Alignment | Template Structure