Psyllid ID: psy6191


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-----
MSQEIAIHRSLKHRNVVGFHSFFEDSKFVYIILELCRKRSMMELYNSACDLEEMSDPAAQPVIWVSKWVDYSDKYGFGYQLNDDSSGVMFNDLTRMIMLANKNTLCGTPNYIAPEILNKNGHSFEVDVWSIGCIMYTLLVGKPPFETSTLKETYSRIKKVEYKLPATLKKPAATMIKKMLLLDPVQRPPVAQLLHFEFFNDYCPTSLPASCLMTAPRFDSVVPSFNSPRRKPLMERNSKRRKAITEPETRFYMKQILEGVSYLHDHKIIHRDLKLGNLFLSDNFVVKIGDFGLAARIEFDGQRKR
cHHHHHHHHccccccccccEEEEEEcccEEEEEEccccccHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHcccEEEEccccccEEEccccccccccccccccccccccccHHccccccccccHHHHHHHHHHHHHccccccccccHHHHHHHHHcccccccccccHHHHHHHHHHccccccccccHHHHHcccccccccccccccccccccccccccccccccccccHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHccccccccccccccccccccEEEccccccccccccccccc
ccHHHHHHHHcccccEEEEEEEEEccccEEEEEEEccccHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHccEEEEEccccccEEEEccccccccccccccccccccccHHHHccccEccHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHcccEEccccccHcHHHHHHHHHcccHcccccHHHHHccccHcccccHHcccccccccccccccHccccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHccccccccccHHHEEEcccccEEEccccccEEccccccccc
MSQEIAIHRSLkhrnvvgfhsffedsKFVYIILELCRKRSMMELYNSacdleemsdpaaqpviwvskwvdysdkygfgyqlnddssgvmfNDLTRMIMLANkntlcgtpnyiapeilnknghsfeVDVWSIGCIMYTllvgkppfetstlKETYSRIKKVEyklpatlkKPAATMIKKMLlldpvqrppvaqllhfeffndycptslpasclmtaprfdsvvpsfnsprrkplmernskrrkaitepeTRFYMKQILEGVSYLHDHKIIHrdlklgnlflsdnfvvkIGDFGLAARIEFDGQRKR
msqeiaihrslkhrnvvgfhsffedskFVYIILELCRKRSMMELYNSACDLEEMSDPAAQPVIWVSKWVDYSDKYGFGYQLNDDSSGVMFNDLTRMIMLANKNTLCGTPNYIAPEILNKNGHSFEVDVWSIGCIMYTLLVGKPPFETSTLKetysrikkveyklpatlkkPAATMIKKMLLLDPVQRPPVAQLLHFEFFNDYCPTSLPASCLMTAPRfdsvvpsfnsprrkplmernskrrkaitepetrfYMKQILEGVSYLHDHKIIHRDLKLGNLFLSDNFVVKIGDFGLaariefdgqrkr
MSQEIAIHRSLKHRNVVGFHSFFEDSKFVYIILELCRKRSMMELYNSACDLEEMSDPAAQPVIWVSKWVDYSDKYGFGYQLNDDSSGVMFNDLTRMIMLANKNTLCGTPNYIAPEILNKNGHSFEVDVWSIGCIMYTLLVGKPPFETSTLKETYSRIKKVEYKLPATLKKPAATMIKKMLLLDPVQRPPVAQLLHFEFFNDYCPTSLPASCLMTAPRFDSVVPSFNSPRRKPLMERNSKRRKAITEPETRFYMKQILEGVSYLHDHKIIHRDLKLGNLFLSDNFVVKIGDFGLAARIEFDGQRKR
******IHRSLKHRNVVGFHSFFEDSKFVYIILELCRKRSMMELYNSACDLEEMSDPAAQPVIWVSKWVDYSDKYGFGYQLNDDSSGVMFNDLTRMIMLANKNTLCGTPNYIAPEILNKNGHSFEVDVWSIGCIMYTLLVGKPPFETSTLKETYSRIKKVEYKLPATLKKPAATMIKKMLLLDPVQRPPVAQLLHFEFFNDYCPTSLPASCLMTAPRFDS****************************TRFYMKQILEGVSYLHDHKIIHRDLKLGNLFLSDNFVVKIGDFGLAARIEF******
MSQEIAIHRSLKHRNVVGFHSFFEDSKFVYIILELCRKRSMMELYNSACDLEEMSDPAAQPVIWVSKWVDYSDKYGFGYQLNDDSSGVMFNDLTRMIMLANKNTLCGTPNYIAPEILNKNGHSFEVDVWSIGCIMYTLLVGKPPFETSTLKETYSRIKKVEYKLPATLKKPAATMIKKMLLLDPVQRPPVAQLLHFEFFNDYCPTSLPASCLMTAPRFDSVVPSFNSPRRKPLMERNSKRR**ITEPETRFYMKQILEGVSYLHDHKIIHRDLKLGNLFLSDNFVVKIGDFGLAA**********
MSQEIAIHRSLKHRNVVGFHSFFEDSKFVYIILELCRKRSMMELYNSACDLEEMSDPAAQPVIWVSKWVDYSDKYGFGYQLNDDSSGVMFNDLTRMIMLANKNTLCGTPNYIAPEILNKNGHSFEVDVWSIGCIMYTLLVGKPPFETSTLKETYSRIKKVEYKLPATLKKPAATMIKKMLLLDPVQRPPVAQLLHFEFFNDYCPTSLPASCLMTAPRFDSVVPSFNSPRRKPLMERNSKRRKAITEPETRFYMKQILEGVSYLHDHKIIHRDLKLGNLFLSDNFVVKIGDFGLAARIEFDGQRKR
MSQEIAIHRSLKHRNVVGFHSFFEDSKFVYIILELCRKRSMMELYNSACDLEEMSDPAAQPVIWVSKWVDYSDKYGFGYQLNDDSSGVMFNDLTRMIMLANKNTLCGTPNYIAPEILNKNGHSFEVDVWSIGCIMYTLLVGKPPFETSTLKETYSRIKKVEYKLPATLKKPAATMIKKMLLLDPVQRPPVAQLLHFEFFNDYCPTSLPASCLMTAPRFDSVVPSFNSPRRKPLMERNSKRRKAITEPETRFYMKQILEGVSYLHDHKIIHRDLKLGNLFLSDNFVVKIGDFGLAARIE*******
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSQEIAIHRSLKHRNVVGFHSFFEDSKFVYIILELCRKRSMMELYNSACDLEEMSDPAAQPVIWVSKWVDYSDKYGFGYQLNDDSSGVMFNDLTRMIMLANKNTLCGTPNYIAPEILNKNGHSFEVDVWSIGCIMYTLLVGKPPFETSTLKETYSRIKKVEYKLPATLKKPAATMIKKMLLLDPVQRPPVAQLLHFEFFNDYCPTSLPASCLMTAPRFDSVVPSFNSPRRKPLMERNSKRRKAITEPETRFYMKQILEGVSYLHDHKIIHRDLKLGNLFLSDNFVVKIGDFGLAARIEFDGQRKR
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query305 2.2.26 [Sep-21-2011]
P52304 576 Serine/threonine-protein yes N/A 0.747 0.395 0.496 2e-60
Q62673 603 Serine/threonine-protein yes N/A 0.763 0.386 0.505 4e-59
Q07832 603 Serine/threonine-protein yes N/A 0.750 0.379 0.510 6e-59
P70032 598 Serine/threonine-protein N/A N/A 0.8 0.408 0.473 1e-58
P53350 603 Serine/threonine-protein yes N/A 0.763 0.386 0.494 1e-58
Q2TA25 602 Serine/threonine-protein yes N/A 0.757 0.383 0.478 4e-58
P62205 598 Serine/threonine-protein yes N/A 0.803 0.409 0.467 7e-58
P34331 649 Serine/threonine-protein yes N/A 0.862 0.405 0.364 5e-46
Q9N2L7 632 Serine/threonine-protein no N/A 0.842 0.406 0.386 1e-45
Q86HN7 978 Probable serine/threonine yes N/A 0.750 0.234 0.396 3e-39
>sp|P52304|POLO_DROME Serine/threonine-protein kinase polo OS=Drosophila melanogaster GN=polo PE=1 SV=2 Back     alignment and function desciption
 Score =  232 bits (592), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 129/260 (49%), Positives = 161/260 (61%), Gaps = 32/260 (12%)

Query: 2   SQEIAIHRSLKHRNVVGFHSFFEDSKFVYIILELCRKRSMMELYNSACDLEEMSDPAAQP 61
           +QEI IHRSL H N+V FH++FEDS+ +YI+LELC+KRSMMEL+     + E        
Sbjct: 71  AQEITIHRSLNHPNIVKFHNYFEDSQNIYIVLELCKKRSMMELHKRRKSITEFE------ 124

Query: 62  VIWVSKWVDYSDKYGFGYQLNDDS--------SGVMFNDLTRMIM----LAN-------- 101
                ++  Y    G  Y L+D+           +  NDL  + +    LA         
Sbjct: 125 ----CRYYIYQIIQGVKY-LHDNRIIHRDLKLGNLFLNDLLHVKIGDFGLATRIEYEGER 179

Query: 102 KNTLCGTPNYIAPEILNKNGHSFEVDVWSIGCIMYTLLVGKPPFETSTLKETYSRIKKVE 161
           K TLCGTPNYIAPEIL K GHSFEVD+WSIGC+MYTLLVG+PPFET TLK+TYS+IKK E
Sbjct: 180 KKTLCGTPNYIAPEILTKKGHSFEVDIWSIGCVMYTLLVGQPPFETKTLKDTYSKIKKCE 239

Query: 162 YKLPATLKKPAATMIKKMLLLDPVQRPPVAQLLHFEFF-NDYCPTSLPASCLMTAPRFDS 220
           Y++P+ L+KPAA M+  ML  +P  RP + QLL+FEF      P  LP+SCL  APR  S
Sbjct: 240 YRVPSYLRKPAADMVIAMLQPNPESRPAIGQLLNFEFLKGSKVPMFLPSSCLTMAPRIGS 299

Query: 221 VVPSFNSPRRKPLMERNSKR 240
                +S  RKPLME N  R
Sbjct: 300 NDTIEDSMHRKPLMEMNGIR 319




May play a role in regulating both nuclear and cytoplasmic aspects of the mitotic cycle.
Drosophila melanogaster (taxid: 7227)
EC: 2EC: .EC: 7EC: .EC: 1EC: 1EC: .EC: 2EC: 1
>sp|Q62673|PLK1_RAT Serine/threonine-protein kinase PLK1 OS=Rattus norvegicus GN=Plk1 PE=2 SV=2 Back     alignment and function description
>sp|Q07832|PLK1_MOUSE Serine/threonine-protein kinase PLK1 OS=Mus musculus GN=Plk1 PE=1 SV=2 Back     alignment and function description
>sp|P70032|PLK1_XENLA Serine/threonine-protein kinase PLK1 OS=Xenopus laevis GN=plk1 PE=1 SV=1 Back     alignment and function description
>sp|P53350|PLK1_HUMAN Serine/threonine-protein kinase PLK1 OS=Homo sapiens GN=PLK1 PE=1 SV=1 Back     alignment and function description
>sp|Q2TA25|PLK1_BOVIN Serine/threonine-protein kinase PLK1 OS=Bos taurus GN=PLK1 PE=2 SV=2 Back     alignment and function description
>sp|P62205|PLK1_XENTR Serine/threonine-protein kinase PLK1 OS=Xenopus tropicalis GN=plk1 PE=2 SV=1 Back     alignment and function description
>sp|P34331|PLK1_CAEEL Serine/threonine-protein kinase plk-1 OS=Caenorhabditis elegans GN=plk-1 PE=1 SV=3 Back     alignment and function description
>sp|Q9N2L7|PLK2_CAEEL Serine/threonine-protein kinase plk-2 OS=Caenorhabditis elegans GN=plk-2 PE=2 SV=1 Back     alignment and function description
>sp|Q86HN7|PLK_DICDI Probable serine/threonine-protein kinase PLK OS=Dictyostelium discoideum GN=PLK PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query305
332017215 574 Serine/threonine-protein kinase polo [Ac 0.760 0.404 0.534 1e-61
307182687 544 Serine/threonine-protein kinase polo [Ca 0.767 0.430 0.522 2e-61
328704669 578 PREDICTED: serine/threonine-protein kina 0.813 0.429 0.498 3e-61
193624934 580 PREDICTED: serine/threonine-protein kina 0.803 0.422 0.5 3e-60
312380567 574 hypothetical protein AND_07357 [Anophele 0.773 0.411 0.522 5e-60
291221901 598 PREDICTED: polo-like kinase 1-like [Sacc 0.763 0.389 0.494 1e-59
209946076369 polo [Drosophila yakuba] 0.747 0.617 0.496 6e-59
195495958 651 GE19659 [Drosophila yakuba] gi|194181591 0.747 0.350 0.496 7e-59
209946078369 polo [Drosophila simulans] gi|209946082| 0.747 0.617 0.496 8e-59
24667346 576 polo, isoform A [Drosophila melanogaster 0.747 0.395 0.496 1e-58
>gi|332017215|gb|EGI58003.1| Serine/threonine-protein kinase polo [Acromyrmex echinatior] Back     alignment and taxonomy information
 Score =  242 bits (618), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 133/249 (53%), Positives = 164/249 (65%), Gaps = 17/249 (6%)

Query: 1   MSQEIAIHRSLKHRNVVGFHSFFEDSKFVYIILELCRKRSMMELYN-----SACDLEEMS 55
           M+QEIAIH+SL HR++VGFH FF+D+K +YIILELCRKRSMMEL+      S C+     
Sbjct: 68  MTQEIAIHQSLNHRHIVGFHGFFDDNKNIYIILELCRKRSMMELHKRRKALSECETRYFM 127

Query: 56  DPAAQPVIWV--SKWVDYSDKYGFGYQLNDDSSGVMFNDLTRMIMLAN----KNTLCGTP 109
                 V ++  +K +    K G  + LNDD   V   D      L +    K T+CGTP
Sbjct: 128 KQILDGVFYLHQNKIIHRDLKLGNLF-LNDDLQ-VKIGDFGLAAKLVHDGERKKTVCGTP 185

Query: 110 NYIAPEILNKNGHSFEVDVWSIGCIMYTLLVGKPPFETSTLKETYSRIKKVEYKLPATLK 169
           NYIAPE+L K GHS+E D+WSIGCIMYTLLVGKPPFETS+LKETYSRIK+V+YK P  + 
Sbjct: 186 NYIAPEVLTKIGHSYEADIWSIGCIMYTLLVGKPPFETSSLKETYSRIKQVQYKTPQHIS 245

Query: 170 KPAATMIKKMLLLDPVQRPPVAQLLHFEFF-NDYCPTSLPASCLMTAPRFDSVVPSFNSP 228
           KPA  M+  ML L+P +RP VA+L+   FF + Y PTSLP SCL  APR D +    N  
Sbjct: 246 KPAMNMVANMLQLNPSKRPSVARLMRDTFFTSGYMPTSLPLSCLTMAPRLDMLESHCN-- 303

Query: 229 RRKPLMERN 237
            R+PL E N
Sbjct: 304 -RRPLGEMN 311




Source: Acromyrmex echinatior

Species: Acromyrmex echinatior

Genus: Acromyrmex

Family: Formicidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|307182687|gb|EFN69812.1| Serine/threonine-protein kinase polo [Camponotus floridanus] Back     alignment and taxonomy information
>gi|328704669|ref|XP_003242563.1| PREDICTED: serine/threonine-protein kinase polo-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|193624934|ref|XP_001949406.1| PREDICTED: serine/threonine-protein kinase polo-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|312380567|gb|EFR26525.1| hypothetical protein AND_07357 [Anopheles darlingi] Back     alignment and taxonomy information
>gi|291221901|ref|XP_002730953.1| PREDICTED: polo-like kinase 1-like [Saccoglossus kowalevskii] Back     alignment and taxonomy information
>gi|209946076|gb|ACI97269.1| polo [Drosophila yakuba] Back     alignment and taxonomy information
>gi|195495958|ref|XP_002095490.1| GE19659 [Drosophila yakuba] gi|194181591|gb|EDW95202.1| GE19659 [Drosophila yakuba] Back     alignment and taxonomy information
>gi|209946078|gb|ACI97270.1| polo [Drosophila simulans] gi|209946082|gb|ACI97272.1| polo [Drosophila melanogaster] gi|209946084|gb|ACI97273.1| polo [Drosophila simulans] gi|209946086|gb|ACI97274.1| polo [Drosophila simulans] gi|209946088|gb|ACI97275.1| polo [Drosophila simulans] gi|209946090|gb|ACI97276.1| polo [Drosophila simulans] gi|209946092|gb|ACI97277.1| polo [Drosophila melanogaster] gi|209946094|gb|ACI97278.1| polo [Drosophila melanogaster] gi|209946096|gb|ACI97279.1| polo [Drosophila melanogaster] gi|209946098|gb|ACI97280.1| polo [Drosophila melanogaster] gi|209946100|gb|ACI97281.1| polo [Drosophila melanogaster] gi|209946102|gb|ACI97282.1| polo [Drosophila melanogaster] gi|209946104|gb|ACI97283.1| polo [Drosophila melanogaster] gi|209946106|gb|ACI97284.1| polo [Drosophila melanogaster] gi|209946108|gb|ACI97285.1| polo [Drosophila melanogaster] gi|209946110|gb|ACI97286.1| polo [Drosophila melanogaster] gi|209946112|gb|ACI97287.1| polo [Drosophila melanogaster] gi|209946114|gb|ACI97288.1| polo [Drosophila melanogaster] gi|209946116|gb|ACI97289.1| polo [Drosophila melanogaster] gi|209946118|gb|ACI97290.1| polo [Drosophila melanogaster] gi|209946120|gb|ACI97291.1| polo [Drosophila melanogaster] gi|209946122|gb|ACI97292.1| polo [Drosophila melanogaster] gi|209946124|gb|ACI97293.1| polo [Drosophila melanogaster] gi|209946126|gb|ACI97294.1| polo [Drosophila melanogaster] gi|209946128|gb|ACI97295.1| polo [Drosophila melanogaster] gi|209946130|gb|ACI97296.1| polo [Drosophila melanogaster] gi|209946132|gb|ACI97297.1| polo [Drosophila melanogaster] gi|209946136|gb|ACI97299.1| polo [Drosophila melanogaster] gi|209946138|gb|ACI97300.1| polo [Drosophila melanogaster] gi|209946140|gb|ACI97301.1| polo [Drosophila melanogaster] gi|209946142|gb|ACI97302.1| polo [Drosophila melanogaster] gi|209946144|gb|ACI97303.1| polo [Drosophila melanogaster] gi|209946146|gb|ACI97304.1| polo [Drosophila melanogaster] gi|209946148|gb|ACI97305.1| polo [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|24667346|ref|NP_524179.2| polo, isoform A [Drosophila melanogaster] gi|62472270|ref|NP_001014592.1| polo, isoform B [Drosophila melanogaster] gi|195348197|ref|XP_002040637.1| GM22270 [Drosophila sechellia] gi|14286167|sp|P52304.2|POLO_DROME RecName: Full=Serine/threonine-protein kinase polo gi|7293666|gb|AAF49036.1| polo, isoform A [Drosophila melanogaster] gi|20151993|gb|AAM11356.1| LD11851p [Drosophila melanogaster] gi|61678452|gb|AAX52738.1| polo, isoform B [Drosophila melanogaster] gi|194122147|gb|EDW44190.1| GM22270 [Drosophila sechellia] gi|220943094|gb|ACL84090.1| polo-PA [synthetic construct] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query305
UNIPROTKB|E2RNE0 551 PLK1 "Uncharacterized protein" 0.786 0.435 0.5 7.5e-57
UNIPROTKB|J9P0Q4 606 PLK1 "Uncharacterized protein" 0.786 0.396 0.5 7.5e-57
FB|FBgn0003124 576 polo "polo" [Drosophila melano 0.836 0.442 0.481 1.2e-56
RGD|3352 603 Plk1 "polo-like kinase 1" [Rat 0.757 0.383 0.517 2e-56
MGI|MGI:97621 603 Plk1 "polo-like kinase 1" [Mus 0.757 0.383 0.517 2.5e-56
UNIPROTKB|P53350 603 PLK1 "Serine/threonine-protein 0.786 0.398 0.5 3.3e-56
UNIPROTKB|P70032 598 plk1 "Serine/threonine-protein 0.793 0.404 0.496 5.3e-56
UNIPROTKB|Q2TA25 602 PLK1 "Serine/threonine-protein 0.786 0.398 0.496 1.4e-55
UNIPROTKB|P62205 598 plk1 "Serine/threonine-protein 0.796 0.406 0.490 1.8e-55
ZFIN|ZDB-GENE-021115-7 595 plk1 "polo-like kinase 1 (Dros 0.767 0.393 0.517 9.9e-55
UNIPROTKB|E2RNE0 PLK1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
 Score = 585 (211.0 bits), Expect = 7.5e-57, P = 7.5e-57
 Identities = 131/262 (50%), Positives = 170/262 (64%)

Query:     1 MSQEIAIHRSLKHRNVVGFHSFFEDSKFVYIILELCRKRSMMELYNSACDLEEMSDPAAQ 60
             MS EI+IHRSL H+++VGFH FFEDS FV+++LELCR+RS++EL+      + +++P A+
Sbjct:    98 MSMEISIHRSLAHQHIVGFHGFFEDSDFVFVVLELCRRRSLLELHKRR---KALTEPEAR 154

Query:    61 ----PVIWVSKW-----VDYSD-KYGFGYQLNDDSSGVMFND--LTRMIML--ANKNTLC 106
                  ++   ++     V + D K G  + LN+D   V   D  L   +      K TLC
Sbjct:   155 YYLRQIVLGCQYLHRNRVIHRDLKLGNLF-LNEDLE-VKIGDFGLATKVEYDGERKKTLC 212

Query:   107 GTPNYIAPEILNKNGHSFEVDVWSIGCIMYTLLVGKPPFETSTLKETYSRIKKVEYKLPA 166
             GTPNYIAPE+L+K GHSFEVDVWSIGCIMYTLLVGKPPFETS LKETY RIKK +Y +P 
Sbjct:   213 GTPNYIAPEVLSKKGHSFEVDVWSIGCIMYTLLVGKPPFETSCLKETYLRIKKNDYSIPK 272

Query:   167 TLKKPAATMIKKMLLLDPVQRPPVAQLLHFEFFND-YCPTSLPASCLMTAPRFDSVVPSF 225
              +   AA++I+KML  DP  RP + +LL+ EFF   Y P  LP +CL  APRF S+ PS 
Sbjct:   273 HINPVAASLIQKMLQTDPAARPTIHELLNDEFFTSGYIPARLPITCLTIAPRF-SIAPSS 331

Query:   226 NSP-RRKPLMERNSKRRKAITE 246
               P  RKPL   N      ++E
Sbjct:   332 LDPSNRKPLTVLNKGTENPMSE 353


GO:0005524 "ATP binding" evidence=IEA
GO:0004674 "protein serine/threonine kinase activity" evidence=IEA
UNIPROTKB|J9P0Q4 PLK1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
FB|FBgn0003124 polo "polo" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
RGD|3352 Plk1 "polo-like kinase 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
MGI|MGI:97621 Plk1 "polo-like kinase 1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|P53350 PLK1 "Serine/threonine-protein kinase PLK1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|P70032 plk1 "Serine/threonine-protein kinase PLK1" [Xenopus laevis (taxid:8355)] Back     alignment and assigned GO terms
UNIPROTKB|Q2TA25 PLK1 "Serine/threonine-protein kinase PLK1" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|P62205 plk1 "Serine/threonine-protein kinase PLK1" [Xenopus (Silurana) tropicalis (taxid:8364)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-021115-7 plk1 "polo-like kinase 1 (Drosophila)" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q07832PLK1_MOUSE2, ., 7, ., 1, 1, ., 2, 10.51010.75080.3797yesN/A
Q62673PLK1_RAT2, ., 7, ., 1, 1, ., 2, 10.50590.76390.3864yesN/A

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer2.7.110.691

Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query305
smart00220254 smart00220, S_TKc, Serine/Threonine protein kinase 5e-38
pfam00069260 pfam00069, Pkinase, Protein kinase domain 1e-30
cd05123250 cd05123, STKc_AGC, Catalytic domain of AGC family 1e-26
cd08215258 cd08215, STKc_Nek, Catalytic domain of the Protein 3e-26
smart00220254 smart00220, S_TKc, Serine/Threonine protein kinase 3e-24
cd05581280 cd05581, STKc_PDK1, Catalytic domain of the Protei 2e-23
cd1311891 cd13118, POLO_box_1, First polo-box domain (PBD) o 6e-23
cd05572262 cd05572, STKc_cGK_PKG, Catalytic domain of the Pro 2e-22
cd06606 260 cd06606, STKc_MAPKKK, Catalytic domain of the Prot 3e-22
cd05579265 cd05579, STKc_MAST_like, Catalytic domain of Micro 9e-22
pfam00069 260 pfam00069, Pkinase, Protein kinase domain 3e-21
cd05122253 cd05122, PKc_STE, Catalytic domain of STE family P 1e-20
cd07829 282 cd07829, STKc_CDK_like, Catalytic domain of Cyclin 7e-20
cd07840 287 cd07840, STKc_CDK9_like, Catalytic domain of Cycli 1e-19
cd08530256 cd08530, STKc_CNK2-like, Catalytic domain of the P 6e-19
cd06627254 cd06627, STKc_Cdc7_like, Catalytic domain of Cell 9e-19
cd00180215 cd00180, PKc, Catalytic domain of Protein Kinases 3e-18
cd00180215 cd00180, PKc, Catalytic domain of Protein Kinases 3e-18
cd05584323 cd05584, STKc_p70S6K, Catalytic domain of the Prot 5e-18
cd05580290 cd05580, STKc_PKA, Catalytic domain of the Protein 7e-18
cd08217265 cd08217, STKc_Nek2, Catalytic domain of the Protei 7e-18
cd05612291 cd05612, STKc_PRKX_like, Catalytic domain of PRKX- 9e-18
cd07832 286 cd07832, STKc_CCRK, Catalytic domain of the Serine 6e-17
cd08215258 cd08215, STKc_Nek, Catalytic domain of the Protein 9e-17
cd05570318 cd05570, STKc_PKC, Catalytic domain of the Protein 1e-16
PTZ00263329 PTZ00263, PTZ00263, protein kinase A catalytic sub 1e-16
cd05122253 cd05122, PKc_STE, Catalytic domain of STE family P 4e-16
cd07843 293 cd07843, STKc_CDC2L1, Catalytic domain of the Seri 4e-16
cd06606260 cd06606, STKc_MAPKKK, Catalytic domain of the Prot 6e-16
cd07845 309 cd07845, STKc_CDK10, Catalytic domain of the Serin 7e-16
cd05573350 cd05573, STKc_ROCK_NDR_like, Catalytic domain of R 8e-16
cd05600333 cd05600, STKc_Sid2p_Dbf2p, Catalytic domain of Fun 1e-15
cd05611260 cd05611, STKc_Rim15_like, Catalytic domain of fung 1e-15
cd05574316 cd05574, STKc_phototropin_like, Catalytic domain o 3e-15
COG0515384 COG0515, SPS1, Serine/threonine protein kinase [Ge 3e-15
cd05599364 cd05599, STKc_NDR_like, Catalytic domain of Nuclea 3e-15
cd05591321 cd05591, STKc_nPKC_epsilon, Catalytic domain of th 5e-15
cd07866 311 cd07866, STKc_BUR1, Catalytic domain of the Serine 6e-15
cd06626 264 cd06626, STKc_MEKK4, Catalytic domain of the Prote 9e-15
cd07830 283 cd07830, STKc_MAK_like, Catalytic domain of Male g 1e-14
cd06624268 cd06624, STKc_ASK, Catalytic domain of the Protein 2e-14
cd05598376 cd05598, STKc_LATS, Catalytic domain of the Protei 2e-14
cd07841 298 cd07841, STKc_CDK7, Catalytic domain of the Serine 2e-14
smart00219257 smart00219, TyrKc, Tyrosine kinase, catalytic doma 2e-14
cd06625 263 cd06625, STKc_MEKK3_like, Catalytic domain of MAP/ 3e-14
cd05592316 cd05592, STKc_nPKC_theta_delta, Catalytic domain o 3e-14
cd06611 280 cd06611, STKc_SLK_like, Catalytic domain of Ste20- 3e-14
cd05585312 cd05585, STKc_YPK1_like, Catalytic domain of Yeast 4e-14
cd05594325 cd05594, STKc_PKB_alpha, Catalytic domain of the P 5e-14
cd05123250 cd05123, STKc_AGC, Catalytic domain of AGC family 6e-14
cd05578258 cd05578, STKc_Yank1, Catalytic domain of the Prote 6e-14
smart00221258 smart00221, STYKc, Protein kinase; unclassified sp 6e-14
cd05582318 cd05582, STKc_RSK_N, N-terminal catalytic domain o 8e-14
cd05593328 cd05593, STKc_PKB_gamma, Catalytic domain of the P 9e-14
cd06623 264 cd06623, PKc_MAPKK_plant_like, Catalytic domain of 1e-13
cd05571323 cd05571, STKc_PKB, Catalytic domain of the Protein 1e-13
cd06632258 cd06632, STKc_MEKK1_plant, Catalytic domain of the 1e-13
cd05620316 cd05620, STKc_nPKC_delta, Catalytic domain of the 1e-13
cd05629377 cd05629, STKc_NDR_like_fungal, Catalytic domain of 1e-13
cd05583288 cd05583, STKc_MSK_N, N-terminal catalytic domain o 2e-13
cd06631 265 cd06631, STKc_YSK4, Catalytic domain of the Protei 2e-13
cd05595323 cd05595, STKc_PKB_beta, Catalytic domain of the Pr 2e-13
cd05587324 cd05587, STKc_cPKC, Catalytic domain of the Protei 2e-13
cd05118 283 cd05118, STKc_CMGC, Catalytic domain of CMGC famil 2e-13
cd07829282 cd07829, STKc_CDK_like, Catalytic domain of Cyclin 3e-13
cd05615323 cd05615, STKc_cPKC_alpha, Catalytic domain of the 3e-13
cd06610 267 cd06610, STKc_OSR1_SPAK, Catalytic domain of the P 3e-13
cd05588329 cd05588, STKc_aPKC, Catalytic domain of the Protei 3e-13
cd06632258 cd06632, STKc_MEKK1_plant, Catalytic domain of the 4e-13
pfam07714258 pfam07714, Pkinase_Tyr, Protein tyrosine kinase 4e-13
cd05619316 cd05619, STKc_nPKC_theta, Catalytic domain of the 4e-13
cd06610267 cd06610, STKc_OSR1_SPAK, Catalytic domain of the P 5e-13
cd05590320 cd05590, STKc_nPKC_eta, Catalytic domain of the Pr 5e-13
cd06612256 cd06612, STKc_MST1_2, Catalytic domain of the Prot 6e-13
cd05581 280 cd05581, STKc_PDK1, Catalytic domain of the Protei 7e-13
cd06612256 cd06612, STKc_MST1_2, Catalytic domain of the Prot 7e-13
cd08221256 cd08221, STKc_Nek9, Catalytic domain of the Protei 7e-13
cd05614332 cd05614, STKc_MSK2_N, N-terminal catalytic domain 8e-13
cd05609305 cd05609, STKc_MAST, Catalytic domain of the Protei 8e-13
cd08530256 cd08530, STKc_CNK2-like, Catalytic domain of the P 1e-12
cd06625263 cd06625, STKc_MEKK3_like, Catalytic domain of MAP/ 1e-12
cd07834 330 cd07834, STKc_MAPK, Catalytic domain of the Serine 1e-12
cd05617327 cd05617, STKc_aPKC_zeta, Catalytic domain of the P 1e-12
PTZ00267478 PTZ00267, PTZ00267, NIMA-related protein kinase; P 2e-12
cd00192262 cd00192, PTKc, Catalytic domain of Protein Tyrosin 2e-12
cd08529256 cd08529, STKc_FA2-like, Catalytic domain of the Pr 2e-12
PHA03209 357 PHA03209, PHA03209, serine/threonine kinase US3; P 2e-12
cd05618329 cd05618, STKc_aPKC_iota, Catalytic domain of the P 2e-12
cd05602325 cd05602, STKc_SGK1, Catalytic domain of the Protei 2e-12
cd05616323 cd05616, STKc_cPKC_beta, Catalytic domain of the P 3e-12
cd06626264 cd06626, STKc_MEKK4, Catalytic domain of the Prote 4e-12
cd08223257 cd08223, STKc_Nek4, Catalytic domain of the Protei 4e-12
cd08225257 cd08225, STKc_Nek5, Catalytic domain of the Protei 4e-12
cd05589 324 cd05589, STKc_PKN, Catalytic domain of the Protein 5e-12
cd06643 282 cd06643, STKc_SLK, Catalytic domain of the Protein 6e-12
cd08220256 cd08220, STKc_Nek8, Catalytic domain of the Protei 6e-12
cd06627254 cd06627, STKc_Cdc7_like, Catalytic domain of Cell 7e-12
cd06653264 cd06653, STKc_MEKK3_like_1, Catalytic domain of MA 7e-12
cd07853 372 cd07853, STKc_NLK, Catalytic domain of the Serine/ 7e-12
cd06608 275 cd06608, STKc_myosinIII_like, Catalytic domain of 7e-12
PTZ00283496 PTZ00283, PTZ00283, serine/threonine protein kinas 8e-12
cd05628363 cd05628, STKc_NDR1, Catalytic domain of the Protei 9e-12
cd08219255 cd08219, STKc_Nek3, Catalytic domain of the Protei 9e-12
cd05625382 cd05625, STKc_LATS1, Catalytic domain of the Prote 9e-12
cd05589324 cd05589, STKc_PKN, Catalytic domain of the Protein 1e-11
cd06629 272 cd06629, STKc_MAPKKK_Bck1_like, Catalytic domain o 1e-11
cd08224267 cd08224, STKc_Nek6_Nek7, Catalytic domain of the P 1e-11
cd06614286 cd06614, STKc_PAK, Catalytic domain of the Protein 1e-11
cd05613290 cd05613, STKc_MSK1_N, N-terminal catalytic domain 1e-11
cd07838 287 cd07838, STKc_CDK4_6_like, Catalytic domain of Cyc 1e-11
cd06614 286 cd06614, STKc_PAK, Catalytic domain of the Protein 2e-11
cd05603321 cd05603, STKc_SGK2, Catalytic domain of the Protei 2e-11
PTZ00426340 PTZ00426, PTZ00426, cAMP-dependent protein kinase 2e-11
cd05575323 cd05575, STKc_SGK, Catalytic domain of the Protein 2e-11
cd07855 334 cd07855, STKc_ERK5, Catalytic domain of the Serine 2e-11
cd06609 274 cd06609, STKc_MST3_like, Catalytic domain of Mamma 2e-11
cd08222260 cd08222, STKc_Nek11, Catalytic domain of the Prote 2e-11
cd05626381 cd05626, STKc_LATS2, Catalytic domain of the Prote 2e-11
cd06652 265 cd06652, STKc_MEKK2, Catalytic domain of the Prote 2e-11
cd05596370 cd05596, STKc_ROCK, Catalytic domain of the Protei 3e-11
cd06651 266 cd06651, STKc_MEKK3, Catalytic domain of the Prote 3e-11
cd05627360 cd05627, STKc_NDR2, Catalytic domain of the Protei 3e-11
cd05148261 cd05148, PTKc_Srm_Brk, Catalytic domain of the Pro 3e-11
cd06644 292 cd06644, STKc_STK10_LOK, Catalytic domain of the P 4e-11
cd06648285 cd06648, STKc_PAK_II, Catalytic domain of the Prot 4e-11
cd06607 307 cd06607, STKc_TAO, Catalytic domain of the Protein 4e-11
cd05579 265 cd05579, STKc_MAST_like, Catalytic domain of Micro 5e-11
cd06624 268 cd06624, STKc_ASK, Catalytic domain of the Protein 5e-11
cd05610669 cd05610, STKc_MASTL, Catalytic domain of the Prote 5e-11
cd06659297 cd06659, STKc_PAK6, Catalytic domain of the Protei 6e-11
cd07865 310 cd07865, STKc_CDK9, Catalytic domain of the Serine 7e-11
cd06630268 cd06630, STKc_MEKK1, Catalytic domain of the Prote 9e-11
COG0515 384 COG0515, SPS1, Serine/threonine protein kinase [Ge 1e-10
cd06631265 cd06631, STKc_YSK4, Catalytic domain of the Protei 1e-10
cd07842 316 cd07842, STKc_CDK8_like, Catalytic domain of Cycli 1e-10
cd06628 267 cd06628, STKc_MAPKKK_Byr2_like, Catalytic domain o 1e-10
cd07835 283 cd07835, STKc_CDK1_like, Catalytic domain of Cycli 1e-10
PTZ00024 335 PTZ00024, PTZ00024, cyclin-dependent protein kinas 1e-10
cd05577277 cd05577, STKc_GRK, Catalytic domain of the Protein 2e-10
cd05604325 cd05604, STKc_SGK3, Catalytic domain of the Protei 2e-10
cd05571 323 cd05571, STKc_PKB, Catalytic domain of the Protein 3e-10
cd06613 262 cd06613, STKc_MAP4K3_like, Catalytic domain of Mit 3e-10
cd05630285 cd05630, STKc_GRK6, Catalytic domain of the Protei 3e-10
cd05572 262 cd05572, STKc_cGK_PKG, Catalytic domain of the Pro 4e-10
cd07833 288 cd07833, STKc_CDKL, Catalytic domain of Cyclin-Dep 4e-10
cd07858 337 cd07858, STKc_TEY_MAPK_plant, Catalytic domain of 4e-10
cd05608 280 cd05608, STKc_GRK1, Catalytic domain of the Protei 4e-10
cd05605285 cd05605, STKc_GRK4_like, Catalytic domain of G pro 4e-10
cd07854 342 cd07854, STKc_MAPK4_6, Catalytic domain of the Ser 4e-10
cd05580 290 cd05580, STKc_PKA, Catalytic domain of the Protein 5e-10
cd07833288 cd07833, STKc_CDKL, Catalytic domain of Cyclin-Dep 5e-10
cd07851 343 cd07851, STKc_p38, Catalytic domain of the Serine/ 5e-10
cd05570 318 cd05570, STKc_PKC, Catalytic domain of the Protein 6e-10
cd06613262 cd06613, STKc_MAP4K3_like, Catalytic domain of Mit 7e-10
cd05118283 cd05118, STKc_CMGC, Catalytic domain of CMGC famil 8e-10
cd08222260 cd08222, STKc_Nek11, Catalytic domain of the Prote 9e-10
cd07836 284 cd07836, STKc_Pho85, Catalytic domain of the Serin 9e-10
cd05578258 cd05578, STKc_Yank1, Catalytic domain of the Prote 1e-09
cd08221256 cd08221, STKc_Nek9, Catalytic domain of the Protei 1e-09
cd08529256 cd08529, STKc_FA2-like, Catalytic domain of the Pr 1e-09
cd05632285 cd05632, STKc_GRK5, Catalytic domain of the Protei 1e-09
cd08228267 cd08228, STKc_Nek6, Catalytic domain of the Protei 1e-09
pfam0065964 pfam00659, POLO_box, POLO box duplicated region 1e-09
cd06657292 cd06657, STKc_PAK4, Catalytic domain of the Protei 1e-09
cd08217265 cd08217, STKc_Nek2, Catalytic domain of the Protei 2e-09
cd07846 286 cd07846, STKc_CDKL2_3, Catalytic domain of the Ser 2e-09
cd06642277 cd06642, STKc_STK25-YSK1, Catalytic domain of the 2e-09
PHA03210 501 PHA03210, PHA03210, serine/threonine kinase US3; P 2e-09
cd07861 285 cd07861, STKc_CDK1_euk, Catalytic domain of the Se 2e-09
cd06609274 cd06609, STKc_MST3_like, Catalytic domain of Mamma 3e-09
cd06628267 cd06628, STKc_MAPKKK_Byr2_like, Catalytic domain o 3e-09
cd07851343 cd07851, STKc_p38, Catalytic domain of the Serine/ 3e-09
cd08229267 cd08229, STKc_Nek7, Catalytic domain of the Protei 3e-09
cd05601330 cd05601, STKc_CRIK, Catalytic domain of the Protei 3e-09
cd07840287 cd07840, STKc_CDK9_like, Catalytic domain of Cycli 4e-09
cd07860 284 cd07860, STKc_CDK2_3, Catalytic domain of the Seri 4e-09
cd05034261 cd05034, PTKc_Src_like, Catalytic domain of Src ki 4e-09
cd05032277 cd05032, PTKc_InsR_like, Catalytic domain of Insul 4e-09
cd08528269 cd08528, STKc_Nek10, Catalytic domain of the Prote 4e-09
cd07844 291 cd07844, STKc_PCTAIRE_like, Catalytic domain of PC 4e-09
cd05621370 cd05621, STKc_ROCK2, Catalytic domain of the Prote 5e-09
cd05631285 cd05631, STKc_GRK4, Catalytic domain of the Protei 6e-09
cd05593 328 cd05593, STKc_PKB_gamma, Catalytic domain of the P 7e-09
cd06658292 cd06658, STKc_PAK5, Catalytic domain of the Protei 7e-09
cd05623332 cd05623, STKc_MRCK_alpha, Catalytic domain of the 7e-09
cd05622371 cd05622, STKc_ROCK1, Catalytic domain of the Prote 7e-09
cd07852 337 cd07852, STKc_MAPK15, Catalytic domain of the Seri 7e-09
cd06630268 cd06630, STKc_MEKK1, Catalytic domain of the Prote 8e-09
cd05597331 cd05597, STKc_DMPK_like, Catalytic domain of Myoto 8e-09
cd06611280 cd06611, STKc_SLK_like, Catalytic domain of Ste20- 9e-09
PTZ00266 1021 PTZ00266, PTZ00266, NIMA-related protein kinase; P 9e-09
cd08225257 cd08225, STKc_Nek5, Catalytic domain of the Protei 1e-08
cd05148261 cd05148, PTKc_Srm_Brk, Catalytic domain of the Pro 1e-08
cd06648 285 cd06648, STKc_PAK_II, Catalytic domain of the Prot 1e-08
cd05080 283 cd05080, PTKc_Tyk2_rpt2, Catalytic (repeat 2) doma 1e-08
cd05054 337 cd05054, PTKc_VEGFR, Catalytic domain of the Prote 1e-08
cd05038 284 cd05038, PTKc_Jak_rpt2, Catalytic (repeat 2) domai 1e-08
cd06637 272 cd06637, STKc_TNIK, Catalytic domain of the Protei 1e-08
cd05595 323 cd05595, STKc_PKB_beta, Catalytic domain of the Pr 2e-08
cd05587 324 cd05587, STKc_cPKC, Catalytic domain of the Protei 2e-08
cd08224 267 cd08224, STKc_Nek6_Nek7, Catalytic domain of the P 2e-08
cd07839 284 cd07839, STKc_CDK5, Catalytic domain of the Serine 2e-08
cd06640 277 cd06640, STKc_MST4, Catalytic domain of the Protei 2e-08
cd05053 293 cd05053, PTKc_FGFR, Catalytic domain of the Protei 2e-08
cd07864 302 cd07864, STKc_CDK12, Catalytic domain of the Serin 2e-08
cd06634 308 cd06634, STKc_TAO2, Catalytic domain of the Protei 2e-08
cd07830283 cd07830, STKc_MAK_like, Catalytic domain of Male g 3e-08
cd06623264 cd06623, PKc_MAPKK_plant_like, Catalytic domain of 3e-08
cd05050288 cd05050, PTKc_Musk, Catalytic domain of the Protei 3e-08
cd05577 277 cd05577, STKc_GRK, Catalytic domain of the Protein 4e-08
cd07880343 cd07880, STKc_p38gamma_MAPK12, Catalytic domain of 4e-08
cd06636 282 cd06636, STKc_MAP4K4_6, Catalytic domain of the Pr 4e-08
cd05590 320 cd05590, STKc_nPKC_eta, Catalytic domain of the Pr 5e-08
cd07880 343 cd07880, STKc_p38gamma_MAPK12, Catalytic domain of 5e-08
cd07871 288 cd07871, STKc_PCTAIRE3, Catalytic domain of the Se 5e-08
cd06645 267 cd06645, STKc_MAP4K3, Catalytic domain of the Prot 5e-08
cd06641 277 cd06641, STKc_MST3, Catalytic domain of the Protei 5e-08
cd07856 328 cd07856, STKc_Sty1_Hog1, Catalytic domain of the S 5e-08
cd06646 267 cd06646, STKc_MAP4K5, Catalytic domain of the Prot 5e-08
cd05600 333 cd05600, STKc_Sid2p_Dbf2p, Catalytic domain of Fun 6e-08
cd05624331 cd05624, STKc_MRCK_beta, Catalytic domain of the P 6e-08
cd05615 323 cd05615, STKc_cPKC_alpha, Catalytic domain of the 7e-08
cd06621 287 cd06621, PKc_MAPKK_Pek1_like, Catalytic domain of 7e-08
cd05575 323 cd05575, STKc_SGK, Catalytic domain of the Protein 8e-08
cd07857 332 cd07857, STKc_MPK1, Catalytic domain of the Serine 8e-08
cd05586330 cd05586, STKc_Sck1_like, Catalytic domain of Suppr 8e-08
cd07852337 cd07852, STKc_MAPK15, Catalytic domain of the Seri 9e-08
cd05040 257 cd05040, PTKc_Ack_like, Catalytic domain of the Pr 9e-08
cd05610 669 cd05610, STKc_MASTL, Catalytic domain of the Prote 1e-07
cd08218256 cd08218, STKc_Nek1, Catalytic domain of the Protei 1e-07
cd07849 336 cd07849, STKc_ERK1_2_like, Catalytic domain of Ext 1e-07
cd07831 282 cd07831, STKc_MOK, Catalytic domain of the Serine/ 1e-07
PLN00034 353 PLN00034, PLN00034, mitogen-activated protein kina 1e-07
cd07877 345 cd07877, STKc_p38alpha_MAPK14, Catalytic domain of 1e-07
cd05591 321 cd05591, STKc_nPKC_epsilon, Catalytic domain of th 2e-07
cd07834330 cd07834, STKc_MAPK, Catalytic domain of the Serine 2e-07
cd08219255 cd08219, STKc_Nek3, Catalytic domain of the Protei 2e-07
cd06651266 cd06651, STKc_MEKK3, Catalytic domain of the Prote 2e-07
cd06642 277 cd06642, STKc_STK25-YSK1, Catalytic domain of the 2e-07
cd06641277 cd06641, STKc_MST3, Catalytic domain of the Protei 2e-07
cd06646267 cd06646, STKc_MAP4K5, Catalytic domain of the Prot 2e-07
cd06917 277 cd06917, STKc_NAK1_like, Catalytic domain of Funga 2e-07
cd07847 286 cd07847, STKc_CDKL1_4, Catalytic domain of the Ser 2e-07
cd07870 291 cd07870, STKc_PFTAIRE2, Catalytic domain of the Se 2e-07
cd07869 303 cd07869, STKc_PFTAIRE1, Catalytic domain of the Se 2e-07
PHA03390267 PHA03390, pk1, serine/threonine-protein kinase 1; 2e-07
cd07879 342 cd07879, STKc_p38delta_MAPK13, Catalytic domain of 2e-07
cd05599 364 cd05599, STKc_NDR_like, Catalytic domain of Nuclea 3e-07
cd05592 316 cd05592, STKc_nPKC_theta_delta, Catalytic domain o 3e-07
cd06652265 cd06652, STKc_MEKK2, Catalytic domain of the Prote 3e-07
cd07846286 cd07846, STKc_CDKL2_3, Catalytic domain of the Ser 3e-07
cd06645267 cd06645, STKc_MAP4K3, Catalytic domain of the Prot 3e-07
cd08218256 cd08218, STKc_Nek1, Catalytic domain of the Protei 3e-07
cd06635 317 cd06635, STKc_TAO1, Catalytic domain of the Protei 3e-07
PLN00009 294 PLN00009, PLN00009, cyclin-dependent kinase A; Pro 3e-07
cd06633 313 cd06633, STKc_TAO3, Catalytic domain of the Protei 3e-07
cd05039256 cd05039, PTKc_Csk_like, Catalytic domain of C-term 3e-07
cd05583 288 cd05583, STKc_MSK_N, N-terminal catalytic domain o 4e-07
cd07862 290 cd07862, STKc_CDK6, Catalytic domain of the Serine 4e-07
cd05059256 cd05059, PTKc_Tec_like, Catalytic domain of Tec-li 4e-07
cd06605265 cd06605, PKc_MAPKK, Catalytic domain of the dual-s 4e-07
cd07838287 cd07838, STKc_CDK4_6_like, Catalytic domain of Cyc 5e-07
cd05102 338 cd05102, PTKc_VEGFR3, Catalytic domain of the Prot 5e-07
cd07878 343 cd07878, STKc_p38beta_MAPK11, Catalytic domain of 5e-07
cd05103 343 cd05103, PTKc_VEGFR2, Catalytic domain of the Prot 5e-07
cd05618 329 cd05618, STKc_aPKC_iota, Catalytic domain of the P 6e-07
cd05616 323 cd05616, STKc_cPKC_beta, Catalytic domain of the P 6e-07
cd08223257 cd08223, STKc_Nek4, Catalytic domain of the Protei 6e-07
cd07857332 cd07857, STKc_MPK1, Catalytic domain of the Serine 6e-07
cd06639291 cd06639, STKc_myosinIIIB, Catalytic domain of the 6e-07
cd05072261 cd05072, PTKc_Lyn, Catalytic domain of the Protein 6e-07
cd05617 327 cd05617, STKc_aPKC_zeta, Catalytic domain of the P 7e-07
cd05605 285 cd05605, STKc_GRK4_like, Catalytic domain of G pro 7e-07
cd05069260 cd05069, PTKc_Yes, Catalytic domain of the Protein 7e-07
cd05067260 cd05067, PTKc_Lck_Blk, Catalytic domain of the Pro 8e-07
cd05594 325 cd05594, STKc_PKB_alpha, Catalytic domain of the P 9e-07
cd06629272 cd06629, STKc_MAPKKK_Bck1_like, Catalytic domain o 9e-07
cd05588 329 cd05588, STKc_aPKC, Catalytic domain of the Protei 1e-06
cd06640277 cd06640, STKc_MST4, Catalytic domain of the Protei 1e-06
cd07856328 cd07856, STKc_Sty1_Hog1, Catalytic domain of the S 1e-06
cd07863 288 cd07863, STKc_CDK4, Catalytic domain of the Serine 1e-06
cd05081 284 cd05081, PTKc_Jak2_Jak3_rpt2, Catalytic (repeat 2) 1e-06
cd06656297 cd06656, STKc_PAK3, Catalytic domain of the Protei 1e-06
cd06655296 cd06655, STKc_PAK2, Catalytic domain of the Protei 1e-06
cd05607277 cd05607, STKc_GRK7, Catalytic domain of the Protei 1e-06
cd07837 295 cd07837, STKc_CdkB_plant, Catalytic domain of the 1e-06
cd05062277 cd05062, PTKc_IGF-1R, Catalytic domain of the Prot 1e-06
cd05068261 cd05068, PTKc_Frk_like, Catalytic domain of Fyn-re 1e-06
cd06638 286 cd06638, STKc_myosinIIIA, Catalytic domain of the 1e-06
cd07872 309 cd07872, STKc_PCTAIRE2, Catalytic domain of the Se 1e-06
cd05052 263 cd05052, PTKc_Abl, Catalytic domain of the Protein 1e-06
cd06654296 cd06654, STKc_PAK1, Catalytic domain of the Protei 1e-06
cd05611 260 cd05611, STKc_Rim15_like, Catalytic domain of fung 2e-06
pfam07714258 pfam07714, Pkinase_Tyr, Protein tyrosine kinase 2e-06
cd08220256 cd08220, STKc_Nek8, Catalytic domain of the Protei 2e-06
PTZ00283 496 PTZ00283, PTZ00283, serine/threonine protein kinas 2e-06
cd05603 321 cd05603, STKc_SGK2, Catalytic domain of the Protei 2e-06
cd07855334 cd07855, STKc_ERK5, Catalytic domain of the Serine 2e-06
cd07849336 cd07849, STKc_ERK1_2_like, Catalytic domain of Ext 2e-06
cd07873 301 cd07873, STKc_PCTAIRE1, Catalytic domain of the Se 2e-06
cd05606 278 cd05606, STKc_beta_ARK, Catalytic domain of the Pr 2e-06
cd05073260 cd05073, PTKc_Hck, Catalytic domain of the Protein 2e-06
cd05061 288 cd05061, PTKc_InsR, Catalytic domain of the Protei 2e-06
cd05071 262 cd05071, PTKc_Src, Catalytic domain of the Protein 2e-06
cd07850 353 cd07850, STKc_JNK, Catalytic domain of the Serine/ 2e-06
PHA03207 392 PHA03207, PHA03207, serine/threonine kinase US3; P 2e-06
cd05057 279 cd05057, PTKc_EGFR_like, Catalytic domain of Epide 2e-06
cd05083254 cd05083, PTKc_Chk, Catalytic domain of the Protein 2e-06
cd05612 291 cd05612, STKc_PRKX_like, Catalytic domain of PRKX- 3e-06
cd05604 325 cd05604, STKc_SGK3, Catalytic domain of the Protei 3e-06
cd08228 267 cd08228, STKc_Nek6, Catalytic domain of the Protei 3e-06
cd08229 267 cd08229, STKc_Nek7, Catalytic domain of the Protei 3e-06
cd07831282 cd07831, STKc_MOK, Catalytic domain of the Serine/ 3e-06
cd05070260 cd05070, PTKc_Fyn_Yrk, Catalytic domain of the Pro 3e-06
cd05573 350 cd05573, STKc_ROCK_NDR_like, Catalytic domain of R 4e-06
PTZ00024335 PTZ00024, PTZ00024, cyclin-dependent protein kinas 4e-06
cd05608280 cd05608, STKc_GRK1, Catalytic domain of the Protei 4e-06
cd05633 279 cd05633, STKc_GRK3, Catalytic domain of the Protei 4e-06
cd05058 262 cd05058, PTKc_Met_Ron, Catalytic domain of the Pro 4e-06
cd05106 374 cd05106, PTKc_CSF-1R, Catalytic domain of the Prot 4e-06
cd05619 316 cd05619, STKc_nPKC_theta, Catalytic domain of the 5e-06
cd05079 284 cd05079, PTKc_Jak1_rpt2, Catalytic (repeat 2) doma 5e-06
cd05630 285 cd05630, STKc_GRK6, Catalytic domain of the Protei 6e-06
cd07841298 cd07841, STKc_CDK7, Catalytic domain of the Serine 7e-06
cd05602 325 cd05602, STKc_SGK1, Catalytic domain of the Protei 7e-06
cd05628 363 cd05628, STKc_NDR1, Catalytic domain of the Protei 7e-06
cd05049280 cd05049, PTKc_Trk, Catalytic domain of the Protein 7e-06
cd07859 338 cd07859, STKc_TDY_MAPK_plant, Catalytic domain of 7e-06
cd06653264 cd06653, STKc_MEKK3_like_1, Catalytic domain of MA 8e-06
cd05596 370 cd05596, STKc_ROCK, Catalytic domain of the Protei 8e-06
cd05055 302 cd05055, PTKc_PDGFR, Catalytic domain of the Prote 8e-06
cd07878343 cd07878, STKc_p38beta_MAPK11, Catalytic domain of 9e-06
PTZ00263 329 PTZ00263, PTZ00263, protein kinase A catalytic sub 1e-05
cd05627 360 cd05627, STKc_NDR2, Catalytic domain of the Protei 1e-05
cd06659 297 cd06659, STKc_PAK6, Catalytic domain of the Protei 1e-05
cd05632 285 cd05632, STKc_GRK5, Catalytic domain of the Protei 1e-05
cd08528269 cd08528, STKc_Nek10, Catalytic domain of the Prote 1e-05
cd06605 265 cd06605, PKc_MAPKK, Catalytic domain of the dual-s 1e-05
cd05101 304 cd05101, PTKc_FGFR2, Catalytic domain of the Prote 1e-05
cd05112256 cd05112, PTKc_Itk, Catalytic domain of the Protein 1e-05
cd06647293 cd06647, STKc_PAK_I, Catalytic domain of the Prote 1e-05
cd05087 269 cd05087, PTKc_Aatyk1_Aatyk3, Catalytic domain of t 1e-05
cd05048 283 cd05048, PTKc_Ror, Catalytic Domain of the Protein 1e-05
cd05620 316 cd05620, STKc_nPKC_delta, Catalytic domain of the 2e-05
cd06644292 cd06644, STKc_STK10_LOK, Catalytic domain of the P 2e-05
cd07836284 cd07836, STKc_Pho85, Catalytic domain of the Serin 2e-05
cd07879342 cd07879, STKc_p38delta_MAPK13, Catalytic domain of 2e-05
cd06639 291 cd06639, STKc_myosinIIIB, Catalytic domain of the 2e-05
cd05068261 cd05068, PTKc_Frk_like, Catalytic domain of Fyn-re 2e-05
cd07859338 cd07859, STKc_TDY_MAPK_plant, Catalytic domain of 2e-05
cd06647 293 cd06647, STKc_PAK_I, Catalytic domain of the Prote 2e-05
cd07848 287 cd07848, STKc_CDKL5, Catalytic domain of the Serin 2e-05
cd05086 268 cd05086, PTKc_Aatyk2, Catalytic domain of the Prot 2e-05
cd05113256 cd05113, PTKc_Btk_Bmx, Catalytic domain of the Pro 2e-05
cd05114256 cd05114, PTKc_Tec_Rlk, Catalytic domain of the Pro 2e-05
cd05066 267 cd05066, PTKc_EphR_A, Catalytic domain of the Prot 2e-05
cd05088 303 cd05088, PTKc_Tie2, Catalytic domain of the Protei 2e-05
cd05584 323 cd05584, STKc_p70S6K, Catalytic domain of the Prot 3e-05
cd05609 305 cd05609, STKc_MAST, Catalytic domain of the Protei 3e-05
cd05613 290 cd05613, STKc_MSK1_N, N-terminal catalytic domain 3e-05
cd05056 270 cd05056, PTKc_FAK, Catalytic domain of the Protein 3e-05
cd05045 290 cd05045, PTKc_RET, Catalytic domain of the Protein 3e-05
cd05093 288 cd05093, PTKc_TrkB, Catalytic domain of the Protei 3e-05
cd05033 266 cd05033, PTKc_EphR, Catalytic domain of Ephrin Rec 3e-05
cd05614 332 cd05614, STKc_MSK2_N, N-terminal catalytic domain 4e-05
cd07876 359 cd07876, STKc_JNK2, Catalytic domain of the Serine 4e-05
cd06620284 cd06620, PKc_MAPKK_Byr1_like, Catalytic domain of 4e-05
cd05082256 cd05082, PTKc_Csk, Catalytic domain of the Protein 4e-05
cd05060 257 cd05060, PTKc_Syk_like, Catalytic domain of Spleen 4e-05
cd05100 334 cd05100, PTKc_FGFR3, Catalytic domain of the Prote 4e-05
PHA03212 391 PHA03212, PHA03212, serine/threonine kinase US3; P 4e-05
cd05109 279 cd05109, PTKc_HER2, Catalytic domain of the Protei 4e-05
cd05111 279 cd05111, PTK_HER3, Pseudokinase domain of the Prot 4e-05
cd05582 318 cd05582, STKc_RSK_N, N-terminal catalytic domain o 5e-05
cd05586 330 cd05586, STKc_Sck1_like, Catalytic domain of Suppr 5e-05
cd05075 272 cd05075, PTKc_Axl, Catalytic domain of the Protein 5e-05
cd05089 297 cd05089, PTKc_Tie1, Catalytic domain of the Protei 5e-05
smart00221258 smart00221, STYKc, Protein kinase; unclassified sp 6e-05
PLN00009294 PLN00009, PLN00009, cyclin-dependent kinase A; Pro 6e-05
cd05039256 cd05039, PTKc_Csk_like, Catalytic domain of C-term 6e-05
cd06638286 cd06638, STKc_myosinIIIA, Catalytic domain of the 6e-05
cd05074 273 cd05074, PTKc_Tyro3, Catalytic domain of the Prote 6e-05
cd06622 286 cd06622, PKc_MAPKK_PBS2_like, Catalytic domain of 6e-05
PTZ00267 478 PTZ00267, PTZ00267, NIMA-related protein kinase; P 8e-05
cd07848287 cd07848, STKc_CDKL5, Catalytic domain of the Serin 8e-05
cd05098 307 cd05098, PTKc_FGFR1, Catalytic domain of the Prote 8e-05
smart00219257 smart00219, TyrKc, Tyrosine kinase, catalytic doma 9e-05
TIGR03903 1266 TIGR03903, TOMM_kin_cyc, TOMM system kinase/cyclas 9e-05
PHA03211 461 PHA03211, PHA03211, serine/threonine kinase US3; P 9e-05
cd07832286 cd07832, STKc_CCRK, Catalytic domain of the Serine 1e-04
cd05629 377 cd05629, STKc_NDR_like_fungal, Catalytic domain of 1e-04
cd07853372 cd07853, STKc_NLK, Catalytic domain of the Serine/ 1e-04
cd06608275 cd06608, STKc_myosinIII_like, Catalytic domain of 1e-04
cd05631 285 cd05631, STKc_GRK4, Catalytic domain of the Protei 1e-04
cd06658 292 cd06658, STKc_PAK5, Catalytic domain of the Protei 1e-04
cd06633313 cd06633, STKc_TAO3, Catalytic domain of the Protei 1e-04
cd06656 297 cd06656, STKc_PAK3, Catalytic domain of the Protei 1e-04
cd05607 277 cd05607, STKc_GRK7, Catalytic domain of the Protei 1e-04
cd06654 296 cd06654, STKc_PAK1, Catalytic domain of the Protei 1e-04
cd05633279 cd05633, STKc_GRK3, Catalytic domain of the Protei 1e-04
TIGR03903 1266 TIGR03903, TOMM_kin_cyc, TOMM system kinase/cyclas 1e-04
cd05099 314 cd05099, PTKc_FGFR4, Catalytic domain of the Prote 1e-04
cd07875 364 cd07875, STKc_JNK1, Catalytic domain of the Serine 1e-04
cd05035 273 cd05035, PTKc_Axl_like, Catalytic Domain of Axl-li 1e-04
cd05044269 cd05044, PTKc_c-ros, Catalytic domain of the Prote 1e-04
cd07874 355 cd07874, STKc_JNK3, Catalytic domain of the Serine 1e-04
cd07843293 cd07843, STKc_CDC2L1, Catalytic domain of the Seri 2e-04
cd06657 292 cd06657, STKc_PAK4, Catalytic domain of the Protei 2e-04
cd05034261 cd05034, PTKc_Src_like, Catalytic domain of Src ki 2e-04
cd05051 296 cd05051, PTKc_DDR, Catalytic domain of the Protein 2e-04
cd05041251 cd05041, PTKc_Fes_like, Catalytic domain of Fes-li 2e-04
cd06617283 cd06617, PKc_MKK3_6, Catalytic domain of the dual- 2e-04
cd05094 291 cd05094, PTKc_TrkC, Catalytic domain of the Protei 2e-04
cd06618 296 cd06618, PKc_MKK7, Catalytic domain of the dual-sp 2e-04
cd06616288 cd06616, PKc_MKK4, Catalytic domain of the dual-sp 2e-04
cd05042 269 cd05042, PTKc_Aatyk, Catalytic domain of the Prote 2e-04
cd05108 316 cd05108, PTKc_EGFR, Catalytic domain of the Protei 2e-04
cd05574 316 cd05574, STKc_phototropin_like, Catalytic domain o 3e-04
cd05601 330 cd05601, STKc_CRIK, Catalytic domain of the Protei 3e-04
cd05624 331 cd05624, STKc_MRCK_beta, Catalytic domain of the P 3e-04
cd07877345 cd07877, STKc_p38alpha_MAPK14, Catalytic domain of 3e-04
cd05041 251 cd05041, PTKc_Fes_like, Catalytic domain of Fes-li 3e-04
cd05092280 cd05092, PTKc_TrkA, Catalytic domain of the Protei 3e-04
cd05065 269 cd05065, PTKc_EphR_B, Catalytic domain of the Prot 3e-04
cd05104 375 cd05104, PTKc_Kit, Catalytic domain of the Protein 3e-04
cd05115 257 cd05115, PTKc_Zap-70, Catalytic domain of the Prot 3e-04
cd05063 268 cd05063, PTKc_EphR_A2, Catalytic domain of the Pro 3e-04
cd06615 308 cd06615, PKc_MEK, Catalytic domain of the dual-spe 3e-04
cd07873301 cd07873, STKc_PCTAIRE1, Catalytic domain of the Se 4e-04
cd05606278 cd05606, STKc_beta_ARK, Catalytic domain of the Pr 4e-04
PRK13184 932 PRK13184, pknD, serine/threonine-protein kinase; R 4e-04
cd05110 303 cd05110, PTKc_HER4, Catalytic domain of the Protei 4e-04
cd05091 283 cd05091, PTKc_Ror2, Catalytic domain of the Protei 4e-04
cd05095 296 cd05095, PTKc_DDR2, Catalytic domain of the Protei 4e-04
PLN03224 507 PLN03224, PLN03224, probable serine/threonine prot 4e-04
cd05576237 cd05576, STKc_RPK118_like, Catalytic domain of the 4e-04
cd06637272 cd06637, STKc_TNIK, Catalytic domain of the Protei 5e-04
cd06634308 cd06634, STKc_TAO2, Catalytic domain of the Protei 5e-04
cd07871288 cd07871, STKc_PCTAIRE3, Catalytic domain of the Se 5e-04
cd05059256 cd05059, PTKc_Tec_like, Catalytic domain of Tec-li 5e-04
cd06655 296 cd06655, STKc_PAK2, Catalytic domain of the Protei 5e-04
cd06620 284 cd06620, PKc_MAPKK_Byr1_like, Catalytic domain of 5e-04
cd06649331 cd06649, PKc_MEK2, Catalytic domain of the dual-sp 5e-04
cd05116 257 cd05116, PTKc_Syk, Catalytic domain of the Protein 5e-04
cd06917277 cd06917, STKc_NAK1_like, Catalytic domain of Funga 6e-04
PLN03225 566 PLN03225, PLN03225, Serine/threonine-protein kinas 6e-04
PHA02988283 PHA02988, PHA02988, hypothetical protein; Provisio 6e-04
cd06650333 cd06650, PKc_MEK1, Catalytic domain of the dual-sp 6e-04
PTZ00284467 PTZ00284, PTZ00284, protein kinase; Provisional 7e-04
cd06636282 cd06636, STKc_MAP4K4_6, Catalytic domain of the Pr 8e-04
cd06635317 cd06635, STKc_TAO1, Catalytic domain of the Protei 8e-04
cd05623 332 cd05623, STKc_MRCK_alpha, Catalytic domain of the 9e-04
cd05597 331 cd05597, STKc_DMPK_like, Catalytic domain of Myoto 9e-04
cd07858337 cd07858, STKc_TEY_MAPK_plant, Catalytic domain of 0.001
cd05083254 cd05083, PTKc_Chk, Catalytic domain of the Protein 0.001
cd07875364 cd07875, STKc_JNK1, Catalytic domain of the Serine 0.001
cd05085250 cd05085, PTKc_Fer, Catalytic domain of the Protein 0.001
cd05096 304 cd05096, PTKc_DDR1, Catalytic domain of the Protei 0.001
cd05105 400 cd05105, PTKc_PDGFR_alpha, Catalytic domain of the 0.001
cd05043 280 cd05043, PTK_Ryk, Pseudokinase domain of Ryk (Rece 0.001
cd05097 295 cd05097, PTKc_DDR_like, Catalytic domain of Discoi 0.001
cd05047270 cd05047, PTKc_Tie, Catalytic domain of Tie Protein 0.001
cd07866311 cd07866, STKc_BUR1, Catalytic domain of the Serine 0.002
PTZ00426 340 PTZ00426, PTZ00426, cAMP-dependent protein kinase 0.002
cd07835283 cd07835, STKc_CDK1_like, Catalytic domain of Cycli 0.002
cd07847286 cd07847, STKc_CDKL1_4, Catalytic domain of the Ser 0.002
cd07850353 cd07850, STKc_JNK, Catalytic domain of the Serine/ 0.002
cd05082256 cd05082, PTKc_Csk, Catalytic domain of the Protein 0.002
cd06622286 cd06622, PKc_MAPKK_PBS2_like, Catalytic domain of 0.002
cd05084252 cd05084, PTKc_Fes, Catalytic domain of the Protein 0.002
COG0661 517 COG0661, AarF, Predicted unusual protein kinase [G 0.002
TIGR03724199 TIGR03724, arch_bud32, Kae1-associated kinase Bud3 0.002
cd07845309 cd07845, STKc_CDK10, Catalytic domain of the Serin 0.003
cd05598 376 cd05598, STKc_LATS, Catalytic domain of the Protei 0.003
cd06643282 cd06643, STKc_SLK, Catalytic domain of the Protein 0.003
cd05622 371 cd05622, STKc_ROCK1, Catalytic domain of the Prote 0.003
cd06617 283 cd06617, PKc_MKK3_6, Catalytic domain of the dual- 0.003
cd06616 288 cd06616, PKc_MKK4, Catalytic domain of the dual-sp 0.003
cd06650 333 cd06650, PKc_MEK1, Catalytic domain of the dual-sp 0.003
cd05043280 cd05043, PTK_Ryk, Pseudokinase domain of Ryk (Rece 0.003
PTZ00036 440 PTZ00036, PTZ00036, glycogen synthase kinase; Prov 0.003
cd05090 283 cd05090, PTKc_Ror1, Catalytic domain of the Protei 0.003
PHA03209357 PHA03209, PHA03209, serine/threonine kinase US3; P 0.004
cd06607307 cd06607, STKc_TAO, Catalytic domain of the Protein 0.004
cd05047270 cd05047, PTKc_Tie, Catalytic domain of Tie Protein 0.004
>gnl|CDD|214567 smart00220, S_TKc, Serine/Threonine protein kinases, catalytic domain Back     alignment and domain information
 Score =  134 bits (341), Expect = 5e-38
 Identities = 65/223 (29%), Positives = 100/223 (44%), Gaps = 40/223 (17%)

Query: 3   QEIAIHRSLKHRNVVGFHSFFEDSKFVYIILELCRKRSMMELYNSACDLEEMSDPAAQPV 62
           +EI I + LKH N+V  +  FED   +Y+++E C    + +L      L E     A+  
Sbjct: 46  REIKILKKLKHPNIVRLYDVFEDEDKLYLVMEYCEGGDLFDLLKKRGRLSE---DEARFY 102

Query: 63  IW-VSKWVDYSDKYGFGYQLNDDSSGVMFNDL---------TRMIMLA------------ 100
           +  +   ++Y         L+  S G++  DL            + LA            
Sbjct: 103 LRQILSALEY---------LH--SKGIVHRDLKPENILLDEDGHVKLADFGLARQLDPGE 151

Query: 101 NKNTLCGTPNYIAPEILNKNGHSFEVDVWSIGCIMYTLLVGKPPFETS-TLKETYSRIKK 159
              T  GTP Y+APE+L   G+   VD+WS+G I+Y LL GKPPF     L E + +I K
Sbjct: 152 KLTTFVGTPEYMAPEVLLGKGYGKAVDIWSLGVILYELLTGKPPFPGDDQLLELFKKIGK 211

Query: 160 VEYKLP---ATLKKPAATMIKKMLLLDPVQRPPVAQLLHFEFF 199
            +   P     +   A  +I+K+L+ DP +R    + L   FF
Sbjct: 212 PKPPFPPPEWDISPEAKDLIRKLLVKDPEKRLTAEEALQHPFF 254


Phosphotransferases. Serine or threonine-specific kinase subfamily. Length = 254

>gnl|CDD|215690 pfam00069, Pkinase, Protein kinase domain Back     alignment and domain information
>gnl|CDD|173660 cd05123, STKc_AGC, Catalytic domain of AGC family Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173755 cd08215, STKc_Nek, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase Back     alignment and domain information
>gnl|CDD|214567 smart00220, S_TKc, Serine/Threonine protein kinases, catalytic domain Back     alignment and domain information
>gnl|CDD|173672 cd05581, STKc_PDK1, Catalytic domain of the Protein Serine/Threonine Kinase, Phosphoinositide-dependent kinase 1 Back     alignment and domain information
>gnl|CDD|240561 cd13118, POLO_box_1, First polo-box domain (PBD) of polo-like kinases Plk1, Plk2, Plk3, and Plk5 Back     alignment and domain information
>gnl|CDD|173663 cd05572, STKc_cGK_PKG, Catalytic domain of the Protein Serine/Threonine Kinase, cGMP-dependent protein kinase Back     alignment and domain information
>gnl|CDD|173724 cd06606, STKc_MAPKKK, Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-Activated Protein Kinase Kinase Kinase Back     alignment and domain information
>gnl|CDD|173670 cd05579, STKc_MAST_like, Catalytic domain of Microtubule-associated serine/threonine kinase-like proteins Back     alignment and domain information
>gnl|CDD|215690 pfam00069, Pkinase, Protein kinase domain Back     alignment and domain information
>gnl|CDD|173659 cd05122, PKc_STE, Catalytic domain of STE family Protein Kinases Back     alignment and domain information
>gnl|CDD|173733 cd07829, STKc_CDK_like, Catalytic domain of Cyclin-Dependent protein Kinase-like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|143345 cd07840, STKc_CDK9_like, Catalytic domain of Cyclin-Dependent protein Kinase 9-like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173772 cd08530, STKc_CNK2-like, Catalytic domain of the Protein Serine/Threonine Kinase, Chlamydomonas reinhardtii CNK2, and similar domains Back     alignment and domain information
>gnl|CDD|173731 cd06627, STKc_Cdc7_like, Catalytic domain of Cell division control protein 7-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173623 cd00180, PKc, Catalytic domain of Protein Kinases Back     alignment and domain information
>gnl|CDD|173623 cd00180, PKc, Catalytic domain of Protein Kinases Back     alignment and domain information
>gnl|CDD|173675 cd05584, STKc_p70S6K, Catalytic domain of the Protein Serine/Threonine Kinase, 70 kDa ribosomal protein S6 kinase Back     alignment and domain information
>gnl|CDD|173671 cd05580, STKc_PKA, Catalytic domain of the Protein Serine/Threonine Kinase, cAMP-dependent protein kinase Back     alignment and domain information
>gnl|CDD|173757 cd08217, STKc_Nek2, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 2 Back     alignment and domain information
>gnl|CDD|173703 cd05612, STKc_PRKX_like, Catalytic domain of PRKX-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173736 cd07832, STKc_CCRK, Catalytic domain of the Serine/Threonine Kinase, Cell Cycle-Related Kinase Back     alignment and domain information
>gnl|CDD|173755 cd08215, STKc_Nek, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase Back     alignment and domain information
>gnl|CDD|173661 cd05570, STKc_PKC, Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase C Back     alignment and domain information
>gnl|CDD|140289 PTZ00263, PTZ00263, protein kinase A catalytic subunit; Provisional Back     alignment and domain information
>gnl|CDD|173659 cd05122, PKc_STE, Catalytic domain of STE family Protein Kinases Back     alignment and domain information
>gnl|CDD|173741 cd07843, STKc_CDC2L1, Catalytic domain of the Serine/Threonine Kinase, Cell Division Cycle 2-like 1 Back     alignment and domain information
>gnl|CDD|173724 cd06606, STKc_MAPKKK, Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-Activated Protein Kinase Kinase Kinase Back     alignment and domain information
>gnl|CDD|173742 cd07845, STKc_CDK10, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 10 Back     alignment and domain information
>gnl|CDD|173664 cd05573, STKc_ROCK_NDR_like, Catalytic domain of ROCK- and NDR kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173691 cd05600, STKc_Sid2p_Dbf2p, Catalytic domain of Fungal Sid2p- and Dbf2p-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173702 cd05611, STKc_Rim15_like, Catalytic domain of fungal Rim15-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173665 cd05574, STKc_phototropin_like, Catalytic domain of Phototropin-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|223589 COG0515, SPS1, Serine/threonine protein kinase [General function prediction only / Signal transduction mechanisms / Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|173690 cd05599, STKc_NDR_like, Catalytic domain of Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173682 cd05591, STKc_nPKC_epsilon, Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C epsilon Back     alignment and domain information
>gnl|CDD|143371 cd07866, STKc_BUR1, Catalytic domain of the Serine/Threonine Kinase, Fungal Cyclin-Dependent protein Kinase Bypass UAS Requirement 1 and similar proteins Back     alignment and domain information
>gnl|CDD|132957 cd06626, STKc_MEKK4, Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 4 Back     alignment and domain information
>gnl|CDD|173734 cd07830, STKc_MAK_like, Catalytic domain of Male germ cell-Associated Kinase-like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173730 cd06624, STKc_ASK, Catalytic domain of the Protein Serine/Threonine Kinase, Apoptosis signal-regulating kinase Back     alignment and domain information
>gnl|CDD|173689 cd05598, STKc_LATS, Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor Back     alignment and domain information
>gnl|CDD|143346 cd07841, STKc_CDK7, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 7 Back     alignment and domain information
>gnl|CDD|197581 smart00219, TyrKc, Tyrosine kinase, catalytic domain Back     alignment and domain information
>gnl|CDD|132956 cd06625, STKc_MEKK3_like, Catalytic domain of MAP/ERK kinase kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173683 cd05592, STKc_nPKC_theta_delta, Catalytic domain of the Protein Serine/Threonine Kinases, Novel Protein Kinase C theta and delta Back     alignment and domain information
>gnl|CDD|132942 cd06611, STKc_SLK_like, Catalytic domain of Ste20-like kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173676 cd05585, STKc_YPK1_like, Catalytic domain of Yeast Protein Kinase 1-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173685 cd05594, STKc_PKB_alpha, Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B alpha Back     alignment and domain information
>gnl|CDD|173660 cd05123, STKc_AGC, Catalytic domain of AGC family Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173669 cd05578, STKc_Yank1, Catalytic domain of the Protein Serine/Threonine Kinase, Yank1 Back     alignment and domain information
>gnl|CDD|214568 smart00221, STYKc, Protein kinase; unclassified specificity Back     alignment and domain information
>gnl|CDD|173673 cd05582, STKc_RSK_N, N-terminal catalytic domain of the Protein Serine/Threonine Kinase, 90 kDa ribosomal protein S6 kinase Back     alignment and domain information
>gnl|CDD|173684 cd05593, STKc_PKB_gamma, Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B gamma Back     alignment and domain information
>gnl|CDD|132954 cd06623, PKc_MAPKK_plant_like, Catalytic domain of Plant dual-specificity MAP kinase kinases and similar proteins Back     alignment and domain information
>gnl|CDD|173662 cd05571, STKc_PKB, Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B Back     alignment and domain information
>gnl|CDD|132963 cd06632, STKc_MEKK1_plant, Catalytic domain of the Protein Serine/Threonine Kinase, Plant MAP/ERK kinase kinase 1 Back     alignment and domain information
>gnl|CDD|173710 cd05620, STKc_nPKC_delta, Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C delta Back     alignment and domain information
>gnl|CDD|173718 cd05629, STKc_NDR_like_fungal, Catalytic domain of Fungal Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173674 cd05583, STKc_MSK_N, N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase Back     alignment and domain information
>gnl|CDD|132962 cd06631, STKc_YSK4, Catalytic domain of the Protein Serine/Threonine Kinase, Yeast Sps1/Ste20-related kinase 4 Back     alignment and domain information
>gnl|CDD|173686 cd05595, STKc_PKB_beta, Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B beta Back     alignment and domain information
>gnl|CDD|173678 cd05587, STKc_cPKC, Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C Back     alignment and domain information
>gnl|CDD|143333 cd05118, STKc_CMGC, Catalytic domain of CMGC family Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173733 cd07829, STKc_CDK_like, Catalytic domain of Cyclin-Dependent protein Kinase-like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173706 cd05615, STKc_cPKC_alpha, Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C alpha Back     alignment and domain information
>gnl|CDD|173726 cd06610, STKc_OSR1_SPAK, Catalytic domain of the Protein Serine/Threonine Kinases, Oxidative stress response kinase and Ste20-related proline alanine-rich kinase Back     alignment and domain information
>gnl|CDD|173679 cd05588, STKc_aPKC, Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C Back     alignment and domain information
>gnl|CDD|132963 cd06632, STKc_MEKK1_plant, Catalytic domain of the Protein Serine/Threonine Kinase, Plant MAP/ERK kinase kinase 1 Back     alignment and domain information
>gnl|CDD|219530 pfam07714, Pkinase_Tyr, Protein tyrosine kinase Back     alignment and domain information
>gnl|CDD|173709 cd05619, STKc_nPKC_theta, Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C theta Back     alignment and domain information
>gnl|CDD|173726 cd06610, STKc_OSR1_SPAK, Catalytic domain of the Protein Serine/Threonine Kinases, Oxidative stress response kinase and Ste20-related proline alanine-rich kinase Back     alignment and domain information
>gnl|CDD|173681 cd05590, STKc_nPKC_eta, Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C eta Back     alignment and domain information
>gnl|CDD|132943 cd06612, STKc_MST1_2, Catalytic domain of the Protein Serine/Threonine Kinases, Mammalian Ste20-like protein kinase 1 and 2 Back     alignment and domain information
>gnl|CDD|173672 cd05581, STKc_PDK1, Catalytic domain of the Protein Serine/Threonine Kinase, Phosphoinositide-dependent kinase 1 Back     alignment and domain information
>gnl|CDD|132943 cd06612, STKc_MST1_2, Catalytic domain of the Protein Serine/Threonine Kinases, Mammalian Ste20-like protein kinase 1 and 2 Back     alignment and domain information
>gnl|CDD|173761 cd08221, STKc_Nek9, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 9 Back     alignment and domain information
>gnl|CDD|173705 cd05614, STKc_MSK2_N, N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase 2 Back     alignment and domain information
>gnl|CDD|173700 cd05609, STKc_MAST, Catalytic domain of the Protein Serine/Threonine Kinase, Microtubule-associated serine/threonine kinase Back     alignment and domain information
>gnl|CDD|173772 cd08530, STKc_CNK2-like, Catalytic domain of the Protein Serine/Threonine Kinase, Chlamydomonas reinhardtii CNK2, and similar domains Back     alignment and domain information
>gnl|CDD|132956 cd06625, STKc_MEKK3_like, Catalytic domain of MAP/ERK kinase kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173737 cd07834, STKc_MAPK, Catalytic domain of the Serine/Threonine Kinase, Mitogen-Activated Protein Kinase Back     alignment and domain information
>gnl|CDD|173708 cd05617, STKc_aPKC_zeta, Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C zeta Back     alignment and domain information
>gnl|CDD|140293 PTZ00267, PTZ00267, NIMA-related protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|173624 cd00192, PTKc, Catalytic domain of Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|173771 cd08529, STKc_FA2-like, Catalytic domain of the Protein Serine/Threonine Kinase, Chlamydomonas reinhardtii FA2 and similar domains Back     alignment and domain information
>gnl|CDD|177557 PHA03209, PHA03209, serine/threonine kinase US3; Provisional Back     alignment and domain information
>gnl|CDD|88519 cd05618, STKc_aPKC_iota, Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C iota Back     alignment and domain information
>gnl|CDD|173693 cd05602, STKc_SGK1, Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 1 Back     alignment and domain information
>gnl|CDD|173707 cd05616, STKc_cPKC_beta, Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C beta Back     alignment and domain information
>gnl|CDD|132957 cd06626, STKc_MEKK4, Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 4 Back     alignment and domain information
>gnl|CDD|173763 cd08223, STKc_Nek4, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 4 Back     alignment and domain information
>gnl|CDD|173765 cd08225, STKc_Nek5, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 5 Back     alignment and domain information
>gnl|CDD|173680 cd05589, STKc_PKN, Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase N Back     alignment and domain information
>gnl|CDD|132974 cd06643, STKc_SLK, Catalytic domain of the Protein Serine/Threonine Kinase, Ste20-like kinase Back     alignment and domain information
>gnl|CDD|173760 cd08220, STKc_Nek8, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 8 Back     alignment and domain information
>gnl|CDD|173731 cd06627, STKc_Cdc7_like, Catalytic domain of Cell division control protein 7-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|132984 cd06653, STKc_MEKK3_like_1, Catalytic domain of MAP/ERK kinase kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173748 cd07853, STKc_NLK, Catalytic domain of the Serine/Threonine Kinase, Nemo-Like Kinase Back     alignment and domain information
>gnl|CDD|173725 cd06608, STKc_myosinIII_like, Catalytic domain of Class III myosin-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|240344 PTZ00283, PTZ00283, serine/threonine protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|173717 cd05628, STKc_NDR1, Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 1 Back     alignment and domain information
>gnl|CDD|173759 cd08219, STKc_Nek3, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 3 Back     alignment and domain information
>gnl|CDD|173714 cd05625, STKc_LATS1, Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor 1 Back     alignment and domain information
>gnl|CDD|173680 cd05589, STKc_PKN, Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase N Back     alignment and domain information
>gnl|CDD|132960 cd06629, STKc_MAPKKK_Bck1_like, Catalytic domain of fungal Bck1-like MAP Kinase Kinase Kinases Back     alignment and domain information
>gnl|CDD|173764 cd08224, STKc_Nek6_Nek7, Catalytic domain of the Protein Serine/Threonine Kinases, Never In Mitosis gene A-related kinase 6 and 7 Back     alignment and domain information
>gnl|CDD|173728 cd06614, STKc_PAK, Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase Back     alignment and domain information
>gnl|CDD|173704 cd05613, STKc_MSK1_N, N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase 1 Back     alignment and domain information
>gnl|CDD|173739 cd07838, STKc_CDK4_6_like, Catalytic domain of Cyclin-Dependent protein Kinase 4 and 6-like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173728 cd06614, STKc_PAK, Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase Back     alignment and domain information
>gnl|CDD|173694 cd05603, STKc_SGK2, Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 2 Back     alignment and domain information
>gnl|CDD|173616 PTZ00426, PTZ00426, cAMP-dependent protein kinase catalytic subunit; Provisional Back     alignment and domain information
>gnl|CDD|173666 cd05575, STKc_SGK, Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase Back     alignment and domain information
>gnl|CDD|173749 cd07855, STKc_ERK5, Catalytic domain of the Serine/Threonine Kinase, Extracellular signal-Regulated Kinase 5 Back     alignment and domain information
>gnl|CDD|132940 cd06609, STKc_MST3_like, Catalytic domain of Mammalian Ste20-like protein kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173762 cd08222, STKc_Nek11, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 11 Back     alignment and domain information
>gnl|CDD|173715 cd05626, STKc_LATS2, Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor 2 Back     alignment and domain information
>gnl|CDD|132983 cd06652, STKc_MEKK2, Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 2 Back     alignment and domain information
>gnl|CDD|173687 cd05596, STKc_ROCK, Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase Back     alignment and domain information
>gnl|CDD|132982 cd06651, STKc_MEKK3, Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 3 Back     alignment and domain information
>gnl|CDD|173716 cd05627, STKc_NDR2, Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 2 Back     alignment and domain information
>gnl|CDD|133248 cd05148, PTKc_Srm_Brk, Catalytic domain of the Protein Tyrosine Kinases, Srm and Brk Back     alignment and domain information
>gnl|CDD|132975 cd06644, STKc_STK10_LOK, Catalytic domain of the Protein Serine/Threonine Kinase, STK10 or Lymphocyte-oriented kinase Back     alignment and domain information
>gnl|CDD|132979 cd06648, STKc_PAK_II, Catalytic domain of the Protein Serine/Threonine Kinase, Group II p21-activated kinase Back     alignment and domain information
>gnl|CDD|132938 cd06607, STKc_TAO, Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids proteins Back     alignment and domain information
>gnl|CDD|173670 cd05579, STKc_MAST_like, Catalytic domain of Microtubule-associated serine/threonine kinase-like proteins Back     alignment and domain information
>gnl|CDD|173730 cd06624, STKc_ASK, Catalytic domain of the Protein Serine/Threonine Kinase, Apoptosis signal-regulating kinase Back     alignment and domain information
>gnl|CDD|173701 cd05610, STKc_MASTL, Catalytic domain of the Protein Serine/Threonine Kinase, Microtubule-associated serine/threonine-like kinase Back     alignment and domain information
>gnl|CDD|132990 cd06659, STKc_PAK6, Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 6 Back     alignment and domain information
>gnl|CDD|173754 cd07865, STKc_CDK9, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 9 Back     alignment and domain information
>gnl|CDD|132961 cd06630, STKc_MEKK1, Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 1 Back     alignment and domain information
>gnl|CDD|223589 COG0515, SPS1, Serine/threonine protein kinase [General function prediction only / Signal transduction mechanisms / Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|132962 cd06631, STKc_YSK4, Catalytic domain of the Protein Serine/Threonine Kinase, Yeast Sps1/Ste20-related kinase 4 Back     alignment and domain information
>gnl|CDD|173740 cd07842, STKc_CDK8_like, Catalytic domain of Cyclin-Dependent protein Kinase 8-like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173732 cd06628, STKc_MAPKKK_Byr2_like, Catalytic domain of fungal Byr2-like MAP Kinase Kinase Kinases Back     alignment and domain information
>gnl|CDD|173738 cd07835, STKc_CDK1_like, Catalytic domain of Cyclin-Dependent protein Kinase 1-like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|240233 PTZ00024, PTZ00024, cyclin-dependent protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|173668 cd05577, STKc_GRK, Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase Back     alignment and domain information
>gnl|CDD|173695 cd05604, STKc_SGK3, Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 3 Back     alignment and domain information
>gnl|CDD|173662 cd05571, STKc_PKB, Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B Back     alignment and domain information
>gnl|CDD|173727 cd06613, STKc_MAP4K3_like, Catalytic domain of Mitogen-activated protein kinase kinase kinase kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173719 cd05630, STKc_GRK6, Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 6 Back     alignment and domain information
>gnl|CDD|173663 cd05572, STKc_cGK_PKG, Catalytic domain of the Protein Serine/Threonine Kinase, cGMP-dependent protein kinase Back     alignment and domain information
>gnl|CDD|143338 cd07833, STKc_CDKL, Catalytic domain of Cyclin-Dependent protein Kinase Like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|143363 cd07858, STKc_TEY_MAPK_plant, Catalytic domain of the Serine/Threonine Kinases, TEY Mitogen-Activated Protein Kinases from Plants Back     alignment and domain information
>gnl|CDD|173699 cd05608, STKc_GRK1, Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 1 Back     alignment and domain information
>gnl|CDD|173696 cd05605, STKc_GRK4_like, Catalytic domain of G protein-coupled Receptor Kinase 4-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|143359 cd07854, STKc_MAPK4_6, Catalytic domain of the Serine/Threonine Kinases, Mitogen-Activated Protein Kinases 4 and 6 Back     alignment and domain information
>gnl|CDD|173671 cd05580, STKc_PKA, Catalytic domain of the Protein Serine/Threonine Kinase, cAMP-dependent protein kinase Back     alignment and domain information
>gnl|CDD|143338 cd07833, STKc_CDKL, Catalytic domain of Cyclin-Dependent protein Kinase Like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|143356 cd07851, STKc_p38, Catalytic domain of the Serine/Threonine Kinase, p38 Mitogen-Activated Protein Kinase Back     alignment and domain information
>gnl|CDD|173661 cd05570, STKc_PKC, Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase C Back     alignment and domain information
>gnl|CDD|173727 cd06613, STKc_MAP4K3_like, Catalytic domain of Mitogen-activated protein kinase kinase kinase kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|143333 cd05118, STKc_CMGC, Catalytic domain of CMGC family Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173762 cd08222, STKc_Nek11, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 11 Back     alignment and domain information
>gnl|CDD|143341 cd07836, STKc_Pho85, Catalytic domain of the Serine/Threonine Kinase, Fungal Cyclin-Dependent protein Kinase Pho85 Back     alignment and domain information
>gnl|CDD|173669 cd05578, STKc_Yank1, Catalytic domain of the Protein Serine/Threonine Kinase, Yank1 Back     alignment and domain information
>gnl|CDD|173761 cd08221, STKc_Nek9, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 9 Back     alignment and domain information
>gnl|CDD|173771 cd08529, STKc_FA2-like, Catalytic domain of the Protein Serine/Threonine Kinase, Chlamydomonas reinhardtii FA2 and similar domains Back     alignment and domain information
>gnl|CDD|173721 cd05632, STKc_GRK5, Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 5 Back     alignment and domain information
>gnl|CDD|173768 cd08228, STKc_Nek6, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 6 Back     alignment and domain information
>gnl|CDD|144309 pfam00659, POLO_box, POLO box duplicated region Back     alignment and domain information
>gnl|CDD|132988 cd06657, STKc_PAK4, Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 4 Back     alignment and domain information
>gnl|CDD|173757 cd08217, STKc_Nek2, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 2 Back     alignment and domain information
>gnl|CDD|173743 cd07846, STKc_CDKL2_3, Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase Like 2 and 3 Back     alignment and domain information
>gnl|CDD|132973 cd06642, STKc_STK25-YSK1, Catalytic domain of the Protein Serine/Threonine Kinase, STK25 or Yeast Sps1/Ste20-related kinase 1 Back     alignment and domain information
>gnl|CDD|165476 PHA03210, PHA03210, serine/threonine kinase US3; Provisional Back     alignment and domain information
>gnl|CDD|173752 cd07861, STKc_CDK1_euk, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 1 from higher eukaryotes-like Back     alignment and domain information
>gnl|CDD|132940 cd06609, STKc_MST3_like, Catalytic domain of Mammalian Ste20-like protein kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173732 cd06628, STKc_MAPKKK_Byr2_like, Catalytic domain of fungal Byr2-like MAP Kinase Kinase Kinases Back     alignment and domain information
>gnl|CDD|143356 cd07851, STKc_p38, Catalytic domain of the Serine/Threonine Kinase, p38 Mitogen-Activated Protein Kinase Back     alignment and domain information
>gnl|CDD|173769 cd08229, STKc_Nek7, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 7 Back     alignment and domain information
>gnl|CDD|173692 cd05601, STKc_CRIK, Catalytic domain of the Protein Serine/Threonine Kinase, Citron Rho-interacting kinase Back     alignment and domain information
>gnl|CDD|143345 cd07840, STKc_CDK9_like, Catalytic domain of Cyclin-Dependent protein Kinase 9-like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173751 cd07860, STKc_CDK2_3, Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase 2 and 3 Back     alignment and domain information
>gnl|CDD|173626 cd05034, PTKc_Src_like, Catalytic domain of Src kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|173625 cd05032, PTKc_InsR_like, Catalytic domain of Insulin Receptor-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|173770 cd08528, STKc_Nek10, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 10 Back     alignment and domain information
>gnl|CDD|143349 cd07844, STKc_PCTAIRE_like, Catalytic domain of PCTAIRE-like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173711 cd05621, STKc_ROCK2, Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 2 Back     alignment and domain information
>gnl|CDD|173720 cd05631, STKc_GRK4, Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 4 Back     alignment and domain information
>gnl|CDD|173684 cd05593, STKc_PKB_gamma, Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B gamma Back     alignment and domain information
>gnl|CDD|132989 cd06658, STKc_PAK5, Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 5 Back     alignment and domain information
>gnl|CDD|88524 cd05623, STKc_MRCK_alpha, Catalytic domain of the Protein Serine/Threonine Kinase, DMPK-related cell division control protein 42 binding kinase alpha Back     alignment and domain information
>gnl|CDD|173712 cd05622, STKc_ROCK1, Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 1 Back     alignment and domain information
>gnl|CDD|173747 cd07852, STKc_MAPK15, Catalytic domain of the Serine/Threonine Kinase, Mitogen-Activated Protein Kinase 15 Back     alignment and domain information
>gnl|CDD|132961 cd06630, STKc_MEKK1, Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 1 Back     alignment and domain information
>gnl|CDD|173688 cd05597, STKc_DMPK_like, Catalytic domain of Myotonic Dystrophy protein kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|132942 cd06611, STKc_SLK_like, Catalytic domain of Ste20-like kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173502 PTZ00266, PTZ00266, NIMA-related protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|173765 cd08225, STKc_Nek5, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 5 Back     alignment and domain information
>gnl|CDD|133248 cd05148, PTKc_Srm_Brk, Catalytic domain of the Protein Tyrosine Kinases, Srm and Brk Back     alignment and domain information
>gnl|CDD|132979 cd06648, STKc_PAK_II, Catalytic domain of the Protein Serine/Threonine Kinase, Group II p21-activated kinase Back     alignment and domain information
>gnl|CDD|133211 cd05080, PTKc_Tyk2_rpt2, Catalytic (repeat 2) domain of the Protein Tyrosine Kinase, Tyrosine kinase 2 Back     alignment and domain information
>gnl|CDD|173635 cd05054, PTKc_VEGFR, Catalytic domain of the Protein Tyrosine Kinases, Vascular Endothelial Growth Factor Receptors Back     alignment and domain information
>gnl|CDD|173628 cd05038, PTKc_Jak_rpt2, Catalytic (repeat 2) domain of the Protein Tyrosine Kinases, Janus kinases Back     alignment and domain information
>gnl|CDD|132968 cd06637, STKc_TNIK, Catalytic domain of the Protein Serine/Threonine Kinase, Traf2- and Nck-interacting kinase Back     alignment and domain information
>gnl|CDD|173686 cd05595, STKc_PKB_beta, Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B beta Back     alignment and domain information
>gnl|CDD|173678 cd05587, STKc_cPKC, Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C Back     alignment and domain information
>gnl|CDD|173764 cd08224, STKc_Nek6_Nek7, Catalytic domain of the Protein Serine/Threonine Kinases, Never In Mitosis gene A-related kinase 6 and 7 Back     alignment and domain information
>gnl|CDD|143344 cd07839, STKc_CDK5, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 5 Back     alignment and domain information
>gnl|CDD|132971 cd06640, STKc_MST4, Catalytic domain of the Protein Serine/Threonine Kinase, Mammalian Ste20-like protein kinase 4 Back     alignment and domain information
>gnl|CDD|173634 cd05053, PTKc_FGFR, Catalytic domain of the Protein Tyrosine Kinases, Fibroblast Growth Factor Receptors Back     alignment and domain information
>gnl|CDD|173753 cd07864, STKc_CDK12, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 12 Back     alignment and domain information
>gnl|CDD|132965 cd06634, STKc_TAO2, Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 2 Back     alignment and domain information
>gnl|CDD|173734 cd07830, STKc_MAK_like, Catalytic domain of Male germ cell-Associated Kinase-like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|132954 cd06623, PKc_MAPKK_plant_like, Catalytic domain of Plant dual-specificity MAP kinase kinases and similar proteins Back     alignment and domain information
>gnl|CDD|133181 cd05050, PTKc_Musk, Catalytic domain of the Protein Tyrosine Kinase, Muscle-specific kinase Back     alignment and domain information
>gnl|CDD|173668 cd05577, STKc_GRK, Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase Back     alignment and domain information
>gnl|CDD|143385 cd07880, STKc_p38gamma_MAPK12, Catalytic domain of the Serine/Threonine Kinase, p38gamma Mitogen-Activated Protein Kinase Back     alignment and domain information
>gnl|CDD|132967 cd06636, STKc_MAP4K4_6, Catalytic domain of the Protein Serine/Threonine Kinases, Mitogen-Activated Protein Kinase Kinase Kinase Kinase 4 and 6 Back     alignment and domain information
>gnl|CDD|173681 cd05590, STKc_nPKC_eta, Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C eta Back     alignment and domain information
>gnl|CDD|143385 cd07880, STKc_p38gamma_MAPK12, Catalytic domain of the Serine/Threonine Kinase, p38gamma Mitogen-Activated Protein Kinase Back     alignment and domain information
>gnl|CDD|143376 cd07871, STKc_PCTAIRE3, Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-3 kinase Back     alignment and domain information
>gnl|CDD|132976 cd06645, STKc_MAP4K3, Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-activated protein kinase kinase kinase kinase 3 Back     alignment and domain information
>gnl|CDD|132972 cd06641, STKc_MST3, Catalytic domain of the Protein Serine/Threonine Kinase, Mammalian Ste20-like protein kinase 3 Back     alignment and domain information
>gnl|CDD|143361 cd07856, STKc_Sty1_Hog1, Catalytic domain of the Serine/Threonine Kinases, Fungal Mitogen-Activated Protein Kinases Sty1 and Hog1 Back     alignment and domain information
>gnl|CDD|132977 cd06646, STKc_MAP4K5, Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-activated protein kinase kinase kinase kinase 5 Back     alignment and domain information
>gnl|CDD|173691 cd05600, STKc_Sid2p_Dbf2p, Catalytic domain of Fungal Sid2p- and Dbf2p-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173713 cd05624, STKc_MRCK_beta, Catalytic domain of the Protein Serine/Threonine Kinase, DMPK-related cell division control protein 42 binding kinase beta Back     alignment and domain information
>gnl|CDD|173706 cd05615, STKc_cPKC_alpha, Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C alpha Back     alignment and domain information
>gnl|CDD|132952 cd06621, PKc_MAPKK_Pek1_like, Catalytic domain of fungal Pek1-like dual-specificity MAP kinase kinases Back     alignment and domain information
>gnl|CDD|173666 cd05575, STKc_SGK, Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase Back     alignment and domain information
>gnl|CDD|173750 cd07857, STKc_MPK1, Catalytic domain of the Serine/Threonine Kinase, Fungal Mitogen-Activated Protein Kinase MPK1 Back     alignment and domain information
>gnl|CDD|173677 cd05586, STKc_Sck1_like, Catalytic domain of Suppressor of loss of cAMP-dependent protein kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173747 cd07852, STKc_MAPK15, Catalytic domain of the Serine/Threonine Kinase, Mitogen-Activated Protein Kinase 15 Back     alignment and domain information
>gnl|CDD|133172 cd05040, PTKc_Ack_like, Catalytic domain of the Protein Tyrosine Kinase, Activated Cdc42-associated kinase Back     alignment and domain information
>gnl|CDD|173701 cd05610, STKc_MASTL, Catalytic domain of the Protein Serine/Threonine Kinase, Microtubule-associated serine/threonine-like kinase Back     alignment and domain information
>gnl|CDD|173758 cd08218, STKc_Nek1, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 1 Back     alignment and domain information
>gnl|CDD|143354 cd07849, STKc_ERK1_2_like, Catalytic domain of Extracellular signal-Regulated Kinase 1 and 2-like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173735 cd07831, STKc_MOK, Catalytic domain of the Serine/Threonine Kinase, MAPK/MAK/MRK Overlapping Kinase Back     alignment and domain information
>gnl|CDD|215036 PLN00034, PLN00034, mitogen-activated protein kinase kinase; Provisional Back     alignment and domain information
>gnl|CDD|143382 cd07877, STKc_p38alpha_MAPK14, Catalytic domain of the Serine/Threonine Kinase, p38alpha Mitogen-Activated Protein Kinase Back     alignment and domain information
>gnl|CDD|173682 cd05591, STKc_nPKC_epsilon, Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C epsilon Back     alignment and domain information
>gnl|CDD|173737 cd07834, STKc_MAPK, Catalytic domain of the Serine/Threonine Kinase, Mitogen-Activated Protein Kinase Back     alignment and domain information
>gnl|CDD|173759 cd08219, STKc_Nek3, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 3 Back     alignment and domain information
>gnl|CDD|132982 cd06651, STKc_MEKK3, Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 3 Back     alignment and domain information
>gnl|CDD|132973 cd06642, STKc_STK25-YSK1, Catalytic domain of the Protein Serine/Threonine Kinase, STK25 or Yeast Sps1/Ste20-related kinase 1 Back     alignment and domain information
>gnl|CDD|132972 cd06641, STKc_MST3, Catalytic domain of the Protein Serine/Threonine Kinase, Mammalian Ste20-like protein kinase 3 Back     alignment and domain information
>gnl|CDD|132977 cd06646, STKc_MAP4K5, Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-activated protein kinase kinase kinase kinase 5 Back     alignment and domain information
>gnl|CDD|132991 cd06917, STKc_NAK1_like, Catalytic domain of Fungal Nak1-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173744 cd07847, STKc_CDKL1_4, Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase Like 1 and 4 Back     alignment and domain information
>gnl|CDD|143375 cd07870, STKc_PFTAIRE2, Catalytic domain of the Serine/Threonine Kinase, PFTAIRE-2 kinase Back     alignment and domain information
>gnl|CDD|143374 cd07869, STKc_PFTAIRE1, Catalytic domain of the Serine/Threonine Kinase, PFTAIRE-1 kinase Back     alignment and domain information
>gnl|CDD|223069 PHA03390, pk1, serine/threonine-protein kinase 1; Provisional Back     alignment and domain information
>gnl|CDD|143384 cd07879, STKc_p38delta_MAPK13, Catalytic domain of the Serine/Threonine Kinase, p38delta Mitogen-Activated Protein Kinase Back     alignment and domain information
>gnl|CDD|173690 cd05599, STKc_NDR_like, Catalytic domain of Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173683 cd05592, STKc_nPKC_theta_delta, Catalytic domain of the Protein Serine/Threonine Kinases, Novel Protein Kinase C theta and delta Back     alignment and domain information
>gnl|CDD|132983 cd06652, STKc_MEKK2, Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 2 Back     alignment and domain information
>gnl|CDD|173743 cd07846, STKc_CDKL2_3, Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase Like 2 and 3 Back     alignment and domain information
>gnl|CDD|132976 cd06645, STKc_MAP4K3, Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-activated protein kinase kinase kinase kinase 3 Back     alignment and domain information
>gnl|CDD|173758 cd08218, STKc_Nek1, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 1 Back     alignment and domain information
>gnl|CDD|132966 cd06635, STKc_TAO1, Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 1 Back     alignment and domain information
>gnl|CDD|177649 PLN00009, PLN00009, cyclin-dependent kinase A; Provisional Back     alignment and domain information
>gnl|CDD|132964 cd06633, STKc_TAO3, Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 3 Back     alignment and domain information
>gnl|CDD|133171 cd05039, PTKc_Csk_like, Catalytic domain of C-terminal Src kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|173674 cd05583, STKc_MSK_N, N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase Back     alignment and domain information
>gnl|CDD|143367 cd07862, STKc_CDK6, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 6 Back     alignment and domain information
>gnl|CDD|173637 cd05059, PTKc_Tec_like, Catalytic domain of Tec-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|173723 cd06605, PKc_MAPKK, Catalytic domain of the dual-specificity Protein Kinase, Mitogen-Activated Protein Kinase Kinase Back     alignment and domain information
>gnl|CDD|173739 cd07838, STKc_CDK4_6_like, Catalytic domain of Cyclin-Dependent protein Kinase 4 and 6-like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|133233 cd05102, PTKc_VEGFR3, Catalytic domain of the Protein Tyrosine Kinase, Vascular Endothelial Growth Factor Receptor 3 Back     alignment and domain information
>gnl|CDD|143383 cd07878, STKc_p38beta_MAPK11, Catalytic domain of the Serine/Threonine Kinase, p38beta Mitogen-Activated Protein Kinase Back     alignment and domain information
>gnl|CDD|133234 cd05103, PTKc_VEGFR2, Catalytic domain of the Protein Tyrosine Kinase, Vascular Endothelial Growth Factor Receptor 2 Back     alignment and domain information
>gnl|CDD|88519 cd05618, STKc_aPKC_iota, Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C iota Back     alignment and domain information
>gnl|CDD|173707 cd05616, STKc_cPKC_beta, Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C beta Back     alignment and domain information
>gnl|CDD|173763 cd08223, STKc_Nek4, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 4 Back     alignment and domain information
>gnl|CDD|173750 cd07857, STKc_MPK1, Catalytic domain of the Serine/Threonine Kinase, Fungal Mitogen-Activated Protein Kinase MPK1 Back     alignment and domain information
>gnl|CDD|132970 cd06639, STKc_myosinIIIB, Catalytic domain of the Protein Serine/Threonine Kinase, Class IIIB myosin Back     alignment and domain information
>gnl|CDD|173641 cd05072, PTKc_Lyn, Catalytic domain of the Protein Tyrosine Kinase, Lyn Back     alignment and domain information
>gnl|CDD|173708 cd05617, STKc_aPKC_zeta, Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C zeta Back     alignment and domain information
>gnl|CDD|173696 cd05605, STKc_GRK4_like, Catalytic domain of G protein-coupled Receptor Kinase 4-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|133200 cd05069, PTKc_Yes, Catalytic domain of the Protein Tyrosine Kinase, Yes Back     alignment and domain information
>gnl|CDD|173640 cd05067, PTKc_Lck_Blk, Catalytic domain of the Protein Tyrosine Kinases, Lymphocyte-specific kinase and Blk Back     alignment and domain information
>gnl|CDD|173685 cd05594, STKc_PKB_alpha, Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B alpha Back     alignment and domain information
>gnl|CDD|132960 cd06629, STKc_MAPKKK_Bck1_like, Catalytic domain of fungal Bck1-like MAP Kinase Kinase Kinases Back     alignment and domain information
>gnl|CDD|173679 cd05588, STKc_aPKC, Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C Back     alignment and domain information
>gnl|CDD|132971 cd06640, STKc_MST4, Catalytic domain of the Protein Serine/Threonine Kinase, Mammalian Ste20-like protein kinase 4 Back     alignment and domain information
>gnl|CDD|143361 cd07856, STKc_Sty1_Hog1, Catalytic domain of the Serine/Threonine Kinases, Fungal Mitogen-Activated Protein Kinases Sty1 and Hog1 Back     alignment and domain information
>gnl|CDD|143368 cd07863, STKc_CDK4, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 4 Back     alignment and domain information
>gnl|CDD|133212 cd05081, PTKc_Jak2_Jak3_rpt2, Catalytic (repeat 2) domain of the Protein Tyrosine Kinases, Janus kinases 2 and 3 Back     alignment and domain information
>gnl|CDD|132987 cd06656, STKc_PAK3, Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 3 Back     alignment and domain information
>gnl|CDD|132986 cd06655, STKc_PAK2, Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 2 Back     alignment and domain information
>gnl|CDD|173698 cd05607, STKc_GRK7, Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 7 Back     alignment and domain information
>gnl|CDD|143342 cd07837, STKc_CdkB_plant, Catalytic domain of the Serine/Threonine Kinase, Plant B-type Cyclin-Dependent protein Kinase Back     alignment and domain information
>gnl|CDD|133193 cd05062, PTKc_IGF-1R, Catalytic domain of the Protein Tyrosine Kinase, Insulin-like Growth Factor-1 Receptor Back     alignment and domain information
>gnl|CDD|133199 cd05068, PTKc_Frk_like, Catalytic domain of Fyn-related kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|132969 cd06638, STKc_myosinIIIA, Catalytic domain of the Protein Serine/Threonine Kinase, Class IIIA myosin Back     alignment and domain information
>gnl|CDD|143377 cd07872, STKc_PCTAIRE2, Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-2 kinase Back     alignment and domain information
>gnl|CDD|173633 cd05052, PTKc_Abl, Catalytic domain of the Protein Tyrosine Kinase, Abelson kinase Back     alignment and domain information
>gnl|CDD|132985 cd06654, STKc_PAK1, Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 1 Back     alignment and domain information
>gnl|CDD|173702 cd05611, STKc_Rim15_like, Catalytic domain of fungal Rim15-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|219530 pfam07714, Pkinase_Tyr, Protein tyrosine kinase Back     alignment and domain information
>gnl|CDD|173760 cd08220, STKc_Nek8, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 8 Back     alignment and domain information
>gnl|CDD|240344 PTZ00283, PTZ00283, serine/threonine protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|173694 cd05603, STKc_SGK2, Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 2 Back     alignment and domain information
>gnl|CDD|173749 cd07855, STKc_ERK5, Catalytic domain of the Serine/Threonine Kinase, Extracellular signal-Regulated Kinase 5 Back     alignment and domain information
>gnl|CDD|143354 cd07849, STKc_ERK1_2_like, Catalytic domain of Extracellular signal-Regulated Kinase 1 and 2-like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|143378 cd07873, STKc_PCTAIRE1, Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-1 kinase Back     alignment and domain information
>gnl|CDD|173697 cd05606, STKc_beta_ARK, Catalytic domain of the Protein Serine/Threonine Kinase, beta-adrenergic receptor kinase Back     alignment and domain information
>gnl|CDD|133204 cd05073, PTKc_Hck, Catalytic domain of the Protein Tyrosine Kinase, Hematopoietic cell kinase Back     alignment and domain information
>gnl|CDD|133192 cd05061, PTKc_InsR, Catalytic domain of the Protein Tyrosine Kinase, Insulin Receptor Back     alignment and domain information
>gnl|CDD|133202 cd05071, PTKc_Src, Catalytic domain of the Protein Tyrosine Kinase, Src Back     alignment and domain information
>gnl|CDD|173746 cd07850, STKc_JNK, Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase Back     alignment and domain information
>gnl|CDD|165473 PHA03207, PHA03207, serine/threonine kinase US3; Provisional Back     alignment and domain information
>gnl|CDD|173636 cd05057, PTKc_EGFR_like, Catalytic domain of Epidermal Growth Factor Receptor-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|133214 cd05083, PTKc_Chk, Catalytic domain of the Protein Tyrosine Kinase, Csk homologous kinase Back     alignment and domain information
>gnl|CDD|173703 cd05612, STKc_PRKX_like, Catalytic domain of PRKX-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173695 cd05604, STKc_SGK3, Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 3 Back     alignment and domain information
>gnl|CDD|173768 cd08228, STKc_Nek6, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 6 Back     alignment and domain information
>gnl|CDD|173769 cd08229, STKc_Nek7, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 7 Back     alignment and domain information
>gnl|CDD|173735 cd07831, STKc_MOK, Catalytic domain of the Serine/Threonine Kinase, MAPK/MAK/MRK Overlapping Kinase Back     alignment and domain information
>gnl|CDD|133201 cd05070, PTKc_Fyn_Yrk, Catalytic domain of the Protein Tyrosine Kinases, Fyn and Yrk Back     alignment and domain information
>gnl|CDD|173664 cd05573, STKc_ROCK_NDR_like, Catalytic domain of ROCK- and NDR kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|240233 PTZ00024, PTZ00024, cyclin-dependent protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|173699 cd05608, STKc_GRK1, Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 1 Back     alignment and domain information
>gnl|CDD|173722 cd05633, STKc_GRK3, Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 3 Back     alignment and domain information
>gnl|CDD|133189 cd05058, PTKc_Met_Ron, Catalytic domain of the Protein Tyrosine Kinases, Met and Ron Back     alignment and domain information
>gnl|CDD|133237 cd05106, PTKc_CSF-1R, Catalytic domain of the Protein Tyrosine Kinase, Colony-Stimulating Factor-1 Receptor Back     alignment and domain information
>gnl|CDD|173709 cd05619, STKc_nPKC_theta, Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C theta Back     alignment and domain information
>gnl|CDD|173644 cd05079, PTKc_Jak1_rpt2, Catalytic (repeat 2) domain of the Protein Tyrosine Kinase, Janus kinase 1 Back     alignment and domain information
>gnl|CDD|173719 cd05630, STKc_GRK6, Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 6 Back     alignment and domain information
>gnl|CDD|143346 cd07841, STKc_CDK7, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 7 Back     alignment and domain information
>gnl|CDD|173693 cd05602, STKc_SGK1, Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 1 Back     alignment and domain information
>gnl|CDD|173717 cd05628, STKc_NDR1, Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 1 Back     alignment and domain information
>gnl|CDD|133180 cd05049, PTKc_Trk, Catalytic domain of the Protein Tyrosine Kinases, Tropomyosin Related Kinases Back     alignment and domain information
>gnl|CDD|143364 cd07859, STKc_TDY_MAPK_plant, Catalytic domain of the Serine/Threonine Kinases, TDY Mitogen-Activated Protein Kinases from Plants Back     alignment and domain information
>gnl|CDD|132984 cd06653, STKc_MEKK3_like_1, Catalytic domain of MAP/ERK kinase kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173687 cd05596, STKc_ROCK, Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase Back     alignment and domain information
>gnl|CDD|133186 cd05055, PTKc_PDGFR, Catalytic domain of the Protein Tyrosine Kinases, Platelet Derived Growth Factor Receptors Back     alignment and domain information
>gnl|CDD|143383 cd07878, STKc_p38beta_MAPK11, Catalytic domain of the Serine/Threonine Kinase, p38beta Mitogen-Activated Protein Kinase Back     alignment and domain information
>gnl|CDD|140289 PTZ00263, PTZ00263, protein kinase A catalytic subunit; Provisional Back     alignment and domain information
>gnl|CDD|173716 cd05627, STKc_NDR2, Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 2 Back     alignment and domain information
>gnl|CDD|132990 cd06659, STKc_PAK6, Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 6 Back     alignment and domain information
>gnl|CDD|173721 cd05632, STKc_GRK5, Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 5 Back     alignment and domain information
>gnl|CDD|173770 cd08528, STKc_Nek10, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 10 Back     alignment and domain information
>gnl|CDD|173723 cd06605, PKc_MAPKK, Catalytic domain of the dual-specificity Protein Kinase, Mitogen-Activated Protein Kinase Kinase Back     alignment and domain information
>gnl|CDD|133232 cd05101, PTKc_FGFR2, Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 2 Back     alignment and domain information
>gnl|CDD|133243 cd05112, PTKc_Itk, Catalytic domain of the Protein Tyrosine Kinase, Interleukin-2-inducible T-cell Kinase Back     alignment and domain information
>gnl|CDD|132978 cd06647, STKc_PAK_I, Catalytic domain of the Protein Serine/Threonine Kinase, Group I p21-activated kinase Back     alignment and domain information
>gnl|CDD|173646 cd05087, PTKc_Aatyk1_Aatyk3, Catalytic domain of the Protein Tyrosine Kinases, Apoptosis-associated tyrosine kinases 1 and 3 Back     alignment and domain information
>gnl|CDD|133179 cd05048, PTKc_Ror, Catalytic Domain of the Protein Tyrosine Kinases, Receptor tyrosine kinase-like Orphan Receptors Back     alignment and domain information
>gnl|CDD|173710 cd05620, STKc_nPKC_delta, Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C delta Back     alignment and domain information
>gnl|CDD|132975 cd06644, STKc_STK10_LOK, Catalytic domain of the Protein Serine/Threonine Kinase, STK10 or Lymphocyte-oriented kinase Back     alignment and domain information
>gnl|CDD|143341 cd07836, STKc_Pho85, Catalytic domain of the Serine/Threonine Kinase, Fungal Cyclin-Dependent protein Kinase Pho85 Back     alignment and domain information
>gnl|CDD|143384 cd07879, STKc_p38delta_MAPK13, Catalytic domain of the Serine/Threonine Kinase, p38delta Mitogen-Activated Protein Kinase Back     alignment and domain information
>gnl|CDD|132970 cd06639, STKc_myosinIIIB, Catalytic domain of the Protein Serine/Threonine Kinase, Class IIIB myosin Back     alignment and domain information
>gnl|CDD|133199 cd05068, PTKc_Frk_like, Catalytic domain of Fyn-related kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|143364 cd07859, STKc_TDY_MAPK_plant, Catalytic domain of the Serine/Threonine Kinases, TDY Mitogen-Activated Protein Kinases from Plants Back     alignment and domain information
>gnl|CDD|132978 cd06647, STKc_PAK_I, Catalytic domain of the Protein Serine/Threonine Kinase, Group I p21-activated kinase Back     alignment and domain information
>gnl|CDD|173745 cd07848, STKc_CDKL5, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase Like 5 Back     alignment and domain information
>gnl|CDD|133217 cd05086, PTKc_Aatyk2, Catalytic domain of the Protein Tyrosine Kinase, Apoptosis-associated tyrosine kinase 2 Back     alignment and domain information
>gnl|CDD|173657 cd05113, PTKc_Btk_Bmx, Catalytic domain of the Protein Tyrosine Kinases, Bruton's tyrosine kinase and Bone marrow kinase on the X chromosome Back     alignment and domain information
>gnl|CDD|173658 cd05114, PTKc_Tec_Rlk, Catalytic domain of the Protein Tyrosine Kinases, Tyrosine kinase expressed in hepatocellular carcinoma and Resting lymphocyte kinase Back     alignment and domain information
>gnl|CDD|173639 cd05066, PTKc_EphR_A, Catalytic domain of the Protein Tyrosine Kinases, Class EphA Ephrin Receptors Back     alignment and domain information
>gnl|CDD|133219 cd05088, PTKc_Tie2, Catalytic domain of the Protein Tyrosine Kinase, Tie2 Back     alignment and domain information
>gnl|CDD|173675 cd05584, STKc_p70S6K, Catalytic domain of the Protein Serine/Threonine Kinase, 70 kDa ribosomal protein S6 kinase Back     alignment and domain information
>gnl|CDD|173700 cd05609, STKc_MAST, Catalytic domain of the Protein Serine/Threonine Kinase, Microtubule-associated serine/threonine kinase Back     alignment and domain information
>gnl|CDD|173704 cd05613, STKc_MSK1_N, N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase 1 Back     alignment and domain information
>gnl|CDD|133187 cd05056, PTKc_FAK, Catalytic domain of the Protein Tyrosine Kinase, Focal Adhesion Kinase Back     alignment and domain information
>gnl|CDD|173631 cd05045, PTKc_RET, Catalytic domain of the Protein Tyrosine Kinase, REarranged during Transfection protein Back     alignment and domain information
>gnl|CDD|173649 cd05093, PTKc_TrkB, Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase B Back     alignment and domain information
>gnl|CDD|133165 cd05033, PTKc_EphR, Catalytic domain of Ephrin Receptor Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|173705 cd05614, STKc_MSK2_N, N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase 2 Back     alignment and domain information
>gnl|CDD|143381 cd07876, STKc_JNK2, Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 2 Back     alignment and domain information
>gnl|CDD|132951 cd06620, PKc_MAPKK_Byr1_like, Catalytic domain of fungal Byr1-like dual-specificity MAP kinase kinases Back     alignment and domain information
>gnl|CDD|133213 cd05082, PTKc_Csk, Catalytic domain of the Protein Tyrosine Kinase, C-terminal Src kinase Back     alignment and domain information
>gnl|CDD|133191 cd05060, PTKc_Syk_like, Catalytic domain of Spleen Tyrosine Kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|173652 cd05100, PTKc_FGFR3, Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 3 Back     alignment and domain information
>gnl|CDD|165478 PHA03212, PHA03212, serine/threonine kinase US3; Provisional Back     alignment and domain information
>gnl|CDD|133240 cd05109, PTKc_HER2, Catalytic domain of the Protein Tyrosine Kinase, HER2 Back     alignment and domain information
>gnl|CDD|173656 cd05111, PTK_HER3, Pseudokinase domain of the Protein Tyrosine Kinase, HER3 Back     alignment and domain information
>gnl|CDD|173673 cd05582, STKc_RSK_N, N-terminal catalytic domain of the Protein Serine/Threonine Kinase, 90 kDa ribosomal protein S6 kinase Back     alignment and domain information
>gnl|CDD|173677 cd05586, STKc_Sck1_like, Catalytic domain of Suppressor of loss of cAMP-dependent protein kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173642 cd05075, PTKc_Axl, Catalytic domain of the Protein Tyrosine Kinase, Axl Back     alignment and domain information
>gnl|CDD|133220 cd05089, PTKc_Tie1, Catalytic domain of the Protein Tyrosine Kinase, Tie1 Back     alignment and domain information
>gnl|CDD|214568 smart00221, STYKc, Protein kinase; unclassified specificity Back     alignment and domain information
>gnl|CDD|177649 PLN00009, PLN00009, cyclin-dependent kinase A; Provisional Back     alignment and domain information
>gnl|CDD|133171 cd05039, PTKc_Csk_like, Catalytic domain of C-terminal Src kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|132969 cd06638, STKc_myosinIIIA, Catalytic domain of the Protein Serine/Threonine Kinase, Class IIIA myosin Back     alignment and domain information
>gnl|CDD|133205 cd05074, PTKc_Tyro3, Catalytic domain of the Protein Tyrosine Kinase, Tyro3 Back     alignment and domain information
>gnl|CDD|132953 cd06622, PKc_MAPKK_PBS2_like, Catalytic domain of fungal PBS2-like dual-specificity MAP kinase kinases Back     alignment and domain information
>gnl|CDD|140293 PTZ00267, PTZ00267, NIMA-related protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|173745 cd07848, STKc_CDKL5, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase Like 5 Back     alignment and domain information
>gnl|CDD|133229 cd05098, PTKc_FGFR1, Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 1 Back     alignment and domain information
>gnl|CDD|197581 smart00219, TyrKc, Tyrosine kinase, catalytic domain Back     alignment and domain information
>gnl|CDD|234389 TIGR03903, TOMM_kin_cyc, TOMM system kinase/cyclase fusion protein Back     alignment and domain information
>gnl|CDD|223009 PHA03211, PHA03211, serine/threonine kinase US3; Provisional Back     alignment and domain information
>gnl|CDD|173736 cd07832, STKc_CCRK, Catalytic domain of the Serine/Threonine Kinase, Cell Cycle-Related Kinase Back     alignment and domain information
>gnl|CDD|173718 cd05629, STKc_NDR_like_fungal, Catalytic domain of Fungal Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173748 cd07853, STKc_NLK, Catalytic domain of the Serine/Threonine Kinase, Nemo-Like Kinase Back     alignment and domain information
>gnl|CDD|173725 cd06608, STKc_myosinIII_like, Catalytic domain of Class III myosin-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173720 cd05631, STKc_GRK4, Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 4 Back     alignment and domain information
>gnl|CDD|132989 cd06658, STKc_PAK5, Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 5 Back     alignment and domain information
>gnl|CDD|132964 cd06633, STKc_TAO3, Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 3 Back     alignment and domain information
>gnl|CDD|132987 cd06656, STKc_PAK3, Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 3 Back     alignment and domain information
>gnl|CDD|173698 cd05607, STKc_GRK7, Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 7 Back     alignment and domain information
>gnl|CDD|132985 cd06654, STKc_PAK1, Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 1 Back     alignment and domain information
>gnl|CDD|173722 cd05633, STKc_GRK3, Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 3 Back     alignment and domain information
>gnl|CDD|234389 TIGR03903, TOMM_kin_cyc, TOMM system kinase/cyclase fusion protein Back     alignment and domain information
>gnl|CDD|133230 cd05099, PTKc_FGFR4, Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 4 Back     alignment and domain information
>gnl|CDD|143380 cd07875, STKc_JNK1, Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 1 Back     alignment and domain information
>gnl|CDD|133167 cd05035, PTKc_Axl_like, Catalytic Domain of Axl-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|173630 cd05044, PTKc_c-ros, Catalytic domain of the Protein Tyrosine Kinase, C-ros Back     alignment and domain information
>gnl|CDD|143379 cd07874, STKc_JNK3, Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 3 Back     alignment and domain information
>gnl|CDD|173741 cd07843, STKc_CDC2L1, Catalytic domain of the Serine/Threonine Kinase, Cell Division Cycle 2-like 1 Back     alignment and domain information
>gnl|CDD|132988 cd06657, STKc_PAK4, Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 4 Back     alignment and domain information
>gnl|CDD|173626 cd05034, PTKc_Src_like, Catalytic domain of Src kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|173632 cd05051, PTKc_DDR, Catalytic domain of the Protein Tyrosine Kinases, Discoidin Domain Receptors Back     alignment and domain information
>gnl|CDD|173629 cd05041, PTKc_Fes_like, Catalytic domain of Fes-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|173729 cd06617, PKc_MKK3_6, Catalytic domain of the dual-specificity Protein Kinases, MAP kinase kinases 3 and 6 Back     alignment and domain information
>gnl|CDD|173650 cd05094, PTKc_TrkC, Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase C Back     alignment and domain information
>gnl|CDD|132949 cd06618, PKc_MKK7, Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 7 Back     alignment and domain information
>gnl|CDD|132947 cd06616, PKc_MKK4, Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 4 Back     alignment and domain information
>gnl|CDD|133174 cd05042, PTKc_Aatyk, Catalytic domain of the Protein Tyrosine Kinases, Apoptosis-associated tyrosine kinases Back     alignment and domain information
>gnl|CDD|173654 cd05108, PTKc_EGFR, Catalytic domain of the Protein Tyrosine Kinase, Epidermal Growth Factor Receptor Back     alignment and domain information
>gnl|CDD|173665 cd05574, STKc_phototropin_like, Catalytic domain of Phototropin-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173692 cd05601, STKc_CRIK, Catalytic domain of the Protein Serine/Threonine Kinase, Citron Rho-interacting kinase Back     alignment and domain information
>gnl|CDD|173713 cd05624, STKc_MRCK_beta, Catalytic domain of the Protein Serine/Threonine Kinase, DMPK-related cell division control protein 42 binding kinase beta Back     alignment and domain information
>gnl|CDD|143382 cd07877, STKc_p38alpha_MAPK14, Catalytic domain of the Serine/Threonine Kinase, p38alpha Mitogen-Activated Protein Kinase Back     alignment and domain information
>gnl|CDD|173629 cd05041, PTKc_Fes_like, Catalytic domain of Fes-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|173648 cd05092, PTKc_TrkA, Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase A Back     alignment and domain information
>gnl|CDD|173638 cd05065, PTKc_EphR_B, Catalytic domain of the Protein Tyrosine Kinases, Class EphB Ephrin Receptors Back     alignment and domain information
>gnl|CDD|133235 cd05104, PTKc_Kit, Catalytic domain of the Protein Tyrosine Kinase, Kit Back     alignment and domain information
>gnl|CDD|133246 cd05115, PTKc_Zap-70, Catalytic domain of the Protein Tyrosine Kinase, Zeta-chain-associated protein of 70kDa Back     alignment and domain information
>gnl|CDD|133194 cd05063, PTKc_EphR_A2, Catalytic domain of the Protein Tyrosine Kinase, Ephrin Receptor A2 Back     alignment and domain information
>gnl|CDD|132946 cd06615, PKc_MEK, Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase Back     alignment and domain information
>gnl|CDD|143378 cd07873, STKc_PCTAIRE1, Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-1 kinase Back     alignment and domain information
>gnl|CDD|173697 cd05606, STKc_beta_ARK, Catalytic domain of the Protein Serine/Threonine Kinase, beta-adrenergic receptor kinase Back     alignment and domain information
>gnl|CDD|183880 PRK13184, pknD, serine/threonine-protein kinase; Reviewed Back     alignment and domain information
>gnl|CDD|173655 cd05110, PTKc_HER4, Catalytic domain of the Protein Tyrosine Kinase, HER4 Back     alignment and domain information
>gnl|CDD|173647 cd05091, PTKc_Ror2, Catalytic domain of the Protein Tyrosine Kinase, Receptor tyrosine kinase-like Orphan Receptor 2 Back     alignment and domain information
>gnl|CDD|173651 cd05095, PTKc_DDR2, Catalytic domain of the Protein Tyrosine Kinase, Discoidin Domain Receptor 2 Back     alignment and domain information
>gnl|CDD|178763 PLN03224, PLN03224, probable serine/threonine protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|173667 cd05576, STKc_RPK118_like, Catalytic domain of the Protein Serine/Threonine Kinases, RPK118 and similar proteins Back     alignment and domain information
>gnl|CDD|132968 cd06637, STKc_TNIK, Catalytic domain of the Protein Serine/Threonine Kinase, Traf2- and Nck-interacting kinase Back     alignment and domain information
>gnl|CDD|132965 cd06634, STKc_TAO2, Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 2 Back     alignment and domain information
>gnl|CDD|143376 cd07871, STKc_PCTAIRE3, Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-3 kinase Back     alignment and domain information
>gnl|CDD|173637 cd05059, PTKc_Tec_like, Catalytic domain of Tec-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|132986 cd06655, STKc_PAK2, Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 2 Back     alignment and domain information
>gnl|CDD|132951 cd06620, PKc_MAPKK_Byr1_like, Catalytic domain of fungal Byr1-like dual-specificity MAP kinase kinases Back     alignment and domain information
>gnl|CDD|132980 cd06649, PKc_MEK2, Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase 2 Back     alignment and domain information
>gnl|CDD|133247 cd05116, PTKc_Syk, Catalytic domain of the Protein Tyrosine Kinase, Spleen tyrosine kinase Back     alignment and domain information
>gnl|CDD|132991 cd06917, STKc_NAK1_like, Catalytic domain of Fungal Nak1-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|215638 PLN03225, PLN03225, Serine/threonine-protein kinase SNT7; Provisional Back     alignment and domain information
>gnl|CDD|165291 PHA02988, PHA02988, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|132981 cd06650, PKc_MEK1, Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase 1 Back     alignment and domain information
>gnl|CDD|140307 PTZ00284, PTZ00284, protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|132967 cd06636, STKc_MAP4K4_6, Catalytic domain of the Protein Serine/Threonine Kinases, Mitogen-Activated Protein Kinase Kinase Kinase Kinase 4 and 6 Back     alignment and domain information
>gnl|CDD|132966 cd06635, STKc_TAO1, Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 1 Back     alignment and domain information
>gnl|CDD|88524 cd05623, STKc_MRCK_alpha, Catalytic domain of the Protein Serine/Threonine Kinase, DMPK-related cell division control protein 42 binding kinase alpha Back     alignment and domain information
>gnl|CDD|173688 cd05597, STKc_DMPK_like, Catalytic domain of Myotonic Dystrophy protein kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|143363 cd07858, STKc_TEY_MAPK_plant, Catalytic domain of the Serine/Threonine Kinases, TEY Mitogen-Activated Protein Kinases from Plants Back     alignment and domain information
>gnl|CDD|133214 cd05083, PTKc_Chk, Catalytic domain of the Protein Tyrosine Kinase, Csk homologous kinase Back     alignment and domain information
>gnl|CDD|143380 cd07875, STKc_JNK1, Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 1 Back     alignment and domain information
>gnl|CDD|133216 cd05085, PTKc_Fer, Catalytic domain of the Protein Tyrosine Kinase, Fer Back     alignment and domain information
>gnl|CDD|133227 cd05096, PTKc_DDR1, Catalytic domain of the Protein Tyrosine Kinase, Discoidin Domain Receptor 1 Back     alignment and domain information
>gnl|CDD|173653 cd05105, PTKc_PDGFR_alpha, Catalytic domain of the Protein Tyrosine Kinase, Platelet Derived Growth Factor Receptor alpha Back     alignment and domain information
>gnl|CDD|133175 cd05043, PTK_Ryk, Pseudokinase domain of Ryk (Receptor related to tyrosine kinase) Back     alignment and domain information
>gnl|CDD|133228 cd05097, PTKc_DDR_like, Catalytic domain of Discoidin Domain Receptor-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|88330 cd05047, PTKc_Tie, Catalytic domain of Tie Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|143371 cd07866, STKc_BUR1, Catalytic domain of the Serine/Threonine Kinase, Fungal Cyclin-Dependent protein Kinase Bypass UAS Requirement 1 and similar proteins Back     alignment and domain information
>gnl|CDD|173616 PTZ00426, PTZ00426, cAMP-dependent protein kinase catalytic subunit; Provisional Back     alignment and domain information
>gnl|CDD|173738 cd07835, STKc_CDK1_like, Catalytic domain of Cyclin-Dependent protein Kinase 1-like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173744 cd07847, STKc_CDKL1_4, Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase Like 1 and 4 Back     alignment and domain information
>gnl|CDD|173746 cd07850, STKc_JNK, Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase Back     alignment and domain information
>gnl|CDD|133213 cd05082, PTKc_Csk, Catalytic domain of the Protein Tyrosine Kinase, C-terminal Src kinase Back     alignment and domain information
>gnl|CDD|132953 cd06622, PKc_MAPKK_PBS2_like, Catalytic domain of fungal PBS2-like dual-specificity MAP kinase kinases Back     alignment and domain information
>gnl|CDD|173645 cd05084, PTKc_Fes, Catalytic domain of the Protein Tyrosine Kinase, Fes Back     alignment and domain information
>gnl|CDD|223733 COG0661, AarF, Predicted unusual protein kinase [General function prediction only] Back     alignment and domain information
>gnl|CDD|234331 TIGR03724, arch_bud32, Kae1-associated kinase Bud32 Back     alignment and domain information
>gnl|CDD|173742 cd07845, STKc_CDK10, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 10 Back     alignment and domain information
>gnl|CDD|173689 cd05598, STKc_LATS, Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor Back     alignment and domain information
>gnl|CDD|132974 cd06643, STKc_SLK, Catalytic domain of the Protein Serine/Threonine Kinase, Ste20-like kinase Back     alignment and domain information
>gnl|CDD|173712 cd05622, STKc_ROCK1, Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 1 Back     alignment and domain information
>gnl|CDD|173729 cd06617, PKc_MKK3_6, Catalytic domain of the dual-specificity Protein Kinases, MAP kinase kinases 3 and 6 Back     alignment and domain information
>gnl|CDD|132947 cd06616, PKc_MKK4, Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 4 Back     alignment and domain information
>gnl|CDD|132981 cd06650, PKc_MEK1, Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase 1 Back     alignment and domain information
>gnl|CDD|133175 cd05043, PTK_Ryk, Pseudokinase domain of Ryk (Receptor related to tyrosine kinase) Back     alignment and domain information
>gnl|CDD|173333 PTZ00036, PTZ00036, glycogen synthase kinase; Provisional Back     alignment and domain information
>gnl|CDD|133221 cd05090, PTKc_Ror1, Catalytic domain of the Protein Tyrosine Kinase, Receptor tyrosine kinase-like Orphan Receptor 1 Back     alignment and domain information
>gnl|CDD|177557 PHA03209, PHA03209, serine/threonine kinase US3; Provisional Back     alignment and domain information
>gnl|CDD|132938 cd06607, STKc_TAO, Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids proteins Back     alignment and domain information
>gnl|CDD|88330 cd05047, PTKc_Tie, Catalytic domain of Tie Protein Tyrosine Kinases Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 305
KOG0575|consensus 592 100.0
KOG0588|consensus 786 100.0
KOG0615|consensus475 100.0
KOG0583|consensus370 100.0
KOG0598|consensus357 100.0
KOG0581|consensus364 100.0
KOG0616|consensus355 100.0
KOG0033|consensus355 100.0
KOG0592|consensus 604 100.0
KOG0595|consensus429 100.0
KOG0611|consensus 668 100.0
KOG0605|consensus550 100.0
KOG0597|consensus 808 100.0
KOG4717|consensus 864 100.0
KOG0578|consensus550 100.0
KOG0591|consensus375 100.0
KOG0610|consensus459 100.0
KOG0580|consensus281 100.0
KOG0694|consensus694 100.0
KOG0032|consensus382 100.0
KOG0599|consensus411 100.0
KOG0198|consensus313 100.0
KOG0582|consensus 516 100.0
KOG0589|consensus426 100.0
KOG0586|consensus 596 100.0
KOG0585|consensus576 100.0
cd05612291 STKc_PRKX_like Catalytic domain of PRKX-like Prote 100.0
PTZ00263329 protein kinase A catalytic subunit; Provisional 100.0
KOG0201|consensus467 100.0
PTZ00426340 cAMP-dependent protein kinase catalytic subunit; P 100.0
cd05571323 STKc_PKB Catalytic domain of the Protein Serine/Th 100.0
cd05585312 STKc_YPK1_like Catalytic domain of Yeast Protein K 100.0
KOG0593|consensus396 100.0
cd05595323 STKc_PKB_beta Catalytic domain of the Protein Seri 100.0
cd05593328 STKc_PKB_gamma Catalytic domain of the Protein Ser 100.0
cd05584323 STKc_p70S6K Catalytic domain of the Protein Serine 100.0
cd05590320 STKc_nPKC_eta Catalytic domain of the Protein Seri 100.0
KOG0690|consensus516 100.0
cd05582318 STKc_RSK_N N-terminal catalytic domain of the Prot 100.0
KOG0604|consensus400 100.0
cd05620316 STKc_nPKC_delta Catalytic domain of the Protein Se 100.0
KOG0661|consensus 538 100.0
cd05591321 STKc_nPKC_epsilon Catalytic domain of the Protein 100.0
cd05628363 STKc_NDR1 Catalytic domain of the Protein Serine/T 100.0
cd05589324 STKc_PKN Catalytic domain of the Protein Serine/Th 100.0
cd05588329 STKc_aPKC Catalytic domain of the Protein Serine/T 100.0
cd05594325 STKc_PKB_alpha Catalytic domain of the Protein Ser 100.0
cd05619316 STKc_nPKC_theta Catalytic domain of the Protein Se 100.0
cd05570318 STKc_PKC Catalytic domain of the Protein Serine/Th 100.0
cd07848287 STKc_CDKL5 Catalytic domain of the Serine/Threonin 100.0
cd05631285 STKc_GRK4 Catalytic domain of the Protein Serine/T 100.0
KOG0600|consensus560 100.0
cd05575323 STKc_SGK Catalytic domain of the Protein Serine/Th 100.0
KOG0696|consensus683 100.0
cd05599364 STKc_NDR_like Catalytic domain of Nuclear Dbf2-Rel 100.0
cd05600333 STKc_Sid2p_Dbf2p Catalytic domain of Fungal Sid2p- 100.0
PHA02988283 hypothetical protein; Provisional 100.0
PTZ00267478 NIMA-related protein kinase; Provisional 100.0
cd05596370 STKc_ROCK Catalytic domain of the Protein Serine/T 100.0
cd05592316 STKc_nPKC_theta_delta Catalytic domain of the Prot 100.0
KOG0607|consensus463 100.0
cd05629377 STKc_NDR_like_fungal Catalytic domain of Fungal Nu 100.0
KOG0192|consensus362 100.0
cd06649331 PKc_MEK2 Catalytic domain of the dual-specificity 100.0
cd05626381 STKc_LATS2 Catalytic domain of the Protein Serine/ 100.0
cd05625382 STKc_LATS1 Catalytic domain of the Protein Serine/ 100.0
cd05587324 STKc_cPKC Catalytic domain of the Protein Serine/T 100.0
cd07871288 STKc_PCTAIRE3 Catalytic domain of the Serine/Threo 100.0
cd05618329 STKc_aPKC_iota Catalytic domain of the Protein Ser 100.0
cd05604325 STKc_SGK3 Catalytic domain of the Protein Serine/T 100.0
cd05608280 STKc_GRK1 Catalytic domain of the Protein Serine/T 100.0
cd05602325 STKc_SGK1 Catalytic domain of the Protein Serine/T 100.0
cd05627360 STKc_NDR2 Catalytic domain of the Protein Serine/T 100.0
cd05603321 STKc_SGK2 Catalytic domain of the Protein Serine/T 100.0
cd05598376 STKc_LATS Catalytic domain of the Protein Serine/T 100.0
cd05605285 STKc_GRK4_like Catalytic domain of G protein-coupl 100.0
cd05614332 STKc_MSK2_N N-terminal catalytic domain of the Pro 100.0
cd05573350 STKc_ROCK_NDR_like Catalytic domain of ROCK- and N 100.0
KOG0574|consensus 502 100.0
cd05616323 STKc_cPKC_beta Catalytic domain of the Protein Ser 100.0
cd05621370 STKc_ROCK2 Catalytic domain of the Protein Serine/ 100.0
KOG0614|consensus732 100.0
cd05617327 STKc_aPKC_zeta Catalytic domain of the Protein Ser 100.0
KOG0612|consensus 1317 100.0
KOG4279|consensus 1226 100.0
KOG0579|consensus 1187 100.0
cd05607277 STKc_GRK7 Catalytic domain of the Protein Serine/T 100.0
KOG4645|consensus1509 100.0
cd06625263 STKc_MEKK3_like Catalytic domain of MAP/ERK kinase 100.0
cd07869303 STKc_PFTAIRE1 Catalytic domain of the Serine/Threo 100.0
KOG0663|consensus419 100.0
cd05601330 STKc_CRIK Catalytic domain of the Protein Serine/T 100.0
KOG4721|consensus 904 100.0
cd05622371 STKc_ROCK1 Catalytic domain of the Protein Serine/ 100.0
cd06650333 PKc_MEK1 Catalytic domain of the dual-specificity 100.0
cd05615323 STKc_cPKC_alpha Catalytic domain of the Protein Se 99.98
cd07859338 STKc_TDY_MAPK_plant Catalytic domain of the Serine 99.98
cd08227327 PK_STRAD_alpha Pseudokinase domain of STE20-relate 99.98
cd05580290 STKc_PKA Catalytic domain of the Protein Serine/Th 99.98
PTZ00036440 glycogen synthase kinase; Provisional 99.98
KOG0660|consensus359 99.98
PLN00034353 mitogen-activated protein kinase kinase; Provision 99.98
KOG0577|consensus 948 99.98
KOG0603|consensus 612 99.98
cd05586330 STKc_Sck1_like Catalytic domain of Suppressor of l 99.98
KOG0197|consensus468 99.98
cd05630285 STKc_GRK6 Catalytic domain of the Protein Serine/T 99.97
PHA03212391 serine/threonine kinase US3; Provisional 99.97
cd05572262 STKc_cGK_PKG Catalytic domain of the Protein Serin 99.97
cd08529256 STKc_FA2-like Catalytic domain of the Protein Seri 99.97
cd06631265 STKc_YSK4 Catalytic domain of the Protein Serine/T 99.97
cd06628267 STKc_MAPKKK_Byr2_like Catalytic domain of fungal B 99.97
cd07862290 STKc_CDK6 Catalytic domain of the Serine/Threonine 99.97
cd05574316 STKc_phototropin_like Catalytic domain of Phototro 99.97
KOG0596|consensus677 99.97
cd06615308 PKc_MEK Catalytic domain of the dual-specificity P 99.97
cd06655296 STKc_PAK2 Catalytic domain of the Protein Serine/T 99.97
cd05597331 STKc_DMPK_like Catalytic domain of Myotonic Dystro 99.97
KOG0659|consensus318 99.97
KOG0603|consensus612 99.97
PHA03207392 serine/threonine kinase US3; Provisional 99.97
cd05623332 STKc_MRCK_alpha Catalytic domain of the Protein Se 99.97
cd06611280 STKc_SLK_like Catalytic domain of Ste20-like kinas 99.97
cd06645267 STKc_MAP4K3 Catalytic domain of the Protein Serine 99.97
cd08221256 STKc_Nek9 Catalytic domain of the Protein Serine/T 99.97
cd06609274 STKc_MST3_like Catalytic domain of Mammalian Ste20 99.97
PHA03390267 pk1 serine/threonine-protein kinase 1; Provisional 99.97
cd08223257 STKc_Nek4 Catalytic domain of the Protein Serine/T 99.97
cd06643282 STKc_SLK Catalytic domain of the Protein Serine/Th 99.97
cd08218256 STKc_Nek1 Catalytic domain of the Protein Serine/T 99.97
cd08220256 STKc_Nek8 Catalytic domain of the Protein Serine/T 99.97
cd06654296 STKc_PAK1 Catalytic domain of the Protein Serine/T 99.97
cd05577277 STKc_GRK Catalytic domain of the Protein Serine/Th 99.97
cd05632285 STKc_GRK5 Catalytic domain of the Protein Serine/T 99.97
PTZ00266 1021 NIMA-related protein kinase; Provisional 99.97
cd07872309 STKc_PCTAIRE2 Catalytic domain of the Serine/Threo 99.97
cd05609305 STKc_MAST Catalytic domain of the Protein Serine/T 99.97
cd06612256 STKc_MST1_2 Catalytic domain of the Protein Serine 99.97
cd07875364 STKc_JNK1 Catalytic domain of the Serine/Threonine 99.97
cd05624331 STKc_MRCK_beta Catalytic domain of the Protein Ser 99.97
cd06644292 STKc_STK10_LOK Catalytic domain of the Protein Ser 99.97
cd06610267 STKc_OSR1_SPAK Catalytic domain of the Protein Ser 99.97
cd06613262 STKc_MAP4K3_like Catalytic domain of Mitogen-activ 99.97
cd08225257 STKc_Nek5 Catalytic domain of the Protein Serine/T 99.97
cd07863288 STKc_CDK4 Catalytic domain of the Serine/Threonine 99.97
cd06637272 STKc_TNIK Catalytic domain of the Protein Serine/T 99.97
cd07873301 STKc_PCTAIRE1 Catalytic domain of the Serine/Threo 99.97
cd05611260 STKc_Rim15_like Catalytic domain of fungal Rim15-l 99.97
cd07876359 STKc_JNK2 Catalytic domain of the Serine/Threonine 99.97
PTZ00284467 protein kinase; Provisional 99.97
cd06630268 STKc_MEKK1 Catalytic domain of the Protein Serine/ 99.97
cd05578258 STKc_Yank1 Catalytic domain of the Protein Serine/ 99.97
cd08219255 STKc_Nek3 Catalytic domain of the Protein Serine/T 99.97
cd07868317 STKc_CDK8 Catalytic domain of the Serine/Threonine 99.97
cd07853372 STKc_NLK Catalytic domain of the Serine/Threonine 99.97
PTZ00283496 serine/threonine protein kinase; Provisional 99.97
cd07861285 STKc_CDK1_euk Catalytic domain of the Serine/Threo 99.97
cd06622286 PKc_MAPKK_PBS2_like Catalytic domain of fungal PBS 99.97
cd06640277 STKc_MST4 Catalytic domain of the Protein Serine/T 99.97
cd06636282 STKc_MAP4K4_6 Catalytic domain of the Protein Seri 99.97
cd07847286 STKc_CDKL1_4 Catalytic domain of the Serine/Threon 99.97
PHA03211461 serine/threonine kinase US3; Provisional 99.97
cd06658292 STKc_PAK5 Catalytic domain of the Protein Serine/T 99.97
cd08226328 PK_STRAD_beta Pseudokinase domain of STE20-related 99.97
cd06648285 STKc_PAK_II Catalytic domain of the Protein Serine 99.97
cd06646267 STKc_MAP4K5 Catalytic domain of the Protein Serine 99.97
cd05606278 STKc_beta_ARK Catalytic domain of the Protein Seri 99.97
cd06656297 STKc_PAK3 Catalytic domain of the Protein Serine/T 99.97
cd07874355 STKc_JNK3 Catalytic domain of the Serine/Threonine 99.97
cd06608275 STKc_myosinIII_like Catalytic domain of Class III 99.97
KOG0658|consensus364 99.97
cd06651266 STKc_MEKK3 Catalytic domain of the Protein Serine/ 99.97
cd05579265 STKc_MAST_like Catalytic domain of Microtubule-ass 99.97
KOG0608|consensus1034 99.97
cd05102338 PTKc_VEGFR3 Catalytic domain of the Protein Tyrosi 99.97
cd06659297 STKc_PAK6 Catalytic domain of the Protein Serine/T 99.97
cd06632258 STKc_MEKK1_plant Catalytic domain of the Protein S 99.97
cd06652265 STKc_MEKK2 Catalytic domain of the Protein Serine/ 99.97
cd07860284 STKc_CDK2_3 Catalytic domain of the Serine/Threoni 99.97
cd06624268 STKc_ASK Catalytic domain of the Protein Serine/Th 99.97
cd07832286 STKc_CCRK Catalytic domain of the Serine/Threonine 99.97
cd08216314 PK_STRAD Pseudokinase domain of STE20-related kina 99.97
cd06614286 STKc_PAK Catalytic domain of the Protein Serine/Th 99.97
cd05048283 PTKc_Ror Catalytic Domain of the Protein Tyrosine 99.97
cd05078258 PTK_Jak2_Jak3_rpt1 Pseudokinase (repeat 1) domain 99.97
cd06639291 STKc_myosinIIIB Catalytic domain of the Protein Se 99.97
cd05064266 PTKc_EphR_A10 Catalytic domain of the Protein Tyro 99.97
cd06619279 PKc_MKK5 Catalytic domain of the dual-specificity 99.97
cd06642277 STKc_STK25-YSK1 Catalytic domain of the Protein Se 99.97
cd07839284 STKc_CDK5 Catalytic domain of the Serine/Threonine 99.97
KOG0986|consensus591 99.97
cd06605265 PKc_MAPKK Catalytic domain of the dual-specificity 99.97
cd08217265 STKc_Nek2 Catalytic domain of the Protein Serine/T 99.96
cd07878343 STKc_p38beta_MAPK11 Catalytic domain of the Serine 99.96
PHA03209357 serine/threonine kinase US3; Provisional 99.96
cd05123250 STKc_AGC Catalytic domain of AGC family Protein Se 99.96
cd06620284 PKc_MAPKK_Byr1_like Catalytic domain of fungal Byr 99.96
cd06641277 STKc_MST3 Catalytic domain of the Protein Serine/T 99.96
KOG1026|consensus774 99.96
KOG1989|consensus 738 99.96
cd06657292 STKc_PAK4 Catalytic domain of the Protein Serine/T 99.96
cd06607307 STKc_TAO Catalytic domain of the Protein Serine/Th 99.96
cd06621287 PKc_MAPKK_Pek1_like Catalytic domain of fungal Pek 99.96
cd05096304 PTKc_DDR1 Catalytic domain of the Protein Tyrosine 99.96
cd05114256 PTKc_Tec_Rlk Catalytic domain of the Protein Tyros 99.96
KOG0594|consensus323 99.96
cd07867317 STKc_CDC2L6 Catalytic domain of Serine/Threonine K 99.96
cd05052263 PTKc_Abl Catalytic domain of the Protein Tyrosine 99.96
KOG0584|consensus 632 99.96
cd07846286 STKc_CDKL2_3 Catalytic domain of the Serine/Threon 99.96
cd06629272 STKc_MAPKKK_Bck1_like Catalytic domain of fungal B 99.96
cd05049280 PTKc_Trk Catalytic domain of the Protein Tyrosine 99.96
cd05581280 STKc_PDK1 Catalytic domain of the Protein Serine/T 99.96
cd05633279 STKc_GRK3 Catalytic domain of the Protein Serine/T 99.96
cd06633313 STKc_TAO3 Catalytic domain of the Protein Serine/T 99.96
PF00069260 Pkinase: Protein kinase domain Protein kinase; unc 99.96
cd05093288 PTKc_TrkB Catalytic domain of the Protein Tyrosine 99.96
cd07833288 STKc_CDKL Catalytic domain of Cyclin-Dependent pro 99.96
cd06638286 STKc_myosinIIIA Catalytic domain of the Protein Se 99.96
KOG0695|consensus593 99.96
cd06626264 STKc_MEKK4 Catalytic domain of the Protein Serine/ 99.96
cd06647293 STKc_PAK_I Catalytic domain of the Protein Serine/ 99.96
cd08215258 STKc_Nek Catalytic domain of the Protein Serine/Th 99.96
cd05106374 PTKc_CSF-1R Catalytic domain of the Protein Tyrosi 99.96
PLN00009294 cyclin-dependent kinase A; Provisional 99.96
cd05077262 PTK_Jak1_rpt1 Pseudokinase (repeat 1) domain of th 99.96
cd05072261 PTKc_Lyn Catalytic domain of the Protein Tyrosine 99.96
cd05062277 PTKc_IGF-1R Catalytic domain of the Protein Tyrosi 99.96
cd05090283 PTKc_Ror1 Catalytic domain of the Protein Tyrosine 99.96
cd06635317 STKc_TAO1 Catalytic domain of the Protein Serine/T 99.96
cd07845309 STKc_CDK10 Catalytic domain of the Serine/Threonin 99.96
cd00192262 PTKc Catalytic domain of Protein Tyrosine Kinases. 99.96
cd07831282 STKc_MOK Catalytic domain of the Serine/Threonine 99.96
cd06623264 PKc_MAPKK_plant_like Catalytic domain of Plant dua 99.96
cd05094291 PTKc_TrkC Catalytic domain of the Protein Tyrosine 99.96
cd05576237 STKc_RPK118_like Catalytic domain of the Protein S 99.96
cd07836284 STKc_Pho85 Catalytic domain of the Serine/Threonin 99.96
cd07844291 STKc_PCTAIRE_like Catalytic domain of PCTAIRE-like 99.96
cd05061288 PTKc_InsR Catalytic domain of the Protein Tyrosine 99.96
cd05113256 PTKc_Btk_Bmx Catalytic domain of the Protein Tyros 99.96
cd05076274 PTK_Tyk2_rpt1 Pseudokinase (repeat 1) domain of th 99.96
cd05088303 PTKc_Tie2 Catalytic domain of the Protein Tyrosine 99.96
cd05116257 PTKc_Syk Catalytic domain of the Protein Tyrosine 99.96
PTZ00024335 cyclin-dependent protein kinase; Provisional 99.96
cd05084252 PTKc_Fes Catalytic domain of the Protein Tyrosine 99.96
cd05055302 PTKc_PDGFR Catalytic domain of the Protein Tyrosin 99.96
cd05613290 STKc_MSK1_N N-terminal catalytic domain of the Pro 99.96
cd05148261 PTKc_Srm_Brk Catalytic domain of the Protein Tyros 99.96
cd05104375 PTKc_Kit Catalytic domain of the Protein Tyrosine 99.96
PHA03210501 serine/threonine kinase US3; Provisional 99.96
cd06634308 STKc_TAO2 Catalytic domain of the Protein Serine/T 99.96
cd05059256 PTKc_Tec_like Catalytic domain of Tec-like Protein 99.96
cd06606260 STKc_MAPKKK Catalytic domain of the Protein Serine 99.96
cd06917277 STKc_NAK1_like Catalytic domain of Fungal Nak1-lik 99.96
cd05032277 PTKc_InsR_like Catalytic domain of Insulin Recepto 99.96
cd05092280 PTKc_TrkA Catalytic domain of the Protein Tyrosine 99.96
cd07835283 STKc_CDK1_like Catalytic domain of Cyclin-Dependen 99.96
cd08222260 STKc_Nek11 Catalytic domain of the Protein Serine/ 99.96
cd06627254 STKc_Cdc7_like Catalytic domain of Cell division c 99.96
cd07843293 STKc_CDC2L1 Catalytic domain of the Serine/Threoni 99.96
KOG1151|consensus775 99.96
cd05082256 PTKc_Csk Catalytic domain of the Protein Tyrosine 99.96
cd07850353 STKc_JNK Catalytic domain of the Serine/Threonine 99.96
cd07865310 STKc_CDK9 Catalytic domain of the Serine/Threonine 99.96
cd05089297 PTKc_Tie1 Catalytic domain of the Protein Tyrosine 99.96
cd05036277 PTKc_ALK_LTK Catalytic domain of the Protein Tyros 99.96
cd05069260 PTKc_Yes Catalytic domain of the Protein Tyrosine 99.96
cd06653264 STKc_MEKK3_like_1 Catalytic domain of MAP/ERK kina 99.96
cd05040257 PTKc_Ack_like Catalytic domain of the Protein Tyro 99.96
cd05033266 PTKc_EphR Catalytic domain of Ephrin Receptor Prot 99.96
PF07714259 Pkinase_Tyr: Protein tyrosine kinase Protein kinas 99.96
cd05068261 PTKc_Frk_like Catalytic domain of Fyn-related kina 99.96
cd07841298 STKc_CDK7 Catalytic domain of the Serine/Threonine 99.96
cd07855334 STKc_ERK5 Catalytic domain of the Serine/Threonine 99.96
cd05085250 PTKc_Fer Catalytic domain of the Protein Tyrosine 99.96
cd05105400 PTKc_PDGFR_alpha Catalytic domain of the Protein T 99.96
cd05122253 PKc_STE Catalytic domain of STE family Protein Kin 99.96
cd05067260 PTKc_Lck_Blk Catalytic domain of the Protein Tyros 99.96
cd05047270 PTKc_Tie Catalytic domain of Tie Protein Tyrosine 99.96
cd05099314 PTKc_FGFR4 Catalytic domain of the Protein Tyrosin 99.96
cd05050288 PTKc_Musk Catalytic domain of the Protein Tyrosine 99.96
cd05044269 PTKc_c-ros Catalytic domain of the Protein Tyrosin 99.96
cd05098307 PTKc_FGFR1 Catalytic domain of the Protein Tyrosin 99.96
cd05115257 PTKc_Zap-70 Catalytic domain of the Protein Tyrosi 99.96
cd07837295 STKc_CdkB_plant Catalytic domain of the Serine/Thr 99.95
cd05091283 PTKc_Ror2 Catalytic domain of the Protein Tyrosine 99.95
cd05045290 PTKc_RET Catalytic domain of the Protein Tyrosine 99.95
cd05583288 STKc_MSK_N N-terminal catalytic domain of the Prot 99.95
cd05060257 PTKc_Syk_like Catalytic domain of Spleen Tyrosine 99.95
cd05053293 PTKc_FGFR Catalytic domain of the Protein Tyrosine 99.95
cd07842316 STKc_CDK8_like Catalytic domain of Cyclin-Dependen 99.95
cd05070260 PTKc_Fyn_Yrk Catalytic domain of the Protein Tyros 99.95
KOG0194|consensus474 99.95
cd05071262 PTKc_Src Catalytic domain of the Protein Tyrosine 99.95
cd08530256 STKc_CNK2-like Catalytic domain of the Protein Ser 99.95
cd07851343 STKc_p38 Catalytic domain of the Serine/Threonine 99.95
cd07834330 STKc_MAPK Catalytic domain of the Serine/Threonine 99.95
cd08229267 STKc_Nek7 Catalytic domain of the Protein Serine/T 99.95
cd05087269 PTKc_Aatyk1_Aatyk3 Catalytic domain of the Protein 99.95
KOG1095|consensus1025 99.95
cd05101304 PTKc_FGFR2 Catalytic domain of the Protein Tyrosin 99.95
cd05086268 PTKc_Aatyk2 Catalytic domain of the Protein Tyrosi 99.95
PRK13184 932 pknD serine/threonine-protein kinase; Reviewed 99.95
cd05118283 STKc_CMGC Catalytic domain of CMGC family Serine/T 99.95
cd07870291 STKc_PFTAIRE2 Catalytic domain of the Serine/Threo 99.95
cd05041251 PTKc_Fes_like Catalytic domain of Fes-like Protein 99.95
cd05112256 PTKc_Itk Catalytic domain of the Protein Tyrosine 99.95
cd07858337 STKc_TEY_MAPK_plant Catalytic domain of the Serine 99.95
cd05063268 PTKc_EphR_A2 Catalytic domain of the Protein Tyros 99.95
cd08228267 STKc_Nek6 Catalytic domain of the Protein Serine/T 99.95
cd07852337 STKc_MAPK15 Catalytic domain of the Serine/Threoni 99.95
cd05066267 PTKc_EphR_A Catalytic domain of the Protein Tyrosi 99.95
cd07880343 STKc_p38gamma_MAPK12 Catalytic domain of the Serin 99.95
cd05039256 PTKc_Csk_like Catalytic domain of C-terminal Src k 99.95
cd05042269 PTKc_Aatyk Catalytic domain of the Protein Tyrosin 99.95
cd05034261 PTKc_Src_like Catalytic domain of Src kinase-like 99.95
cd05073260 PTKc_Hck Catalytic domain of the Protein Tyrosine 99.95
cd05054337 PTKc_VEGFR Catalytic domain of the Protein Tyrosin 99.95
cd05051296 PTKc_DDR Catalytic domain of the Protein Tyrosine 99.95
cd06616288 PKc_MKK4 Catalytic domain of the dual-specificity 99.95
cd06617283 PKc_MKK3_6 Catalytic domain of the dual-specificit 99.95
cd05058262 PTKc_Met_Ron Catalytic domain of the Protein Tyros 99.95
cd07856328 STKc_Sty1_Hog1 Catalytic domain of the Serine/Thre 99.95
cd07854342 STKc_MAPK4_6 Catalytic domain of the Serine/Threon 99.95
cd05095296 PTKc_DDR2 Catalytic domain of the Protein Tyrosine 99.95
cd07849336 STKc_ERK1_2_like Catalytic domain of Extracellular 99.95
cd07830283 STKc_MAK_like Catalytic domain of Male germ cell-A 99.95
cd05097295 PTKc_DDR_like Catalytic domain of Discoidin Domain 99.95
cd05046275 PTK_CCK4 Pseudokinase domain of the Protein Tyrosi 99.95
cd05083254 PTKc_Chk Catalytic domain of the Protein Tyrosine 99.95
smart00219258 TyrKc Tyrosine kinase, catalytic domain. Phosphotr 99.95
KOG4236|consensus888 99.95
cd05100334 PTKc_FGFR3 Catalytic domain of the Protein Tyrosin 99.95
KOG0587|consensus 953 99.95
cd08224267 STKc_Nek6_Nek7 Catalytic domain of the Protein Ser 99.95
cd07838287 STKc_CDK4_6_like Catalytic domain of Cyclin-Depend 99.95
cd05037259 PTK_Jak_rpt1 Pseudokinase (repeat 1) domain of the 99.95
cd05107401 PTKc_PDGFR_beta Catalytic domain of the Protein Ty 99.95
cd07840287 STKc_CDK9_like Catalytic domain of Cyclin-Dependen 99.95
cd05035273 PTKc_Axl_like Catalytic Domain of Axl-like Protein 99.95
cd05065269 PTKc_EphR_B Catalytic domain of the Protein Tyrosi 99.95
cd07864302 STKc_CDK12 Catalytic domain of the Serine/Threonin 99.95
cd05075272 PTKc_Axl Catalytic domain of the Protein Tyrosine 99.95
cd05108316 PTKc_EGFR Catalytic domain of the Protein Tyrosine 99.95
cd05056270 PTKc_FAK Catalytic domain of the Protein Tyrosine 99.95
cd05111279 PTK_HER3 Pseudokinase domain of the Protein Tyrosi 99.95
cd07829282 STKc_CDK_like Catalytic domain of Cyclin-Dependent 99.95
cd07877345 STKc_p38alpha_MAPK14 Catalytic domain of the Serin 99.95
cd07879342 STKc_p38delta_MAPK13 Catalytic domain of the Serin 99.95
KOG0667|consensus586 99.95
cd05080283 PTKc_Tyk2_rpt2 Catalytic (repeat 2) domain of the 99.94
cd05057279 PTKc_EGFR_like Catalytic domain of Epidermal Growt 99.94
KOG0666|consensus438 99.94
cd08528269 STKc_Nek10 Catalytic domain of the Protein Serine/ 99.94
cd06618296 PKc_MKK7 Catalytic domain of the dual-specificity 99.94
cd07857332 STKc_MPK1 Catalytic domain of the Serine/Threonine 99.94
cd05610669 STKc_MASTL Catalytic domain of the Protein Serine/ 99.94
cd07866311 STKc_BUR1 Catalytic domain of the Serine/Threonine 99.94
cd05043280 PTK_Ryk Pseudokinase domain of Ryk (Receptor relat 99.94
smart00220244 S_TKc Serine/Threonine protein kinases, catalytic 99.94
KOG0983|consensus391 99.94
cd05079284 PTKc_Jak1_rpt2 Catalytic (repeat 2) domain of the 99.94
PLN00113968 leucine-rich repeat receptor-like protein kinase; 99.94
cd05109279 PTKc_HER2 Catalytic domain of the Protein Tyrosine 99.94
KOG0662|consensus292 99.94
cd05110303 PTKc_HER4 Catalytic domain of the Protein Tyrosine 99.94
KOG2345|consensus302 99.93
cd05103343 PTKc_VEGFR2 Catalytic domain of the Protein Tyrosi 99.93
cd05081284 PTKc_Jak2_Jak3_rpt2 Catalytic (repeat 2) domain of 99.93
KOG4250|consensus 732 99.93
cd05038284 PTKc_Jak_rpt2 Catalytic (repeat 2) domain of the P 99.93
KOG1027|consensus903 99.93
KOG4257|consensus 974 99.93
KOG0576|consensus 829 99.93
cd05074273 PTKc_Tyro3 Catalytic domain of the Protein Tyrosin 99.92
KOG4278|consensus 1157 99.92
KOG0665|consensus369 99.92
KOG1187|consensus361 99.92
KOG1094|consensus807 99.92
KOG0199|consensus 1039 99.91
KOG0669|consensus376 99.91
KOG0671|consensus415 99.91
KOG0196|consensus996 99.9
PHA02882294 putative serine/threonine kinase; Provisional 99.9
KOG0200|consensus609 99.89
KOG1006|consensus361 99.89
KOG0193|consensus678 99.89
smart00750176 KIND kinase non-catalytic C-lobe domain. It is an 99.88
KOG0668|consensus338 99.88
KOG0670|consensus752 99.88
PLN00181 793 protein SPA1-RELATED; Provisional 99.88
PLN03225566 Serine/threonine-protein kinase SNT7; Provisional 99.87
PLN03224507 probable serine/threonine protein kinase; Provisio 99.87
KOG0590|consensus 601 99.83
KOG1152|consensus772 99.83
KOG1025|consensus 1177 99.83
KOG1024|consensus563 99.83
KOG1035|consensus 1351 99.82
cd00180215 PKc Catalytic domain of Protein Kinases. Protein K 99.8
KOG0590|consensus601 99.79
smart00221225 STYKc Protein kinase; unclassified specificity. Ph 99.78
KOG2052|consensus513 99.75
KOG3653|consensus534 99.75
KOG1167|consensus418 99.74
KOG0984|consensus282 99.73
KOG0195|consensus448 99.72
KOG0664|consensus449 99.72
KOG1345|consensus378 99.63
KOG0606|consensus 1205 99.61
COG0515384 SPS1 Serine/threonine protein kinase [General func 99.61
KOG1290|consensus590 99.6
KOG1033|consensus516 99.53
KOG1023|consensus 484 99.52
KOG4158|consensus598 99.51
KOG0575|consensus 592 99.43
KOG0616|consensus 355 99.39
KOG0606|consensus1205 99.38
KOG0592|consensus 604 99.37
KOG0600|consensus 560 99.33
KOG0594|consensus 323 99.33
KOG0593|consensus 396 99.32
KOG0598|consensus 357 99.32
KOG0661|consensus 538 99.31
KOG1240|consensus 1431 99.3
KOG1035|consensus 1351 99.25
KOG0599|consensus 411 99.23
KOG0614|consensus 732 99.21
KOG0595|consensus 429 99.2
KOG0694|consensus 694 99.2
KOG0663|consensus 419 99.19
KOG0660|consensus 359 99.18
KOG0658|consensus 364 99.17
KOG0583|consensus 370 99.16
KOG0659|consensus 318 99.13
KOG0581|consensus 364 99.12
KOG0198|consensus 313 99.12
KOG0615|consensus 475 99.11
KOG0605|consensus 550 99.09
KOG0585|consensus 576 99.08
KOG0611|consensus 668 99.07
KOG0588|consensus 786 99.07
KOG0664|consensus 449 99.05
KOG0578|consensus 550 99.03
KOG0591|consensus 375 99.02
KOG0589|consensus 426 99.01
KOG1266|consensus458 99.01
KOG0662|consensus 292 99.0
PF14531288 Kinase-like: Kinase-like; PDB: 3DZO_A 2W1Z_A 3BYV_ 98.99
KOG0695|consensus 593 98.98
KOG1164|consensus322 98.98
PRK09188365 serine/threonine protein kinase; Provisional 98.97
KOG0986|consensus 591 98.97
PRK10359232 lipopolysaccharide core biosynthesis protein; Prov 98.94
KOG0033|consensus 355 98.94
KOG0582|consensus 516 98.92
KOG0197|consensus 468 98.92
KOG0601|consensus524 98.92
KOG0669|consensus 376 98.92
PRK12274218 serine/threonine protein kinase; Provisional 98.91
KOG0604|consensus 400 98.9
KOG4236|consensus 888 98.88
KOG0610|consensus 459 98.87
KOG0690|consensus 516 98.86
cd05628 363 STKc_NDR1 Catalytic domain of the Protein Serine/T 98.86
KOG0192|consensus 362 98.84
KOG0580|consensus281 98.84
cd05571 323 STKc_PKB Catalytic domain of the Protein Serine/Th 98.83
KOG0608|consensus 1034 98.82
PHA02882 294 putative serine/threonine kinase; Provisional 98.82
cd05614 332 STKc_MSK2_N N-terminal catalytic domain of the Pro 98.81
cd05597 331 STKc_DMPK_like Catalytic domain of Myotonic Dystro 98.81
cd05621 370 STKc_ROCK2 Catalytic domain of the Protein Serine/ 98.81
KOG0666|consensus 438 98.8
cd05586 330 STKc_Sck1_like Catalytic domain of Suppressor of l 98.8
cd05601 330 STKc_CRIK Catalytic domain of the Protein Serine/T 98.8
KOG0612|consensus 1317 98.79
cd05624 331 STKc_MRCK_beta Catalytic domain of the Protein Ser 98.79
cd07869 303 STKc_PFTAIRE1 Catalytic domain of the Serine/Threo 98.79
cd05102 338 PTKc_VEGFR3 Catalytic domain of the Protein Tyrosi 98.78
cd05623 332 STKc_MRCK_alpha Catalytic domain of the Protein Se 98.78
KOG0597|consensus 808 98.78
cd05622 371 STKc_ROCK1 Catalytic domain of the Protein Serine/ 98.78
cd05602 325 STKc_SGK1 Catalytic domain of the Protein Serine/T 98.77
cd07871 288 STKc_PCTAIRE3 Catalytic domain of the Serine/Threo 98.77
PHA03212 391 serine/threonine kinase US3; Provisional 98.76
KOG0667|consensus 586 98.76
KOG0193|consensus 678 98.76
cd05627 360 STKc_NDR2 Catalytic domain of the Protein Serine/T 98.76
cd05604 325 STKc_SGK3 Catalytic domain of the Protein Serine/T 98.76
cd05593 328 STKc_PKB_gamma Catalytic domain of the Protein Ser 98.76
cd05625 382 STKc_LATS1 Catalytic domain of the Protein Serine/ 98.75
cd05599 364 STKc_NDR_like Catalytic domain of Nuclear Dbf2-Rel 98.75
cd05594 325 STKc_PKB_alpha Catalytic domain of the Protein Ser 98.75
cd05592 316 STKc_nPKC_theta_delta Catalytic domain of the Prot 98.75
cd05575 323 STKc_SGK Catalytic domain of the Protein Serine/Th 98.75
cd05596 370 STKc_ROCK Catalytic domain of the Protein Serine/T 98.75
PTZ00263 329 protein kinase A catalytic subunit; Provisional 98.75
PTZ00426 340 cAMP-dependent protein kinase catalytic subunit; P 98.74
PTZ00036 440 glycogen synthase kinase; Provisional 98.74
cd07878 343 STKc_p38beta_MAPK11 Catalytic domain of the Serine 98.74
>KOG0575|consensus Back     alignment and domain information
Probab=100.00  E-value=1.1e-49  Score=348.42  Aligned_cols=216  Identities=49%  Similarity=0.883  Sum_probs=190.5

Q ss_pred             ChhHHHHHhcCCCCCccceeEEEEcCCeEEEEEeccCCCCHHHHHHHhcCCCCCCCcCchhHH-HHHHHHHHhhhhCCce
Q psy6191           1 MSQEIAIHRSLKHRNVVGFHSFFEDSKFVYIILELCRKRSMMELYNSACDLEEMSDPAAQPVI-WVSKWVDYSDKYGFGY   79 (305)
Q Consensus         1 ~~~Ei~il~~l~HpnIV~l~~~~~~~~~~ylVmEy~~~g~L~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~~~~~~~~~   79 (305)
                      +.+||+|+++|+|||||++|++|+|++++|||+|+|+.|+|.+++++...+   .+..++.++ +++.++.|+|+.++.|
T Consensus        65 v~~EIeIHr~L~HpnIV~f~~~FEDs~nVYivLELC~~~sL~el~Krrk~l---tEpEary~l~QIv~GlkYLH~~~IiH  141 (592)
T KOG0575|consen   65 VLNEIEIHRSLKHPNIVQFYHFFEDSNNVYIVLELCHRGSLMELLKRRKPL---TEPEARYFLRQIVEGLKYLHSLGIIH  141 (592)
T ss_pred             HHHHHHHHHhcCCCcEEeeeeEeecCCceEEEEEecCCccHHHHHHhcCCC---CcHHHHHHHHHHHHHHHHHHhcCcee
Confidence            368999999999999999999999999999999999999999999977666   444555444 4578888998777644


Q ss_pred             e-------ecCCCCCeeEcchhHHHHhc----CCcccccCCCcccccccccCCCCccchHHHHHHHHHHHHhCCCCCCCC
Q psy6191          80 Q-------LNDDSSGVMFNDLTRMIMLA----NKNTLCGTPNYIAPEILNKNGHSFEVDVWSIGCIMYTLLVGKPPFETS  148 (305)
Q Consensus        80 ~-------~~~~~~~v~~~d~~~~~~~~----~~~~~~Gt~~y~aPE~~~~~~~~~~~DiwSlGvilye~l~g~~Pf~~~  148 (305)
                      +       +.+...+|+++||+.+..+.    +..|.||||.|+|||++...+++..+||||+|||||.||+|+|||+..
T Consensus       142 RDLKLGNlfL~~~~~VKIgDFGLAt~le~~~Erk~TlCGTPNYIAPEVl~k~gHsfEvDiWSlGcvmYtLL~G~PPFetk  221 (592)
T KOG0575|consen  142 RDLKLGNLFLNENMNVKIGDFGLATQLEYDGERKKTLCGTPNYIAPEVLNKSGHSFEVDIWSLGCVMYTLLVGRPPFETK  221 (592)
T ss_pred             cccchhheeecCcCcEEecccceeeeecCcccccceecCCCcccChhHhccCCCCCchhhhhhhhHHHhhhhCCCCcccc
Confidence            3       34455789999998776654    346999999999999999999999999999999999999999999999


Q ss_pred             CHHHHHHHHhccccCCCCCCCHHHHHHHHHHhhcCCCCCCCHhhhhcCccc-cccCCCCCCccccccCCCCC
Q psy6191         149 TLKETYSRIKKVEYKLPATLKKPAATMIKKMLLLDPVQRPPVAQLLHFEFF-NDYCPTSLPASCLMTAPRFD  219 (305)
Q Consensus       149 ~~~~~~~~i~~~~~~~~~~~~~~~~~li~~~l~~dp~~R~~~~~~l~~~~~-~~~~~~~~~~~~~~~~~~~~  219 (305)
                      +..+++.+|+...+.+|..++.++++||.++|..||.+|||+++++.|+|| +.+.|...|..|....|++.
T Consensus       222 ~vkety~~Ik~~~Y~~P~~ls~~A~dLI~~lL~~~P~~Rpsl~~vL~h~Ff~~g~~p~~lp~~~l~~~p~~~  293 (592)
T KOG0575|consen  222 TVKETYNKIKLNEYSMPSHLSAEAKDLIRKLLRPNPSERPSLDEVLDHPFFKSGFTPARLPSSCLTMVPRFG  293 (592)
T ss_pred             hHHHHHHHHHhcCcccccccCHHHHHHHHHHhcCCcccCCCHHHHhcCHhhhCCCcCCCCCccccccCCcCC
Confidence            999999999999999999999999999999999999999999999999999 56778888888887777664



>KOG0588|consensus Back     alignment and domain information
>KOG0615|consensus Back     alignment and domain information
>KOG0583|consensus Back     alignment and domain information
>KOG0598|consensus Back     alignment and domain information
>KOG0581|consensus Back     alignment and domain information
>KOG0616|consensus Back     alignment and domain information
>KOG0033|consensus Back     alignment and domain information
>KOG0592|consensus Back     alignment and domain information
>KOG0595|consensus Back     alignment and domain information
>KOG0611|consensus Back     alignment and domain information
>KOG0605|consensus Back     alignment and domain information
>KOG0597|consensus Back     alignment and domain information
>KOG4717|consensus Back     alignment and domain information
>KOG0578|consensus Back     alignment and domain information
>KOG0591|consensus Back     alignment and domain information
>KOG0610|consensus Back     alignment and domain information
>KOG0580|consensus Back     alignment and domain information
>KOG0694|consensus Back     alignment and domain information
>KOG0032|consensus Back     alignment and domain information
>KOG0599|consensus Back     alignment and domain information
>KOG0198|consensus Back     alignment and domain information
>KOG0582|consensus Back     alignment and domain information
>KOG0589|consensus Back     alignment and domain information
>KOG0586|consensus Back     alignment and domain information
>KOG0585|consensus Back     alignment and domain information
>cd05612 STKc_PRKX_like Catalytic domain of PRKX-like Protein Serine/Threonine Kinases Back     alignment and domain information
>PTZ00263 protein kinase A catalytic subunit; Provisional Back     alignment and domain information
>KOG0201|consensus Back     alignment and domain information
>PTZ00426 cAMP-dependent protein kinase catalytic subunit; Provisional Back     alignment and domain information
>cd05571 STKc_PKB Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B Back     alignment and domain information
>cd05585 STKc_YPK1_like Catalytic domain of Yeast Protein Kinase 1-like Protein Serine/Threonine Kinases Back     alignment and domain information
>KOG0593|consensus Back     alignment and domain information
>cd05595 STKc_PKB_beta Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B beta Back     alignment and domain information
>cd05593 STKc_PKB_gamma Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B gamma Back     alignment and domain information
>cd05584 STKc_p70S6K Catalytic domain of the Protein Serine/Threonine Kinase, 70 kDa ribosomal protein S6 kinase Back     alignment and domain information
>cd05590 STKc_nPKC_eta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C eta Back     alignment and domain information
>KOG0690|consensus Back     alignment and domain information
>cd05582 STKc_RSK_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, 90 kDa ribosomal protein S6 kinase Back     alignment and domain information
>KOG0604|consensus Back     alignment and domain information
>cd05620 STKc_nPKC_delta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C delta Back     alignment and domain information
>KOG0661|consensus Back     alignment and domain information
>cd05591 STKc_nPKC_epsilon Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C epsilon Back     alignment and domain information
>cd05628 STKc_NDR1 Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 1 Back     alignment and domain information
>cd05589 STKc_PKN Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase N Back     alignment and domain information
>cd05588 STKc_aPKC Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C Back     alignment and domain information
>cd05594 STKc_PKB_alpha Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B alpha Back     alignment and domain information
>cd05619 STKc_nPKC_theta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C theta Back     alignment and domain information
>cd05570 STKc_PKC Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase C Back     alignment and domain information
>cd07848 STKc_CDKL5 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase Like 5 Back     alignment and domain information
>cd05631 STKc_GRK4 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 4 Back     alignment and domain information
>KOG0600|consensus Back     alignment and domain information
>cd05575 STKc_SGK Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase Back     alignment and domain information
>KOG0696|consensus Back     alignment and domain information
>cd05599 STKc_NDR_like Catalytic domain of Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05600 STKc_Sid2p_Dbf2p Catalytic domain of Fungal Sid2p- and Dbf2p-like Protein Serine/Threonine Kinases Back     alignment and domain information
>PHA02988 hypothetical protein; Provisional Back     alignment and domain information
>PTZ00267 NIMA-related protein kinase; Provisional Back     alignment and domain information
>cd05596 STKc_ROCK Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase Back     alignment and domain information
>cd05592 STKc_nPKC_theta_delta Catalytic domain of the Protein Serine/Threonine Kinases, Novel Protein Kinase C theta and delta Back     alignment and domain information
>KOG0607|consensus Back     alignment and domain information
>cd05629 STKc_NDR_like_fungal Catalytic domain of Fungal Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>KOG0192|consensus Back     alignment and domain information
>cd06649 PKc_MEK2 Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase 2 Back     alignment and domain information
>cd05626 STKc_LATS2 Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor 2 Back     alignment and domain information
>cd05625 STKc_LATS1 Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor 1 Back     alignment and domain information
>cd05587 STKc_cPKC Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C Back     alignment and domain information
>cd07871 STKc_PCTAIRE3 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-3 kinase Back     alignment and domain information
>cd05618 STKc_aPKC_iota Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C iota Back     alignment and domain information
>cd05604 STKc_SGK3 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 3 Back     alignment and domain information
>cd05608 STKc_GRK1 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 1 Back     alignment and domain information
>cd05602 STKc_SGK1 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 1 Back     alignment and domain information
>cd05627 STKc_NDR2 Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 2 Back     alignment and domain information
>cd05603 STKc_SGK2 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 2 Back     alignment and domain information
>cd05598 STKc_LATS Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor Back     alignment and domain information
>cd05605 STKc_GRK4_like Catalytic domain of G protein-coupled Receptor Kinase 4-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05614 STKc_MSK2_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase 2 Back     alignment and domain information
>cd05573 STKc_ROCK_NDR_like Catalytic domain of ROCK- and NDR kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>KOG0574|consensus Back     alignment and domain information
>cd05616 STKc_cPKC_beta Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C beta Back     alignment and domain information
>cd05621 STKc_ROCK2 Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 2 Back     alignment and domain information
>KOG0614|consensus Back     alignment and domain information
>cd05617 STKc_aPKC_zeta Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C zeta Back     alignment and domain information
>KOG0612|consensus Back     alignment and domain information
>KOG4279|consensus Back     alignment and domain information
>KOG0579|consensus Back     alignment and domain information
>cd05607 STKc_GRK7 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 7 Back     alignment and domain information
>KOG4645|consensus Back     alignment and domain information
>cd06625 STKc_MEKK3_like Catalytic domain of MAP/ERK kinase kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd07869 STKc_PFTAIRE1 Catalytic domain of the Serine/Threonine Kinase, PFTAIRE-1 kinase Back     alignment and domain information
>KOG0663|consensus Back     alignment and domain information
>cd05601 STKc_CRIK Catalytic domain of the Protein Serine/Threonine Kinase, Citron Rho-interacting kinase Back     alignment and domain information
>KOG4721|consensus Back     alignment and domain information
>cd05622 STKc_ROCK1 Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 1 Back     alignment and domain information
>cd06650 PKc_MEK1 Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase 1 Back     alignment and domain information
>cd05615 STKc_cPKC_alpha Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C alpha Back     alignment and domain information
>cd07859 STKc_TDY_MAPK_plant Catalytic domain of the Serine/Threonine Kinases, TDY Mitogen-Activated Protein Kinases from Plants Back     alignment and domain information
>cd08227 PK_STRAD_alpha Pseudokinase domain of STE20-related kinase adapter protein alpha Back     alignment and domain information
>cd05580 STKc_PKA Catalytic domain of the Protein Serine/Threonine Kinase, cAMP-dependent protein kinase Back     alignment and domain information
>PTZ00036 glycogen synthase kinase; Provisional Back     alignment and domain information
>KOG0660|consensus Back     alignment and domain information
>PLN00034 mitogen-activated protein kinase kinase; Provisional Back     alignment and domain information
>KOG0577|consensus Back     alignment and domain information
>KOG0603|consensus Back     alignment and domain information
>cd05586 STKc_Sck1_like Catalytic domain of Suppressor of loss of cAMP-dependent protein kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>KOG0197|consensus Back     alignment and domain information
>cd05630 STKc_GRK6 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 6 Back     alignment and domain information
>PHA03212 serine/threonine kinase US3; Provisional Back     alignment and domain information
>cd05572 STKc_cGK_PKG Catalytic domain of the Protein Serine/Threonine Kinase, cGMP-dependent protein kinase Back     alignment and domain information
>cd08529 STKc_FA2-like Catalytic domain of the Protein Serine/Threonine Kinase, Chlamydomonas reinhardtii FA2 and similar domains Back     alignment and domain information
>cd06631 STKc_YSK4 Catalytic domain of the Protein Serine/Threonine Kinase, Yeast Sps1/Ste20-related kinase 4 Back     alignment and domain information
>cd06628 STKc_MAPKKK_Byr2_like Catalytic domain of fungal Byr2-like MAP Kinase Kinase Kinases Back     alignment and domain information
>cd07862 STKc_CDK6 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 6 Back     alignment and domain information
>cd05574 STKc_phototropin_like Catalytic domain of Phototropin-like Protein Serine/Threonine Kinases Back     alignment and domain information
>KOG0596|consensus Back     alignment and domain information
>cd06615 PKc_MEK Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase Back     alignment and domain information
>cd06655 STKc_PAK2 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 2 Back     alignment and domain information
>cd05597 STKc_DMPK_like Catalytic domain of Myotonic Dystrophy protein kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>KOG0659|consensus Back     alignment and domain information
>KOG0603|consensus Back     alignment and domain information
>PHA03207 serine/threonine kinase US3; Provisional Back     alignment and domain information
>cd05623 STKc_MRCK_alpha Catalytic domain of the Protein Serine/Threonine Kinase, DMPK-related cell division control protein 42 binding kinase alpha Back     alignment and domain information
>cd06611 STKc_SLK_like Catalytic domain of Ste20-like kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd06645 STKc_MAP4K3 Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-activated protein kinase kinase kinase kinase 3 Back     alignment and domain information
>cd08221 STKc_Nek9 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 9 Back     alignment and domain information
>cd06609 STKc_MST3_like Catalytic domain of Mammalian Ste20-like protein kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>PHA03390 pk1 serine/threonine-protein kinase 1; Provisional Back     alignment and domain information
>cd08223 STKc_Nek4 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 4 Back     alignment and domain information
>cd06643 STKc_SLK Catalytic domain of the Protein Serine/Threonine Kinase, Ste20-like kinase Back     alignment and domain information
>cd08218 STKc_Nek1 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 1 Back     alignment and domain information
>cd08220 STKc_Nek8 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 8 Back     alignment and domain information
>cd06654 STKc_PAK1 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 1 Back     alignment and domain information
>cd05577 STKc_GRK Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase Back     alignment and domain information
>cd05632 STKc_GRK5 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 5 Back     alignment and domain information
>PTZ00266 NIMA-related protein kinase; Provisional Back     alignment and domain information
>cd07872 STKc_PCTAIRE2 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-2 kinase Back     alignment and domain information
>cd05609 STKc_MAST Catalytic domain of the Protein Serine/Threonine Kinase, Microtubule-associated serine/threonine kinase Back     alignment and domain information
>cd06612 STKc_MST1_2 Catalytic domain of the Protein Serine/Threonine Kinases, Mammalian Ste20-like protein kinase 1 and 2 Back     alignment and domain information
>cd07875 STKc_JNK1 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 1 Back     alignment and domain information
>cd05624 STKc_MRCK_beta Catalytic domain of the Protein Serine/Threonine Kinase, DMPK-related cell division control protein 42 binding kinase beta Back     alignment and domain information
>cd06644 STKc_STK10_LOK Catalytic domain of the Protein Serine/Threonine Kinase, STK10 or Lymphocyte-oriented kinase Back     alignment and domain information
>cd06610 STKc_OSR1_SPAK Catalytic domain of the Protein Serine/Threonine Kinases, Oxidative stress response kinase and Ste20-related proline alanine-rich kinase Back     alignment and domain information
>cd06613 STKc_MAP4K3_like Catalytic domain of Mitogen-activated protein kinase kinase kinase kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd08225 STKc_Nek5 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 5 Back     alignment and domain information
>cd07863 STKc_CDK4 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 4 Back     alignment and domain information
>cd06637 STKc_TNIK Catalytic domain of the Protein Serine/Threonine Kinase, Traf2- and Nck-interacting kinase Back     alignment and domain information
>cd07873 STKc_PCTAIRE1 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-1 kinase Back     alignment and domain information
>cd05611 STKc_Rim15_like Catalytic domain of fungal Rim15-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd07876 STKc_JNK2 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 2 Back     alignment and domain information
>PTZ00284 protein kinase; Provisional Back     alignment and domain information
>cd06630 STKc_MEKK1 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 1 Back     alignment and domain information
>cd05578 STKc_Yank1 Catalytic domain of the Protein Serine/Threonine Kinase, Yank1 Back     alignment and domain information
>cd08219 STKc_Nek3 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 3 Back     alignment and domain information
>cd07868 STKc_CDK8 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 8 Back     alignment and domain information
>cd07853 STKc_NLK Catalytic domain of the Serine/Threonine Kinase, Nemo-Like Kinase Back     alignment and domain information
>PTZ00283 serine/threonine protein kinase; Provisional Back     alignment and domain information
>cd07861 STKc_CDK1_euk Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 1 from higher eukaryotes-like Back     alignment and domain information
>cd06622 PKc_MAPKK_PBS2_like Catalytic domain of fungal PBS2-like dual-specificity MAP kinase kinases Back     alignment and domain information
>cd06640 STKc_MST4 Catalytic domain of the Protein Serine/Threonine Kinase, Mammalian Ste20-like protein kinase 4 Back     alignment and domain information
>cd06636 STKc_MAP4K4_6 Catalytic domain of the Protein Serine/Threonine Kinases, Mitogen-Activated Protein Kinase Kinase Kinase Kinase 4 and 6 Back     alignment and domain information
>cd07847 STKc_CDKL1_4 Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase Like 1 and 4 Back     alignment and domain information
>PHA03211 serine/threonine kinase US3; Provisional Back     alignment and domain information
>cd06658 STKc_PAK5 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 5 Back     alignment and domain information
>cd08226 PK_STRAD_beta Pseudokinase domain of STE20-related kinase adapter protein beta Back     alignment and domain information
>cd06648 STKc_PAK_II Catalytic domain of the Protein Serine/Threonine Kinase, Group II p21-activated kinase Back     alignment and domain information
>cd06646 STKc_MAP4K5 Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-activated protein kinase kinase kinase kinase 5 Back     alignment and domain information
>cd05606 STKc_beta_ARK Catalytic domain of the Protein Serine/Threonine Kinase, beta-adrenergic receptor kinase Back     alignment and domain information
>cd06656 STKc_PAK3 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 3 Back     alignment and domain information
>cd07874 STKc_JNK3 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 3 Back     alignment and domain information
>cd06608 STKc_myosinIII_like Catalytic domain of Class III myosin-like Protein Serine/Threonine Kinases Back     alignment and domain information
>KOG0658|consensus Back     alignment and domain information
>cd06651 STKc_MEKK3 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 3 Back     alignment and domain information
>cd05579 STKc_MAST_like Catalytic domain of Microtubule-associated serine/threonine kinase-like proteins Back     alignment and domain information
>KOG0608|consensus Back     alignment and domain information
>cd05102 PTKc_VEGFR3 Catalytic domain of the Protein Tyrosine Kinase, Vascular Endothelial Growth Factor Receptor 3 Back     alignment and domain information
>cd06659 STKc_PAK6 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 6 Back     alignment and domain information
>cd06632 STKc_MEKK1_plant Catalytic domain of the Protein Serine/Threonine Kinase, Plant MAP/ERK kinase kinase 1 Back     alignment and domain information
>cd06652 STKc_MEKK2 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 2 Back     alignment and domain information
>cd07860 STKc_CDK2_3 Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase 2 and 3 Back     alignment and domain information
>cd06624 STKc_ASK Catalytic domain of the Protein Serine/Threonine Kinase, Apoptosis signal-regulating kinase Back     alignment and domain information
>cd07832 STKc_CCRK Catalytic domain of the Serine/Threonine Kinase, Cell Cycle-Related Kinase Back     alignment and domain information
>cd08216 PK_STRAD Pseudokinase domain of STE20-related kinase adapter protein Back     alignment and domain information
>cd06614 STKc_PAK Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase Back     alignment and domain information
>cd05048 PTKc_Ror Catalytic Domain of the Protein Tyrosine Kinases, Receptor tyrosine kinase-like Orphan Receptors Back     alignment and domain information
>cd05078 PTK_Jak2_Jak3_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinases, Janus kinases 2 and 3 Back     alignment and domain information
>cd06639 STKc_myosinIIIB Catalytic domain of the Protein Serine/Threonine Kinase, Class IIIB myosin Back     alignment and domain information
>cd05064 PTKc_EphR_A10 Catalytic domain of the Protein Tyrosine Kinase, Ephrin Receptor A10 Back     alignment and domain information
>cd06619 PKc_MKK5 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 5 Back     alignment and domain information
>cd06642 STKc_STK25-YSK1 Catalytic domain of the Protein Serine/Threonine Kinase, STK25 or Yeast Sps1/Ste20-related kinase 1 Back     alignment and domain information
>cd07839 STKc_CDK5 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 5 Back     alignment and domain information
>KOG0986|consensus Back     alignment and domain information
>cd06605 PKc_MAPKK Catalytic domain of the dual-specificity Protein Kinase, Mitogen-Activated Protein Kinase Kinase Back     alignment and domain information
>cd08217 STKc_Nek2 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 2 Back     alignment and domain information
>cd07878 STKc_p38beta_MAPK11 Catalytic domain of the Serine/Threonine Kinase, p38beta Mitogen-Activated Protein Kinase Back     alignment and domain information
>PHA03209 serine/threonine kinase US3; Provisional Back     alignment and domain information
>cd05123 STKc_AGC Catalytic domain of AGC family Protein Serine/Threonine Kinases Back     alignment and domain information
>cd06620 PKc_MAPKK_Byr1_like Catalytic domain of fungal Byr1-like dual-specificity MAP kinase kinases Back     alignment and domain information
>cd06641 STKc_MST3 Catalytic domain of the Protein Serine/Threonine Kinase, Mammalian Ste20-like protein kinase 3 Back     alignment and domain information
>KOG1026|consensus Back     alignment and domain information
>KOG1989|consensus Back     alignment and domain information
>cd06657 STKc_PAK4 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 4 Back     alignment and domain information
>cd06607 STKc_TAO Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids proteins Back     alignment and domain information
>cd06621 PKc_MAPKK_Pek1_like Catalytic domain of fungal Pek1-like dual-specificity MAP kinase kinases Back     alignment and domain information
>cd05096 PTKc_DDR1 Catalytic domain of the Protein Tyrosine Kinase, Discoidin Domain Receptor 1 Back     alignment and domain information
>cd05114 PTKc_Tec_Rlk Catalytic domain of the Protein Tyrosine Kinases, Tyrosine kinase expressed in hepatocellular carcinoma and Resting lymphocyte kinase Back     alignment and domain information
>KOG0594|consensus Back     alignment and domain information
>cd07867 STKc_CDC2L6 Catalytic domain of Serine/Threonine Kinase, Cell Division Cycle 2-like 6 Back     alignment and domain information
>cd05052 PTKc_Abl Catalytic domain of the Protein Tyrosine Kinase, Abelson kinase Back     alignment and domain information
>KOG0584|consensus Back     alignment and domain information
>cd07846 STKc_CDKL2_3 Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase Like 2 and 3 Back     alignment and domain information
>cd06629 STKc_MAPKKK_Bck1_like Catalytic domain of fungal Bck1-like MAP Kinase Kinase Kinases Back     alignment and domain information
>cd05049 PTKc_Trk Catalytic domain of the Protein Tyrosine Kinases, Tropomyosin Related Kinases Back     alignment and domain information
>cd05581 STKc_PDK1 Catalytic domain of the Protein Serine/Threonine Kinase, Phosphoinositide-dependent kinase 1 Back     alignment and domain information
>cd05633 STKc_GRK3 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 3 Back     alignment and domain information
>cd06633 STKc_TAO3 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 3 Back     alignment and domain information
>PF00069 Pkinase: Protein kinase domain Protein kinase; unclassified specificity Back     alignment and domain information
>cd05093 PTKc_TrkB Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase B Back     alignment and domain information
>cd07833 STKc_CDKL Catalytic domain of Cyclin-Dependent protein Kinase Like Serine/Threonine Kinases Back     alignment and domain information
>cd06638 STKc_myosinIIIA Catalytic domain of the Protein Serine/Threonine Kinase, Class IIIA myosin Back     alignment and domain information
>KOG0695|consensus Back     alignment and domain information
>cd06626 STKc_MEKK4 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 4 Back     alignment and domain information
>cd06647 STKc_PAK_I Catalytic domain of the Protein Serine/Threonine Kinase, Group I p21-activated kinase Back     alignment and domain information
>cd08215 STKc_Nek Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase Back     alignment and domain information
>cd05106 PTKc_CSF-1R Catalytic domain of the Protein Tyrosine Kinase, Colony-Stimulating Factor-1 Receptor Back     alignment and domain information
>PLN00009 cyclin-dependent kinase A; Provisional Back     alignment and domain information
>cd05077 PTK_Jak1_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinase, Janus kinase 1 Back     alignment and domain information
>cd05072 PTKc_Lyn Catalytic domain of the Protein Tyrosine Kinase, Lyn Back     alignment and domain information
>cd05062 PTKc_IGF-1R Catalytic domain of the Protein Tyrosine Kinase, Insulin-like Growth Factor-1 Receptor Back     alignment and domain information
>cd05090 PTKc_Ror1 Catalytic domain of the Protein Tyrosine Kinase, Receptor tyrosine kinase-like Orphan Receptor 1 Back     alignment and domain information
>cd06635 STKc_TAO1 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 1 Back     alignment and domain information
>cd07845 STKc_CDK10 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 10 Back     alignment and domain information
>cd00192 PTKc Catalytic domain of Protein Tyrosine Kinases Back     alignment and domain information
>cd07831 STKc_MOK Catalytic domain of the Serine/Threonine Kinase, MAPK/MAK/MRK Overlapping Kinase Back     alignment and domain information
>cd06623 PKc_MAPKK_plant_like Catalytic domain of Plant dual-specificity MAP kinase kinases and similar proteins Back     alignment and domain information
>cd05094 PTKc_TrkC Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase C Back     alignment and domain information
>cd05576 STKc_RPK118_like Catalytic domain of the Protein Serine/Threonine Kinases, RPK118 and similar proteins Back     alignment and domain information
>cd07836 STKc_Pho85 Catalytic domain of the Serine/Threonine Kinase, Fungal Cyclin-Dependent protein Kinase Pho85 Back     alignment and domain information
>cd07844 STKc_PCTAIRE_like Catalytic domain of PCTAIRE-like Serine/Threonine Kinases Back     alignment and domain information
>cd05061 PTKc_InsR Catalytic domain of the Protein Tyrosine Kinase, Insulin Receptor Back     alignment and domain information
>cd05113 PTKc_Btk_Bmx Catalytic domain of the Protein Tyrosine Kinases, Bruton's tyrosine kinase and Bone marrow kinase on the X chromosome Back     alignment and domain information
>cd05076 PTK_Tyk2_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinase, Tyrosine kinase 2 Back     alignment and domain information
>cd05088 PTKc_Tie2 Catalytic domain of the Protein Tyrosine Kinase, Tie2 Back     alignment and domain information
>cd05116 PTKc_Syk Catalytic domain of the Protein Tyrosine Kinase, Spleen tyrosine kinase Back     alignment and domain information
>PTZ00024 cyclin-dependent protein kinase; Provisional Back     alignment and domain information
>cd05084 PTKc_Fes Catalytic domain of the Protein Tyrosine Kinase, Fes Back     alignment and domain information
>cd05055 PTKc_PDGFR Catalytic domain of the Protein Tyrosine Kinases, Platelet Derived Growth Factor Receptors Back     alignment and domain information
>cd05613 STKc_MSK1_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase 1 Back     alignment and domain information
>cd05148 PTKc_Srm_Brk Catalytic domain of the Protein Tyrosine Kinases, Srm and Brk Back     alignment and domain information
>cd05104 PTKc_Kit Catalytic domain of the Protein Tyrosine Kinase, Kit Back     alignment and domain information
>PHA03210 serine/threonine kinase US3; Provisional Back     alignment and domain information
>cd06634 STKc_TAO2 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 2 Back     alignment and domain information
>cd05059 PTKc_Tec_like Catalytic domain of Tec-like Protein Tyrosine Kinases Back     alignment and domain information
>cd06606 STKc_MAPKKK Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-Activated Protein Kinase Kinase Kinase Back     alignment and domain information
>cd06917 STKc_NAK1_like Catalytic domain of Fungal Nak1-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05032 PTKc_InsR_like Catalytic domain of Insulin Receptor-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05092 PTKc_TrkA Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase A Back     alignment and domain information
>cd07835 STKc_CDK1_like Catalytic domain of Cyclin-Dependent protein Kinase 1-like Serine/Threonine Kinases Back     alignment and domain information
>cd08222 STKc_Nek11 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 11 Back     alignment and domain information
>cd06627 STKc_Cdc7_like Catalytic domain of Cell division control protein 7-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd07843 STKc_CDC2L1 Catalytic domain of the Serine/Threonine Kinase, Cell Division Cycle 2-like 1 Back     alignment and domain information
>KOG1151|consensus Back     alignment and domain information
>cd05082 PTKc_Csk Catalytic domain of the Protein Tyrosine Kinase, C-terminal Src kinase Back     alignment and domain information
>cd07850 STKc_JNK Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase Back     alignment and domain information
>cd07865 STKc_CDK9 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 9 Back     alignment and domain information
>cd05089 PTKc_Tie1 Catalytic domain of the Protein Tyrosine Kinase, Tie1 Back     alignment and domain information
>cd05036 PTKc_ALK_LTK Catalytic domain of the Protein Tyrosine Kinases, Anaplastic Lymphoma Kinase and Leukocyte Tyrosine Kinase Back     alignment and domain information
>cd05069 PTKc_Yes Catalytic domain of the Protein Tyrosine Kinase, Yes Back     alignment and domain information
>cd06653 STKc_MEKK3_like_1 Catalytic domain of MAP/ERK kinase kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05040 PTKc_Ack_like Catalytic domain of the Protein Tyrosine Kinase, Activated Cdc42-associated kinase Back     alignment and domain information
>cd05033 PTKc_EphR Catalytic domain of Ephrin Receptor Protein Tyrosine Kinases Back     alignment and domain information
>PF07714 Pkinase_Tyr: Protein tyrosine kinase Protein kinase; unclassified specificity Back     alignment and domain information
>cd05068 PTKc_Frk_like Catalytic domain of Fyn-related kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>cd07841 STKc_CDK7 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 7 Back     alignment and domain information
>cd07855 STKc_ERK5 Catalytic domain of the Serine/Threonine Kinase, Extracellular signal-Regulated Kinase 5 Back     alignment and domain information
>cd05085 PTKc_Fer Catalytic domain of the Protein Tyrosine Kinase, Fer Back     alignment and domain information
>cd05105 PTKc_PDGFR_alpha Catalytic domain of the Protein Tyrosine Kinase, Platelet Derived Growth Factor Receptor alpha Back     alignment and domain information
>cd05122 PKc_STE Catalytic domain of STE family Protein Kinases Back     alignment and domain information
>cd05067 PTKc_Lck_Blk Catalytic domain of the Protein Tyrosine Kinases, Lymphocyte-specific kinase and Blk Back     alignment and domain information
>cd05047 PTKc_Tie Catalytic domain of Tie Protein Tyrosine Kinases Back     alignment and domain information
>cd05099 PTKc_FGFR4 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 4 Back     alignment and domain information
>cd05050 PTKc_Musk Catalytic domain of the Protein Tyrosine Kinase, Muscle-specific kinase Back     alignment and domain information
>cd05044 PTKc_c-ros Catalytic domain of the Protein Tyrosine Kinase, C-ros Back     alignment and domain information
>cd05098 PTKc_FGFR1 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 1 Back     alignment and domain information
>cd05115 PTKc_Zap-70 Catalytic domain of the Protein Tyrosine Kinase, Zeta-chain-associated protein of 70kDa Back     alignment and domain information
>cd07837 STKc_CdkB_plant Catalytic domain of the Serine/Threonine Kinase, Plant B-type Cyclin-Dependent protein Kinase Back     alignment and domain information
>cd05091 PTKc_Ror2 Catalytic domain of the Protein Tyrosine Kinase, Receptor tyrosine kinase-like Orphan Receptor 2 Back     alignment and domain information
>cd05045 PTKc_RET Catalytic domain of the Protein Tyrosine Kinase, REarranged during Transfection protein Back     alignment and domain information
>cd05583 STKc_MSK_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase Back     alignment and domain information
>cd05060 PTKc_Syk_like Catalytic domain of Spleen Tyrosine Kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05053 PTKc_FGFR Catalytic domain of the Protein Tyrosine Kinases, Fibroblast Growth Factor Receptors Back     alignment and domain information
>cd07842 STKc_CDK8_like Catalytic domain of Cyclin-Dependent protein Kinase 8-like Serine/Threonine Kinases Back     alignment and domain information
>cd05070 PTKc_Fyn_Yrk Catalytic domain of the Protein Tyrosine Kinases, Fyn and Yrk Back     alignment and domain information
>KOG0194|consensus Back     alignment and domain information
>cd05071 PTKc_Src Catalytic domain of the Protein Tyrosine Kinase, Src Back     alignment and domain information
>cd08530 STKc_CNK2-like Catalytic domain of the Protein Serine/Threonine Kinase, Chlamydomonas reinhardtii CNK2, and similar domains Back     alignment and domain information
>cd07851 STKc_p38 Catalytic domain of the Serine/Threonine Kinase, p38 Mitogen-Activated Protein Kinase Back     alignment and domain information
>cd07834 STKc_MAPK Catalytic domain of the Serine/Threonine Kinase, Mitogen-Activated Protein Kinase Back     alignment and domain information
>cd08229 STKc_Nek7 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 7 Back     alignment and domain information
>cd05087 PTKc_Aatyk1_Aatyk3 Catalytic domain of the Protein Tyrosine Kinases, Apoptosis-associated tyrosine kinases 1 and 3 Back     alignment and domain information
>KOG1095|consensus Back     alignment and domain information
>cd05101 PTKc_FGFR2 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 2 Back     alignment and domain information
>cd05086 PTKc_Aatyk2 Catalytic domain of the Protein Tyrosine Kinase, Apoptosis-associated tyrosine kinase 2 Back     alignment and domain information
>PRK13184 pknD serine/threonine-protein kinase; Reviewed Back     alignment and domain information
>cd05118 STKc_CMGC Catalytic domain of CMGC family Serine/Threonine Kinases Back     alignment and domain information
>cd07870 STKc_PFTAIRE2 Catalytic domain of the Serine/Threonine Kinase, PFTAIRE-2 kinase Back     alignment and domain information
>cd05041 PTKc_Fes_like Catalytic domain of Fes-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05112 PTKc_Itk Catalytic domain of the Protein Tyrosine Kinase, Interleukin-2-inducible T-cell Kinase Back     alignment and domain information
>cd07858 STKc_TEY_MAPK_plant Catalytic domain of the Serine/Threonine Kinases, TEY Mitogen-Activated Protein Kinases from Plants Back     alignment and domain information
>cd05063 PTKc_EphR_A2 Catalytic domain of the Protein Tyrosine Kinase, Ephrin Receptor A2 Back     alignment and domain information
>cd08228 STKc_Nek6 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 6 Back     alignment and domain information
>cd07852 STKc_MAPK15 Catalytic domain of the Serine/Threonine Kinase, Mitogen-Activated Protein Kinase 15 Back     alignment and domain information
>cd05066 PTKc_EphR_A Catalytic domain of the Protein Tyrosine Kinases, Class EphA Ephrin Receptors Back     alignment and domain information
>cd07880 STKc_p38gamma_MAPK12 Catalytic domain of the Serine/Threonine Kinase, p38gamma Mitogen-Activated Protein Kinase Back     alignment and domain information
>cd05039 PTKc_Csk_like Catalytic domain of C-terminal Src kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05042 PTKc_Aatyk Catalytic domain of the Protein Tyrosine Kinases, Apoptosis-associated tyrosine kinases Back     alignment and domain information
>cd05034 PTKc_Src_like Catalytic domain of Src kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05073 PTKc_Hck Catalytic domain of the Protein Tyrosine Kinase, Hematopoietic cell kinase Back     alignment and domain information
>cd05054 PTKc_VEGFR Catalytic domain of the Protein Tyrosine Kinases, Vascular Endothelial Growth Factor Receptors Back     alignment and domain information
>cd05051 PTKc_DDR Catalytic domain of the Protein Tyrosine Kinases, Discoidin Domain Receptors Back     alignment and domain information
>cd06616 PKc_MKK4 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 4 Back     alignment and domain information
>cd06617 PKc_MKK3_6 Catalytic domain of the dual-specificity Protein Kinases, MAP kinase kinases 3 and 6 Back     alignment and domain information
>cd05058 PTKc_Met_Ron Catalytic domain of the Protein Tyrosine Kinases, Met and Ron Back     alignment and domain information
>cd07856 STKc_Sty1_Hog1 Catalytic domain of the Serine/Threonine Kinases, Fungal Mitogen-Activated Protein Kinases Sty1 and Hog1 Back     alignment and domain information
>cd07854 STKc_MAPK4_6 Catalytic domain of the Serine/Threonine Kinases, Mitogen-Activated Protein Kinases 4 and 6 Back     alignment and domain information
>cd05095 PTKc_DDR2 Catalytic domain of the Protein Tyrosine Kinase, Discoidin Domain Receptor 2 Back     alignment and domain information
>cd07849 STKc_ERK1_2_like Catalytic domain of Extracellular signal-Regulated Kinase 1 and 2-like Serine/Threonine Kinases Back     alignment and domain information
>cd07830 STKc_MAK_like Catalytic domain of Male germ cell-Associated Kinase-like Serine/Threonine Kinases Back     alignment and domain information
>cd05097 PTKc_DDR_like Catalytic domain of Discoidin Domain Receptor-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05046 PTK_CCK4 Pseudokinase domain of the Protein Tyrosine Kinase, Colon Carcinoma Kinase 4 Back     alignment and domain information
>cd05083 PTKc_Chk Catalytic domain of the Protein Tyrosine Kinase, Csk homologous kinase Back     alignment and domain information
>smart00219 TyrKc Tyrosine kinase, catalytic domain Back     alignment and domain information
>KOG4236|consensus Back     alignment and domain information
>cd05100 PTKc_FGFR3 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 3 Back     alignment and domain information
>KOG0587|consensus Back     alignment and domain information
>cd08224 STKc_Nek6_Nek7 Catalytic domain of the Protein Serine/Threonine Kinases, Never In Mitosis gene A-related kinase 6 and 7 Back     alignment and domain information
>cd07838 STKc_CDK4_6_like Catalytic domain of Cyclin-Dependent protein Kinase 4 and 6-like Serine/Threonine Kinases Back     alignment and domain information
>cd05037 PTK_Jak_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinases, Janus kinases Back     alignment and domain information
>cd05107 PTKc_PDGFR_beta Catalytic domain of the Protein Tyrosine Kinase, Platelet Derived Growth Factor Receptor beta Back     alignment and domain information
>cd07840 STKc_CDK9_like Catalytic domain of Cyclin-Dependent protein Kinase 9-like Serine/Threonine Kinases Back     alignment and domain information
>cd05035 PTKc_Axl_like Catalytic Domain of Axl-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05065 PTKc_EphR_B Catalytic domain of the Protein Tyrosine Kinases, Class EphB Ephrin Receptors Back     alignment and domain information
>cd07864 STKc_CDK12 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 12 Back     alignment and domain information
>cd05075 PTKc_Axl Catalytic domain of the Protein Tyrosine Kinase, Axl Back     alignment and domain information
>cd05108 PTKc_EGFR Catalytic domain of the Protein Tyrosine Kinase, Epidermal Growth Factor Receptor Back     alignment and domain information
>cd05056 PTKc_FAK Catalytic domain of the Protein Tyrosine Kinase, Focal Adhesion Kinase Back     alignment and domain information
>cd05111 PTK_HER3 Pseudokinase domain of the Protein Tyrosine Kinase, HER3 Back     alignment and domain information
>cd07829 STKc_CDK_like Catalytic domain of Cyclin-Dependent protein Kinase-like Serine/Threonine Kinases Back     alignment and domain information
>cd07877 STKc_p38alpha_MAPK14 Catalytic domain of the Serine/Threonine Kinase, p38alpha Mitogen-Activated Protein Kinase Back     alignment and domain information
>cd07879 STKc_p38delta_MAPK13 Catalytic domain of the Serine/Threonine Kinase, p38delta Mitogen-Activated Protein Kinase Back     alignment and domain information
>KOG0667|consensus Back     alignment and domain information
>cd05080 PTKc_Tyk2_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinase, Tyrosine kinase 2 Back     alignment and domain information
>cd05057 PTKc_EGFR_like Catalytic domain of Epidermal Growth Factor Receptor-like Protein Tyrosine Kinases Back     alignment and domain information
>KOG0666|consensus Back     alignment and domain information
>cd08528 STKc_Nek10 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 10 Back     alignment and domain information
>cd06618 PKc_MKK7 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 7 Back     alignment and domain information
>cd07857 STKc_MPK1 Catalytic domain of the Serine/Threonine Kinase, Fungal Mitogen-Activated Protein Kinase MPK1 Back     alignment and domain information
>cd05610 STKc_MASTL Catalytic domain of the Protein Serine/Threonine Kinase, Microtubule-associated serine/threonine-like kinase Back     alignment and domain information
>cd07866 STKc_BUR1 Catalytic domain of the Serine/Threonine Kinase, Fungal Cyclin-Dependent protein Kinase Bypass UAS Requirement 1 and similar proteins Back     alignment and domain information
>cd05043 PTK_Ryk Pseudokinase domain of Ryk (Receptor related to tyrosine kinase) Back     alignment and domain information
>smart00220 S_TKc Serine/Threonine protein kinases, catalytic domain Back     alignment and domain information
>KOG0983|consensus Back     alignment and domain information
>cd05079 PTKc_Jak1_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinase, Janus kinase 1 Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>cd05109 PTKc_HER2 Catalytic domain of the Protein Tyrosine Kinase, HER2 Back     alignment and domain information
>KOG0662|consensus Back     alignment and domain information
>cd05110 PTKc_HER4 Catalytic domain of the Protein Tyrosine Kinase, HER4 Back     alignment and domain information
>KOG2345|consensus Back     alignment and domain information
>cd05103 PTKc_VEGFR2 Catalytic domain of the Protein Tyrosine Kinase, Vascular Endothelial Growth Factor Receptor 2 Back     alignment and domain information
>cd05081 PTKc_Jak2_Jak3_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinases, Janus kinases 2 and 3 Back     alignment and domain information
>KOG4250|consensus Back     alignment and domain information
>cd05038 PTKc_Jak_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinases, Janus kinases Back     alignment and domain information
>KOG1027|consensus Back     alignment and domain information
>KOG4257|consensus Back     alignment and domain information
>KOG0576|consensus Back     alignment and domain information
>cd05074 PTKc_Tyro3 Catalytic domain of the Protein Tyrosine Kinase, Tyro3 Back     alignment and domain information
>KOG4278|consensus Back     alignment and domain information
>KOG0665|consensus Back     alignment and domain information
>KOG1187|consensus Back     alignment and domain information
>KOG1094|consensus Back     alignment and domain information
>KOG0199|consensus Back     alignment and domain information
>KOG0669|consensus Back     alignment and domain information
>KOG0671|consensus Back     alignment and domain information
>KOG0196|consensus Back     alignment and domain information
>PHA02882 putative serine/threonine kinase; Provisional Back     alignment and domain information
>KOG0200|consensus Back     alignment and domain information
>KOG1006|consensus Back     alignment and domain information
>KOG0193|consensus Back     alignment and domain information
>smart00750 KIND kinase non-catalytic C-lobe domain Back     alignment and domain information
>KOG0668|consensus Back     alignment and domain information
>KOG0670|consensus Back     alignment and domain information
>PLN00181 protein SPA1-RELATED; Provisional Back     alignment and domain information
>PLN03225 Serine/threonine-protein kinase SNT7; Provisional Back     alignment and domain information
>PLN03224 probable serine/threonine protein kinase; Provisional Back     alignment and domain information
>KOG0590|consensus Back     alignment and domain information
>KOG1152|consensus Back     alignment and domain information
>KOG1025|consensus Back     alignment and domain information
>KOG1024|consensus Back     alignment and domain information
>KOG1035|consensus Back     alignment and domain information
>cd00180 PKc Catalytic domain of Protein Kinases Back     alignment and domain information
>KOG0590|consensus Back     alignment and domain information
>smart00221 STYKc Protein kinase; unclassified specificity Back     alignment and domain information
>KOG2052|consensus Back     alignment and domain information
>KOG3653|consensus Back     alignment and domain information
>KOG1167|consensus Back     alignment and domain information
>KOG0984|consensus Back     alignment and domain information
>KOG0195|consensus Back     alignment and domain information
>KOG0664|consensus Back     alignment and domain information
>KOG1345|consensus Back     alignment and domain information
>KOG0606|consensus Back     alignment and domain information
>COG0515 SPS1 Serine/threonine protein kinase [General function prediction only / Signal transduction mechanisms / Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>KOG1290|consensus Back     alignment and domain information
>KOG1033|consensus Back     alignment and domain information
>KOG1023|consensus Back     alignment and domain information
>KOG4158|consensus Back     alignment and domain information
>KOG0575|consensus Back     alignment and domain information
>KOG0616|consensus Back     alignment and domain information
>KOG0606|consensus Back     alignment and domain information
>KOG0592|consensus Back     alignment and domain information
>KOG0600|consensus Back     alignment and domain information
>KOG0594|consensus Back     alignment and domain information
>KOG0593|consensus Back     alignment and domain information
>KOG0598|consensus Back     alignment and domain information
>KOG0661|consensus Back     alignment and domain information
>KOG1240|consensus Back     alignment and domain information
>KOG1035|consensus Back     alignment and domain information
>KOG0599|consensus Back     alignment and domain information
>KOG0614|consensus Back     alignment and domain information
>KOG0595|consensus Back     alignment and domain information
>KOG0694|consensus Back     alignment and domain information
>KOG0663|consensus Back     alignment and domain information
>KOG0660|consensus Back     alignment and domain information
>KOG0658|consensus Back     alignment and domain information
>KOG0583|consensus Back     alignment and domain information
>KOG0659|consensus Back     alignment and domain information
>KOG0581|consensus Back     alignment and domain information
>KOG0198|consensus Back     alignment and domain information
>KOG0615|consensus Back     alignment and domain information
>KOG0605|consensus Back     alignment and domain information
>KOG0585|consensus Back     alignment and domain information
>KOG0611|consensus Back     alignment and domain information
>KOG0588|consensus Back     alignment and domain information
>KOG0664|consensus Back     alignment and domain information
>KOG0578|consensus Back     alignment and domain information
>KOG0591|consensus Back     alignment and domain information
>KOG0589|consensus Back     alignment and domain information
>KOG1266|consensus Back     alignment and domain information
>KOG0662|consensus Back     alignment and domain information
>PF14531 Kinase-like: Kinase-like; PDB: 3DZO_A 2W1Z_A 3BYV_A 3Q5Z_A 3Q60_A Back     alignment and domain information
>KOG0695|consensus Back     alignment and domain information
>KOG1164|consensus Back     alignment and domain information
>PRK09188 serine/threonine protein kinase; Provisional Back     alignment and domain information
>KOG0986|consensus Back     alignment and domain information
>PRK10359 lipopolysaccharide core biosynthesis protein; Provisional Back     alignment and domain information
>KOG0033|consensus Back     alignment and domain information
>KOG0582|consensus Back     alignment and domain information
>KOG0197|consensus Back     alignment and domain information
>KOG0601|consensus Back     alignment and domain information
>KOG0669|consensus Back     alignment and domain information
>PRK12274 serine/threonine protein kinase; Provisional Back     alignment and domain information
>KOG0604|consensus Back     alignment and domain information
>KOG4236|consensus Back     alignment and domain information
>KOG0610|consensus Back     alignment and domain information
>KOG0690|consensus Back     alignment and domain information
>cd05628 STKc_NDR1 Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 1 Back     alignment and domain information
>KOG0192|consensus Back     alignment and domain information
>KOG0580|consensus Back     alignment and domain information
>cd05571 STKc_PKB Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B Back     alignment and domain information
>KOG0608|consensus Back     alignment and domain information
>PHA02882 putative serine/threonine kinase; Provisional Back     alignment and domain information
>cd05614 STKc_MSK2_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase 2 Back     alignment and domain information
>cd05597 STKc_DMPK_like Catalytic domain of Myotonic Dystrophy protein kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05621 STKc_ROCK2 Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 2 Back     alignment and domain information
>KOG0666|consensus Back     alignment and domain information
>cd05586 STKc_Sck1_like Catalytic domain of Suppressor of loss of cAMP-dependent protein kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05601 STKc_CRIK Catalytic domain of the Protein Serine/Threonine Kinase, Citron Rho-interacting kinase Back     alignment and domain information
>KOG0612|consensus Back     alignment and domain information
>cd05624 STKc_MRCK_beta Catalytic domain of the Protein Serine/Threonine Kinase, DMPK-related cell division control protein 42 binding kinase beta Back     alignment and domain information
>cd07869 STKc_PFTAIRE1 Catalytic domain of the Serine/Threonine Kinase, PFTAIRE-1 kinase Back     alignment and domain information
>cd05102 PTKc_VEGFR3 Catalytic domain of the Protein Tyrosine Kinase, Vascular Endothelial Growth Factor Receptor 3 Back     alignment and domain information
>cd05623 STKc_MRCK_alpha Catalytic domain of the Protein Serine/Threonine Kinase, DMPK-related cell division control protein 42 binding kinase alpha Back     alignment and domain information
>KOG0597|consensus Back     alignment and domain information
>cd05622 STKc_ROCK1 Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 1 Back     alignment and domain information
>cd05602 STKc_SGK1 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 1 Back     alignment and domain information
>cd07871 STKc_PCTAIRE3 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-3 kinase Back     alignment and domain information
>PHA03212 serine/threonine kinase US3; Provisional Back     alignment and domain information
>KOG0667|consensus Back     alignment and domain information
>KOG0193|consensus Back     alignment and domain information
>cd05627 STKc_NDR2 Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 2 Back     alignment and domain information
>cd05604 STKc_SGK3 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 3 Back     alignment and domain information
>cd05593 STKc_PKB_gamma Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B gamma Back     alignment and domain information
>cd05625 STKc_LATS1 Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor 1 Back     alignment and domain information
>cd05599 STKc_NDR_like Catalytic domain of Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05594 STKc_PKB_alpha Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B alpha Back     alignment and domain information
>cd05592 STKc_nPKC_theta_delta Catalytic domain of the Protein Serine/Threonine Kinases, Novel Protein Kinase C theta and delta Back     alignment and domain information
>cd05575 STKc_SGK Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase Back     alignment and domain information
>cd05596 STKc_ROCK Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase Back     alignment and domain information
>PTZ00263 protein kinase A catalytic subunit; Provisional Back     alignment and domain information
>PTZ00426 cAMP-dependent protein kinase catalytic subunit; Provisional Back     alignment and domain information
>PTZ00036 glycogen synthase kinase; Provisional Back     alignment and domain information
>cd07878 STKc_p38beta_MAPK11 Catalytic domain of the Serine/Threonine Kinase, p38beta Mitogen-Activated Protein Kinase Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query305
2v5q_A315 Crystal Structure Of Wild-type Plk-1 Kinase Domain 1e-59
2v5q_A 315 Crystal Structure Of Wild-type Plk-1 Kinase Domain 1e-23
2yac_A311 Crystal Structure Of Polo-Like Kinase 1 In Complex 1e-59
2yac_A 311 Crystal Structure Of Polo-Like Kinase 1 In Complex 2e-23
3thb_A333 Structure Of Plk1 Kinase Domain In Complex With A B 4e-59
3thb_A 333 Structure Of Plk1 Kinase Domain In Complex With A B 2e-23
2ou7_A335 Structure Of The Catalytic Domain Of Human Polo-Lik 4e-59
2ou7_A 335 Structure Of The Catalytic Domain Of Human Polo-Lik 2e-23
3kb7_A311 Crystal Structure Of Polo-Like Kinase 1 In Complex 7e-59
3kb7_A 311 Crystal Structure Of Polo-Like Kinase 1 In Complex 1e-23
2rku_A294 Structure Of Plk1 In Complex With Bi2536 Length = 2 9e-58
2rku_A 294 Structure Of Plk1 In Complex With Bi2536 Length = 2 2e-23
3d5u_A317 Crystal Structure Of A Wildtype Polo-Like Kinase 1 9e-56
3d5u_A 317 Crystal Structure Of A Wildtype Polo-Like Kinase 1 2e-25
3d5w_A317 Crystal Structure Of A Phosphorylated Polo-Like Kin 4e-55
3d5w_A 317 Crystal Structure Of A Phosphorylated Polo-Like Kin 2e-25
3db6_A301 Crystal Structure Of An Activated (Thr->asp) Polo-L 4e-55
3db6_A 301 Crystal Structure Of An Activated (Thr->asp) Polo-L 2e-25
3d5v_A317 Crystal Structure Of An Activated (Thr->asp) Polo-L 4e-55
3d5v_A 317 Crystal Structure Of An Activated (Thr->asp) Polo-L 2e-25
3cok_A278 Crystal Structure Of Plk4 Kinase Length = 278 1e-28
3cok_A 278 Crystal Structure Of Plk4 Kinase Length = 278 1e-11
4af3_A292 Human Aurora B Kinase In Complex With Incenp And Vx 5e-23
3unz_A279 Aurora A In Complex With Rpm1679 Length = 279 9e-23
3unz_A 279 Aurora A In Complex With Rpm1679 Length = 279 2e-04
2dwb_A285 Aurora-A Kinase Complexed With Amppnp Length = 285 1e-22
2dwb_A 285 Aurora-A Kinase Complexed With Amppnp Length = 285 2e-04
1ol6_A282 Structure Of Unphosphorylated D274n Mutant Of Auror 1e-22
1ol6_A 282 Structure Of Unphosphorylated D274n Mutant Of Auror 7e-04
1muo_A297 Crystal Structure Of Aurora-2, An Oncogenic Serine- 1e-22
1muo_A 297 Crystal Structure Of Aurora-2, An Oncogenic Serine- 2e-04
2xng_A283 Structure Of Aurora-A Bound To A Selective Imidazop 2e-22
2xng_A 283 Structure Of Aurora-A Bound To A Selective Imidazop 2e-04
2j50_A280 Structure Of Aurora-2 In Complex With Pha-739358 Le 2e-22
2j50_A 280 Structure Of Aurora-2 In Complex With Pha-739358 Le 2e-04
2x6d_A285 Aurora-A Bound To An Inhibitor Length = 285 2e-22
2x6d_A 285 Aurora-A Bound To An Inhibitor Length = 285 2e-04
2wtw_A285 Aurora-A Inhibitor Structure (2nd Crystal Form) Len 2e-22
2wtw_A 285 Aurora-A Inhibitor Structure (2nd Crystal Form) Len 2e-04
2j4z_A306 Structure Of Aurora-2 In Complex With Pha-680626 Le 2e-22
2j4z_A 306 Structure Of Aurora-2 In Complex With Pha-680626 Le 2e-04
2bmc_A306 Aurora-2 T287d T288d Complexed With Pha-680632 Leng 5e-22
2bmc_A 306 Aurora-2 T287d T288d Complexed With Pha-680632 Leng 2e-04
2xne_A272 Structure Of Aurora-A Bound To An Imidazopyrazine I 5e-22
2xne_A 272 Structure Of Aurora-A Bound To An Imidazopyrazine I 9e-04
3o50_A267 Crystal Structure Of Benzamide 9 Bound To Auroraa L 6e-22
3o50_A 267 Crystal Structure Of Benzamide 9 Bound To Auroraa L 3e-04
2wqe_A262 Structure Of S155r Aurora-A Somatic Mutant Length = 6e-22
2wqe_A262 Structure Of S155r Aurora-A Somatic Mutant Length = 3e-04
2w1d_A275 Structure Determination Of Aurora Kinase In Complex 6e-22
2w1d_A 275 Structure Determination Of Aurora Kinase In Complex 3e-04
1mq4_A272 Crystal Structure Of Aurora-A Protein Kinase Length 7e-22
1mq4_A 272 Crystal Structure Of Aurora-A Protein Kinase Length 3e-04
2xru_A280 Aurora-A T288e Complexed With Pha-828300 Length = 2 7e-22
2xru_A 280 Aurora-A T288e Complexed With Pha-828300 Length = 2 2e-04
3fdn_A279 Structure-Based Drug Design Of Novel Aurora Kinase 7e-22
3fdn_A 279 Structure-Based Drug Design Of Novel Aurora Kinase 2e-04
2c6d_A275 Aurora A Kinase Activated Mutant (T287d) In Complex 7e-22
2c6d_A 275 Aurora A Kinase Activated Mutant (T287d) In Complex 2e-04
2c6e_A283 Aurora A Kinase Activated Mutant (T287d) In Complex 7e-22
2c6e_A 283 Aurora A Kinase Activated Mutant (T287d) In Complex 2e-04
1ol5_A282 Structure Of Aurora-A 122-403, Phosphorylated On Th 8e-22
1ol5_A 282 Structure Of Aurora-A 122-403, Phosphorylated On Th 2e-04
3nrm_A283 Imidazo[1,2-A]pyrazine-Based Aurora Kinase Inhibito 8e-22
3nrm_A 283 Imidazo[1,2-A]pyrazine-Based Aurora Kinase Inhibito 2e-04
3lau_A287 Crystal Structure Of Aurora2 Kinase In Complex With 8e-22
3lau_A 287 Crystal Structure Of Aurora2 Kinase In Complex With 2e-04
3r21_A271 Design, Synthesis, And Biological Evaluation Of Pyr 2e-21
3r21_A 271 Design, Synthesis, And Biological Evaluation Of Pyr 3e-04
3e5a_A268 Crystal Structure Of Aurora A In Complex With Vx-68 3e-21
3e5a_A 268 Crystal Structure Of Aurora A In Complex With Vx-68 3e-04
3h0y_A268 Aurora A In Complex With A Bisanilinopyrimidine Len 3e-21
3h0y_A 268 Aurora A In Complex With A Bisanilinopyrimidine Len 2e-04
3ha6_A268 Crystal Structure Of Aurora A In Complex With Tpx2 3e-21
3ha6_A 268 Crystal Structure Of Aurora A In Complex With Tpx2 3e-04
2w1c_A275 Structure Determination Of Aurora Kinase In Complex 4e-21
2w1c_A 275 Structure Determination Of Aurora Kinase In Complex 3e-04
3coh_A268 Crystal Structure Of Aurora-A In Complex With A Pen 5e-21
3coh_A 268 Crystal Structure Of Aurora-A In Complex With A Pen 1e-04
2wtv_A285 Aurora-A Inhibitor Structure Length = 285 1e-20
2wtv_A 285 Aurora-A Inhibitor Structure Length = 285 2e-04
3qbn_A281 Structure Of Human Aurora A In Complex With A Diami 2e-20
3qbn_A 281 Structure Of Human Aurora A In Complex With A Diami 2e-04
3daj_A272 Crystal Structure Of Aurora A Complexed With An Inh 3e-20
3daj_A 272 Crystal Structure Of Aurora A Complexed With An Inh 5e-05
3d14_A272 Crystal Structure Of Mouse Aurora A (Asn186->gly, L 4e-20
3d14_A 272 Crystal Structure Of Mouse Aurora A (Asn186->gly, L 5e-05
2jc6_A334 Crystal Structure Of Human Calmodulin-Dependent Pro 1e-17
2bfx_B284 Mechanism Of Aurora-B Activation By Incenp And Inhi 1e-17
2vrx_A285 Structure Of Aurora B Kinase In Complex With Zm4474 1e-17
2bfy_A284 Complex Of Aurora-B With Incenp And Hesperidin. Len 1e-17
2r0i_A327 Crystal Structure Of A Kinase Mark2PAR-1 Mutant Len 1e-17
2r0i_A 327 Crystal Structure Of A Kinase Mark2PAR-1 Mutant Len 4e-06
2jam_A304 Crystal Structure Of Human Calmodulin-Dependent Pro 2e-17
2jam_A 304 Crystal Structure Of Human Calmodulin-Dependent Pro 2e-05
1zmu_A327 Catalytic And Ubiqutin-Associated Domains Of Mark2P 2e-17
1zmu_A 327 Catalytic And Ubiqutin-Associated Domains Of Mark2P 4e-06
1zmv_A327 Catalytic And Ubiqutin-Associated Domains Of Mark2P 2e-17
1zmv_A 327 Catalytic And Ubiqutin-Associated Domains Of Mark2P 4e-06
3iec_A319 Helicobacter Pylori Caga Inhibits Par1MARK FAMILY K 4e-17
3iec_A 319 Helicobacter Pylori Caga Inhibits Par1MARK FAMILY K 5e-06
1a06_A332 Calmodulin-Dependent Protein Kinase From Rat Length 4e-17
1a06_A 332 Calmodulin-Dependent Protein Kinase From Rat Length 3e-04
4fg9_A320 Crystal Structure Of Human Calcium/calmodulin-depen 4e-17
4fg9_A 320 Crystal Structure Of Human Calcium/calmodulin-depen 3e-04
4fg7_A293 Crystal Structure Of Human Calcium/calmodulin-depen 4e-17
4fg7_A 293 Crystal Structure Of Human Calcium/calmodulin-depen 3e-04
4fg8_A315 Crystal Structure Of Human Calcium/calmodulin-depen 5e-17
4fg8_A 315 Crystal Structure Of Human Calcium/calmodulin-depen 3e-04
3bhy_A283 Crystal Structure Of Human Death Associated Protein 6e-17
3bhy_A 283 Crystal Structure Of Human Death Associated Protein 2e-07
2j90_A304 Crystal Structure Of Human Zip Kinase In Complex Wi 8e-17
2j90_A 304 Crystal Structure Of Human Zip Kinase In Complex Wi 2e-07
2wzj_A327 Catalytic And Uba Domain Of Kinase Mark2(PAR-1) K82 8e-17
2wzj_A 327 Catalytic And Uba Domain Of Kinase Mark2(PAR-1) K82 4e-06
1zmw_A327 Catalytic And Ubiqutin-Associated Domains Of Mark2P 9e-17
1zmw_A 327 Catalytic And Ubiqutin-Associated Domains Of Mark2P 4e-06
1yrp_A278 Catalytic Domain Of Human Zip Kinase Phosphorylated 9e-17
1yrp_A 278 Catalytic Domain Of Human Zip Kinase Phosphorylated 2e-07
3h4j_B336 Crystal Structure Of Pombe Ampk Kdaid Fragment Leng 1e-16
3h4j_B 336 Crystal Structure Of Pombe Ampk Kdaid Fragment Leng 2e-10
2qnj_A328 Kinase And Ubiquitin-Associated Domains Of Mark3PAR 2e-16
2qnj_A 328 Kinase And Ubiquitin-Associated Domains Of Mark3PAR 1e-06
3mn3_A271 An Inhibited Conformation For The Protein Kinase Do 3e-16
3mn3_A 271 An Inhibited Conformation For The Protein Kinase Do 2e-09
2fh9_A274 Structure And Dimerization Of The Kinase Domain Fro 3e-16
2fh9_A 274 Structure And Dimerization Of The Kinase Domain Fro 2e-09
3dae_A283 Crystal Structure Of Phosphorylated Snf1 Kinase Dom 3e-16
3dae_A 283 Crystal Structure Of Phosphorylated Snf1 Kinase Dom 2e-09
3hyh_A275 Crystal Structure Of The Protein Kinase Domain Of Y 3e-16
3hyh_A 275 Crystal Structure Of The Protein Kinase Domain Of Y 2e-09
2wel_A327 Crystal Structure Of Su6656-Bound CalciumCALMODULIN 4e-16
2wel_A 327 Crystal Structure Of Su6656-Bound CalciumCALMODULIN 1e-06
2vn9_A301 Crystal Structure Of Human Calcium Calmodulin Depen 5e-16
2vn9_A 301 Crystal Structure Of Human Calcium Calmodulin Depen 1e-06
1q4k_B259 The Polo-Box Domain Of Plk1 In Complex With A Phosp 5e-16
2ogq_A239 Molecular And Structural Basis Of Plk1 Substrate Re 5e-16
2bdw_A362 Crystal Structure Of The Auto-Inhibited Kinase Doma 5e-16
2bdw_A 362 Crystal Structure Of The Auto-Inhibited Kinase Doma 1e-05
1umw_A237 Structure Of A Human Plk1 Polo-Box DomainPHOSPHOPEP 6e-16
4h5x_B240 Human Plk1-Pbd With A Glycerol Bound At The Phophop 6e-16
3fvh_A237 Polo-Like Kinase 1 Polo Box Domain In Complex With 6e-16
3c5l_A221 Polo-Like Kinase 1 Polo Box Domain In Complex With 6e-16
3hih_A223 Structure Of Human Plk1-pbd With Glycerol And Sulfa 6e-16
3p2w_A232 Unliganded Form Of Polo-Like Kinase I Polo-Box Doma 7e-16
3kk8_A284 Camkii Substrate Complex A Length = 284 9e-16
3kk8_A 284 Camkii Substrate Complex A Length = 284 1e-05
3kk9_A282 Camkii Substrate Complex B Length = 282 9e-16
3kk9_A 282 Camkii Substrate Complex B Length = 282 1e-05
3kl8_A269 Camkiintide Inhibitor Complex Length = 269 9e-16
3kl8_A 269 Camkiintide Inhibitor Complex Length = 269 1e-05
3fe3_A328 Crystal Structure Of The Kinase Mark3PAR-1: T211a-S 1e-15
3fe3_A 328 Crystal Structure Of The Kinase Mark3PAR-1: T211a-S 1e-06
3bhh_A295 Crystal Structure Of Human Calcium/calmodulin-depen 1e-15
3bhh_A 295 Crystal Structure Of Human Calcium/calmodulin-depen 4e-06
2qr8_A342 2.0a X-ray Structure Of C-terminal Kinase Domain Of 1e-15
3is5_A285 Crystal Structure Of Cdpk Kinase Domain From Toxopl 1e-15
3is5_A285 Crystal Structure Of Cdpk Kinase Domain From Toxopl 6e-05
3rny_A346 Crystal Structure Of Human Rsk1 C-Terminal Kinase D 2e-15
3rny_A 346 Crystal Structure Of Human Rsk1 C-Terminal Kinase D 3e-04
3soa_A444 Full-Length Human Camkii Length = 444 2e-15
3soa_A 444 Full-Length Human Camkii Length = 444 2e-05
2vz6_A313 Structure Of Human Calcium Calmodulin Dependent Pro 2e-15
2vz6_A 313 Structure Of Human Calcium Calmodulin Dependent Pro 5e-06
3f3z_A277 Crystal Structure Of Cryptosporidium Parvum Calcium 2e-15
3f3z_A 277 Crystal Structure Of Cryptosporidium Parvum Calcium 4e-05
2qg5_A294 Cryptosporidium Parvum Calcium Dependent Protein Ki 2e-15
2qg5_A 294 Cryptosporidium Parvum Calcium Dependent Protein Ki 4e-05
2v7o_A336 Crystal Structure Of Human Calcium-Calmodulin-Depen 2e-15
2v7o_A 336 Crystal Structure Of Human Calcium-Calmodulin-Depen 3e-07
2wnt_A330 Crystal Structure Of The Human Ribosomal Protein S6 4e-15
2wnt_A 330 Crystal Structure Of The Human Ribosomal Protein S6 2e-04
1y8g_A327 Catalytic And Ubiqutin-Associated Domains Of Mark2P 4e-15
1y8g_A 327 Catalytic And Ubiqutin-Associated Domains Of Mark2P 7e-06
3lij_A494 Crystal Structure Of Full Length Cpcdpk3 (Cgd5_820) 4e-15
3lij_A 494 Crystal Structure Of Full Length Cpcdpk3 (Cgd5_820) 9e-10
2h6d_A276 Protein Kinase Domain Of The Human 5'-Amp-Activated 6e-15
2h6d_A 276 Protein Kinase Domain Of The Human 5'-Amp-Activated 5e-06
3a60_A327 Crystal Structure Of Unphosphorylated P70s6k1 (Form 8e-15
3a60_A 327 Crystal Structure Of Unphosphorylated P70s6k1 (Form 5e-04
2a27_A321 Human Drp-1 Kinase, W305s S308a D40 Mutant, Crystal 9e-15
2a27_A 321 Human Drp-1 Kinase, W305s S308a D40 Mutant, Crystal 1e-07
1z9x_A321 Human Drp-1 Kinase, W305s S308a D40 Mutant, Crystal 1e-14
1z9x_A 321 Human Drp-1 Kinase, W305s S308a D40 Mutant, Crystal 1e-07
2yza_A276 Crystal Structure Of Kinase Domain Of Human 5'-Amp- 1e-14
2yza_A 276 Crystal Structure Of Kinase Domain Of Human 5'-Amp- 5e-06
2clq_A295 Structure Of Mitogen-Activated Protein Kinase Kinas 1e-14
2clq_A 295 Structure Of Mitogen-Activated Protein Kinase Kinas 3e-08
3vw6_A269 Crystal Structure Of Human Apoptosis Signal-Regulat 2e-14
3vw6_A 269 Crystal Structure Of Human Apoptosis Signal-Regulat 4e-08
2qr7_A342 2.0a X-Ray Structure Of C-Terminal Kinase Domain Of 2e-14
3udb_A317 Crystal Structure Of Snrk2.6 Length = 317 3e-14
3udb_A 317 Crystal Structure Of Snrk2.6 Length = 317 4e-06
1wmk_A321 Human Death-Associated Kinase Drp-1, Mutant S308d D 3e-14
1wmk_A 321 Human Death-Associated Kinase Drp-1, Mutant S308d D 1e-07
3a62_A327 Crystal Structure Of Phosphorylated P70s6k1 Length 3e-14
3a62_A 327 Crystal Structure Of Phosphorylated P70s6k1 Length 5e-04
2a2a_A321 High-resolution Crystallographic Analysis Of The Au 3e-14
2a2a_A 321 High-resolution Crystallographic Analysis Of The Au 1e-07
1zws_A288 Crystal Structure Of The Catalytic Domain Of Human 3e-14
1zws_A 288 Crystal Structure Of The Catalytic Domain Of Human 1e-07
2w4k_A302 X-Ray Structure Of A Dap-Kinase 2-302 Length = 302 4e-14
2w4k_A 302 X-Ray Structure Of A Dap-Kinase 2-302 Length = 302 5e-08
2w4j_A277 X-Ray Structure Of A Dap-Kinase 2-277 Length = 277 4e-14
2w4j_A 277 X-Ray Structure Of A Dap-Kinase 2-277 Length = 277 6e-08
2yak_A285 Structure Of Death-Associated Protein Kinase 1 (Dap 4e-14
2yak_A 285 Structure Of Death-Associated Protein Kinase 1 (Dap 5e-08
1wvw_A278 Crystal Structures Of Kinase Domain Of Dap Kinase I 4e-14
1wvw_A 278 Crystal Structures Of Kinase Domain Of Dap Kinase I 6e-08
2xzs_A312 Death Associated Protein Kinase 1 Residues 1-312 Le 5e-14
2xzs_A 312 Death Associated Protein Kinase 1 Residues 1-312 Le 5e-08
2x0g_A334 X-ray Structure Of A Dap-kinase Calmodulin Complex 5e-14
2x0g_A 334 X-ray Structure Of A Dap-kinase Calmodulin Complex 4e-08
2hak_A328 Catalytic And Ubiqutin-Associated Domains Of Mark1P 5e-14
2hak_A 328 Catalytic And Ubiqutin-Associated Domains Of Mark1P 5e-06
2y0a_A326 Structure Of Dapk1 Construct Residues 1-304 Length 5e-14
2y0a_A 326 Structure Of Dapk1 Construct Residues 1-304 Length 6e-08
3gu4_A295 Crystal Structure Of Dapkq23v-Amppnp Length = 295 5e-14
3gu4_A 295 Crystal Structure Of Dapkq23v-Amppnp Length = 295 5e-08
1p4f_A293 Death Associated Protein Kinase Catalytic Domain Wi 5e-14
1p4f_A 293 Death Associated Protein Kinase Catalytic Domain Wi 5e-08
1ig1_A294 1.8a X-Ray Structure Of Ternary Complex Of A Cataly 5e-14
1ig1_A 294 1.8a X-Ray Structure Of Ternary Complex Of A Cataly 5e-08
3f5u_A295 Crystal Structure Of The Death Associated Protein K 6e-14
3f5u_A 295 Crystal Structure Of The Death Associated Protein K 5e-08
3dfc_B295 Crystal Structure Of A Glycine-Rich Loop Mutant Of 6e-14
3dfc_B 295 Crystal Structure Of A Glycine-Rich Loop Mutant Of 5e-08
2xuu_A334 Crystal Structure Of A Dap-Kinase 1 Mutant Length = 7e-14
2xuu_A 334 Crystal Structure Of A Dap-Kinase 1 Mutant Length = 4e-08
3zgw_A347 Crystal Structure Of Maternal Embryonic Leucine Zip 8e-14
3zgw_A 347 Crystal Structure Of Maternal Embryonic Leucine Zip 8e-06
2ya9_A361 Crystal Structure Of The Autoinhibited Form Of Mous 8e-14
2ya9_A 361 Crystal Structure Of The Autoinhibited Form Of Mous 1e-07
3zut_A362 The Structure Of Ost1 (D160a) Kinase Length = 362 1e-13
3zut_A 362 The Structure Of Ost1 (D160a) Kinase Length = 362 8e-05
3uc4_A362 The Crystal Structure Of Snf1-Related Kinase 2.6 Le 2e-13
3uc4_A 362 The Crystal Structure Of Snf1-Related Kinase 2.6 Le 1e-05
3zuu_A362 The Structure Of Ost1 (D160a, S175d) Kinase In Comp 2e-13
3zuu_A 362 The Structure Of Ost1 (D160a, S175d) Kinase In Comp 8e-05
3pwy_A311 Crystal Structure Of An Extender (Spd28345)-Modifie 2e-13
3pwy_A 311 Crystal Structure Of An Extender (Spd28345)-Modifie 6e-07
3qc4_A314 Pdk1 In Complex With Dfg-Out Inhibitor Xxx Length = 3e-13
3qc4_A 314 Pdk1 In Complex With Dfg-Out Inhibitor Xxx Length = 7e-07
3dxn_A287 Crystal Structure Of The Calcium-dependent Kinase F 3e-13
3dxn_A 287 Crystal Structure Of The Calcium-dependent Kinase F 3e-11
3ujg_A361 Crystal Structure Of Snrk2.6 In Complex With Hab1 L 3e-13
3ujg_A 361 Crystal Structure Of Snrk2.6 In Complex With Hab1 L 1e-05
3hzt_A467 Crystal Structure Of Toxoplasma Gondii Cdpk3, Tgme4 3e-13
3hzt_A 467 Crystal Structure Of Toxoplasma Gondii Cdpk3, Tgme4 2e-11
2z7q_A321 Crystal Structure Of The N-Terminal Kinase Domain O 3e-13
2z7q_A 321 Crystal Structure Of The N-Terminal Kinase Domain O 5e-05
3gu8_A295 Crystal Structure Of Dapkl93g With N6-Cyclopentylad 4e-13
3gu8_A 295 Crystal Structure Of Dapkl93g With N6-Cyclopentylad 6e-08
1gzn_A335 Structure Of Pkb Kinase Domain Length = 335 4e-13
1gzn_A 335 Structure Of Pkb Kinase Domain Length = 335 2e-07
1mrv_A339 Crystal Structure Of An Inactive Akt2 Kinase Domain 4e-13
1mrv_A 339 Crystal Structure Of An Inactive Akt2 Kinase Domain 2e-07
1gzk_A315 Molecular Mechanism For The Regulation Of Protein K 5e-13
1gzk_A 315 Molecular Mechanism For The Regulation Of Protein K 2e-07
4ejn_A446 Crystal Structure Of Autoinhibited Form Of Akt1 In 5e-13
4ejn_A 446 Crystal Structure Of Autoinhibited Form Of Akt1 In 1e-06
3o96_A446 Crystal Structure Of Human Akt1 With An Allosteric 5e-13
3o96_A 446 Crystal Structure Of Human Akt1 With An Allosteric 1e-06
4a07_A311 Human Pdk1 Kinase Domain In Complex With Allosteric 6e-13
4a07_A 311 Human Pdk1 Kinase Domain In Complex With Allosteric 7e-07
3nax_A311 Pdk1 In Complex With Inhibitor Mp7 Length = 311 7e-13
3nax_A 311 Pdk1 In Complex With Inhibitor Mp7 Length = 311 8e-07
3hrc_A311 Crystal Structure Of A Mutant Of Human Pdk1 Kinase 7e-13
3hrc_A 311 Crystal Structure Of A Mutant Of Human Pdk1 Kinase 7e-07
2r7b_A312 Crystal Structure Of The Phosphoinositide-Dependent 9e-13
2r7b_A 312 Crystal Structure Of The Phosphoinositide-Dependent 6e-07
4dc2_A396 Structure Of Pkc In Complex With A Substrate Peptid 1e-12
4dc2_A 396 Structure Of Pkc In Complex With A Substrate Peptid 2e-06
2jed_A352 The Crystal Structure Of The Kinase Domain Of The P 1e-12
2jed_A 352 The Crystal Structure Of The Kinase Domain Of The P 5e-05
3nay_A311 Pdk1 In Complex With Inhibitor Mp6 Length = 311 1e-12
3nay_A 311 Pdk1 In Complex With Inhibitor Mp6 Length = 311 9e-07
2biy_A310 Structure Of Pdk1-S241a Mutant Kinase Domain Length 1e-12
2biy_A 310 Structure Of Pdk1-S241a Mutant Kinase Domain Length 7e-07
3nun_A292 Phosphoinositide-Dependent Kinase-1 (Pdk1) With Lea 1e-12
3nun_A 292 Phosphoinositide-Dependent Kinase-1 (Pdk1) With Lea 8e-07
1xjd_A345 Crystal Structure Of Pkc-Theta Complexed With Staur 1e-12
1xjd_A 345 Crystal Structure Of Pkc-Theta Complexed With Staur 5e-05
2y94_A476 Structure Of An Active Form Of Mammalian Ampk Lengt 1e-12
2y94_A 476 Structure Of An Active Form Of Mammalian Ampk Lengt 3e-07
2xch_A309 Crystal Structure Of Pdk1 In Complex With A Pyrazol 1e-12
2xch_A 309 Crystal Structure Of Pdk1 In Complex With A Pyrazol 7e-07
3orx_A316 Pdk1 Mutant Bound To Allosteric Disulfide Fragment 1e-12
3orx_A 316 Pdk1 Mutant Bound To Allosteric Disulfide Fragment 7e-07
3rwp_A311 Discovery Of A Novel, Potent And Selective Inhibito 1e-12
3rwp_A 311 Discovery Of A Novel, Potent And Selective Inhibito 7e-07
1uu3_A310 Structure Of Human Pdk1 Kinase Domain In Complex Wi 1e-12
1uu3_A 310 Structure Of Human Pdk1 Kinase Domain In Complex Wi 7e-07
3nus_A286 Phosphoinositide-Dependent Kinase-1 (Pdk1) With Fra 1e-12
3nus_A 286 Phosphoinositide-Dependent Kinase-1 (Pdk1) With Fra 7e-07
1o6l_A337 Crystal Structure Of An Activated Akt/protein Kinas 1e-12
1o6l_A 337 Crystal Structure Of An Activated Akt/protein Kinas 2e-07
3sc1_A311 Novel Isoquinolone Pdk1 Inhibitors Discovered Throu 1e-12
3sc1_A 311 Novel Isoquinolone Pdk1 Inhibitors Discovered Throu 7e-07
2xck_A309 Crystal Structure Of Pdk1 In Complex With A Pyrazol 1e-12
2xck_A 309 Crystal Structure Of Pdk1 In Complex With A Pyrazol 7e-07
2jdo_A342 Structure Of Pkb-Beta (Akt2) Complexed With Isoquin 1e-12
2jdo_A 342 Structure Of Pkb-Beta (Akt2) Complexed With Isoquin 2e-07
1z5m_A286 Crystal Structure Of N1-[3-[[5-bromo-2-[[3-[(1-pyrr 1e-12
1z5m_A 286 Crystal Structure Of N1-[3-[[5-bromo-2-[[3-[(1-pyrr 7e-07
3ubd_A304 Structure Of N-Terminal Domain Of Rsk2 Kinase In Co 1e-12
3ubd_A 304 Structure Of N-Terminal Domain Of Rsk2 Kinase In Co 3e-04
4el9_A305 Structure Of N-Terminal Kinase Domain Of Rsk2 With 2e-12
4el9_A 305 Structure Of N-Terminal Kinase Domain Of Rsk2 With 3e-04
3h9o_A311 Phosphoinositide-Dependent Protein Kinase 1 (Pdk-1) 2e-12
3h9o_A 311 Phosphoinositide-Dependent Protein Kinase 1 (Pdk-1) 7e-07
3e87_A335 Crystal Structures Of The Kinase Domain Of Akt2 In 2e-12
3e87_A 335 Crystal Structures Of The Kinase Domain Of Akt2 In 2e-07
1uu9_A286 Structure Of Human Pdk1 Kinase Domain In Complex Wi 2e-12
1uu9_A 286 Structure Of Human Pdk1 Kinase Domain In Complex Wi 7e-07
1o6k_A336 Structure Of Activated Form Of Pkb Kinase Domain S4 2e-12
1o6k_A 336 Structure Of Activated Form Of Pkb Kinase Domain S4 2e-07
3iop_A312 Pdk-1 In Complex With The Inhibitor Compound-8i Len 2e-12
3iop_A 312 Pdk-1 In Complex With The Inhibitor Compound-8i Len 7e-07
1h1w_A289 High Resolution Crystal Structure Of The Human Pdk1 2e-12
1h1w_A 289 High Resolution Crystal Structure Of The Human Pdk1 6e-07
3ocb_A341 Akt1 Kinase Domain With Pyrrolopyrimidine Inhibitor 2e-12
3ocb_A 341 Akt1 Kinase Domain With Pyrrolopyrimidine Inhibitor 1e-06
4gv1_A340 Pkb Alpha In Complex With Azd5363 Length = 340 2e-12
4gv1_A 340 Pkb Alpha In Complex With Azd5363 Length = 340 2e-06
3g51_A325 Structural Diversity Of The Active Conformation Of 2e-12
3g51_A 325 Structural Diversity Of The Active Conformation Of 3e-04
3cqu_A342 Crystal Structure Of Akt-1 Complexed With Substrate 2e-12
3cqu_A 342 Crystal Structure Of Akt-1 Complexed With Substrate 2e-06
2wtk_C305 Structure Of The Heterotrimeric Lkb1-Stradalpha-Mo2 2e-12
2wtk_C 305 Structure Of The Heterotrimeric Lkb1-Stradalpha-Mo2 9e-06
2r5t_A373 Crystal Structure Of Inactive Serum And Glucocortic 3e-12
2r5t_A 373 Crystal Structure Of Inactive Serum And Glucocortic 1e-05
3uc3_A361 The Crystal Structure Of Snf1-Related Kinase 2.3 Le 3e-12
3uc3_A 361 The Crystal Structure Of Snf1-Related Kinase 2.3 Le 2e-06
3q5i_A504 Crystal Structure Of Pbanka_031420 Length = 504 3e-12
3q5i_A 504 Crystal Structure Of Pbanka_031420 Length = 504 3e-06
3zh8_A349 A Novel Small Molecule Apkc Inhibitor Length = 349 3e-12
3zh8_A 349 A Novel Small Molecule Apkc Inhibitor Length = 349 2e-06
3a8w_A345 Crystal Structure Of Pkciota Kinase Domain Length = 4e-12
3a8w_A 345 Crystal Structure Of Pkciota Kinase Domain Length = 2e-06
1zrz_A364 Crystal Structure Of The Catalytic Domain Of Atypic 6e-12
1zrz_A 364 Crystal Structure Of The Catalytic Domain Of Atypic 2e-06
3kn5_A325 Crystal Structure Of The C-Terminal Kinase Domain O 6e-12
3kn5_A 325 Crystal Structure Of The C-Terminal Kinase Domain O 3e-07
3iw4_A360 Crystal Structure Of Pkc Alpha In Complex With Nvp- 8e-12
3iw4_A 360 Crystal Structure Of Pkc Alpha In Complex With Nvp- 4e-07
2w5a_A279 Human Nek2 Kinase Adp-Bound Length = 279 1e-11
2w5a_A 279 Human Nek2 Kinase Adp-Bound Length = 279 5e-04
1fot_A318 Structure Of The Unliganded Camp-Dependent Protein 2e-11
1fot_A 318 Structure Of The Unliganded Camp-Dependent Protein 3e-05
2cn5_A329 Crystal Structure Of Human Chk2 In Complex With Adp 2e-11
2cn5_A 329 Crystal Structure Of Human Chk2 In Complex With Adp 1e-05
2ycf_A322 Crystal Structure Of Checkpoint Kinase 2 In Complex 2e-11
2ycf_A 322 Crystal Structure Of Checkpoint Kinase 2 In Complex 1e-05
2w0j_A323 Crystal Structure Of Chk2 In Complex With Nsc 10955 2e-11
2w0j_A 323 Crystal Structure Of Chk2 In Complex With Nsc 10955 1e-05
2ycr_A323 Crystal Structure Of Checkpoint Kinase 2 In Complex 2e-11
2ycr_A 323 Crystal Structure Of Checkpoint Kinase 2 In Complex 1e-05
2xk9_A322 Structural Analysis Of Checkpoint Kinase 2 (Chk2) I 3e-11
2xk9_A 322 Structural Analysis Of Checkpoint Kinase 2 (Chk2) I 1e-05
3i6w_A443 Structure And Activation Mechanism Of The Chk2 Dna- 3e-11
3i6w_A 443 Structure And Activation Mechanism Of The Chk2 Dna- 7e-06
3i6u_A419 Structure And Activation Mechanism Of The Chk2 Dna- 3e-11
3i6u_A 419 Structure And Activation Mechanism Of The Chk2 Dna- 8e-06
3txo_A353 Pkc Eta Kinase In Complex With A Naphthyridine Leng 3e-11
3txo_A 353 Pkc Eta Kinase In Complex With A Naphthyridine Leng 6e-06
3igo_A486 Crystal Structure Of Cryptosporidium Parvum Cdpk1, 3e-11
3igo_A 486 Crystal Structure Of Cryptosporidium Parvum Cdpk1, 1e-08
3r1n_A317 Mk3 Kinase Bound To Compound 5b Length = 317 4e-11
3r1n_A 317 Mk3 Kinase Bound To Compound 5b Length = 317 3e-04
3fhr_A336 High Resolution Crystal Structure Of Mitogen-Activa 5e-11
3fhr_A 336 High Resolution Crystal Structure Of Mitogen-Activa 3e-04
2jav_A279 Human Kinase With Pyrrole-Indolinone Ligand Length 5e-11
2jav_A 279 Human Kinase With Pyrrole-Indolinone Ligand Length 5e-04
1ql6_A298 The Catalytic Mechanism Of Phosphorylase Kinase Pro 5e-11
1ql6_A 298 The Catalytic Mechanism Of Phosphorylase Kinase Pro 1e-06
3dfa_A286 Crystal Structure Of Kinase Domain Of Calcium-depen 6e-11
3dfa_A 286 Crystal Structure Of Kinase Domain Of Calcium-depen 2e-08
1phk_A298 Two Structures Of The Catalytic Domain Of Phosphory 6e-11
1phk_A 298 Two Structures Of The Catalytic Domain Of Phosphory 1e-06
4a4x_A279 Nek2-Ede Bound To Cct248662 Length = 279 6e-11
4a4x_A 279 Nek2-Ede Bound To Cct248662 Length = 279 6e-04
2wei_A287 Crystal Structure Of The Kinase Domain Of Cryptospo 6e-11
2wei_A 287 Crystal Structure Of The Kinase Domain Of Cryptospo 2e-08
2uzt_A336 Pka Structures Of Akt, Indazole-Pyridine Inhibitors 6e-11
2uzt_A 336 Pka Structures Of Akt, Indazole-Pyridine Inhibitors 1e-06
4dfy_A371 Crystal Structure Of R194a Mutant Of Camp-Dependent 7e-11
4dfy_A 371 Crystal Structure Of R194a Mutant Of Camp-Dependent 1e-06
2f7e_E351 Pka Complexed With (S)-2-(1h-Indol-3-Yl)-1-(5-Isoqu 7e-11
2f7e_E 351 Pka Complexed With (S)-2-(1h-Indol-3-Yl)-1-(5-Isoqu 1e-06
2phk_A277 The Crystal Structure Of A Phosphorylase Kinase Pep 7e-11
2phk_A 277 The Crystal Structure Of A Phosphorylase Kinase Pep 1e-06
2w4o_A349 Crystal Structure Of Human Camk4 In Complex With 4- 7e-11
2w4o_A 349 Crystal Structure Of Human Camk4 In Complex With 4- 8e-06
3ku2_A507 Crystal Structure Of Inactivated Form Of Cdpk1 From 7e-11
3ku2_A 507 Crystal Structure Of Inactivated Form Of Cdpk1 From 4e-09
3hx4_A508 Crystal Structure Of Cdpk1 Of Toxoplasma Gondii, Tg 8e-11
3hx4_A 508 Crystal Structure Of Cdpk1 Of Toxoplasma Gondii, Tg 4e-09
3i79_A484 Calcium-Dependent Protein Kinase 1 From Toxoplasma 8e-11
3i79_A 484 Calcium-Dependent Protein Kinase 1 From Toxoplasma 3e-09
2i0e_A353 Structure Of Catalytic Domain Of Human Protein Kina 1e-10
2i0e_A 353 Structure Of Catalytic Domain Of Human Protein Kina 2e-06
3pfq_A674 Crystal Structure And Allosteric Activation Of Prot 1e-10
3pfq_A 674 Crystal Structure And Allosteric Activation Of Prot 3e-06
3ma6_A298 Crystal Structure Of Kinase Domain Of Tgcdpk1 In Pr 1e-10
3ma6_A 298 Crystal Structure Of Kinase Domain Of Tgcdpk1 In Pr 5e-09
2c30_A321 Crystal Structure Of The Human P21-Activated Kinase 1e-10
2c30_A 321 Crystal Structure Of The Human P21-Activated Kinase 1e-04
2y7j_A365 Structure Of Human Phosphorylase Kinase, Gamma 2 Le 2e-10
2y7j_A 365 Structure Of Human Phosphorylase Kinase, Gamma 2 Le 4e-10
1vzo_A355 The Structure Of The N-Terminal Kinase Domain Of Ms 2e-10
1vzo_A 355 The Structure Of The N-Terminal Kinase Domain Of Ms 3e-05
3uiu_A 306 Crystal Structure Of Apo-Pkr Kinase Domain Length = 2e-10
3i7c_A484 Calcium-Dependent Protein Kinase 1 From Toxoplasma 2e-10
3i7c_A 484 Calcium-Dependent Protein Kinase 1 From Toxoplasma 7e-09
1ydt_E350 Structure Of Camp-Dependent Protein Kinase, Alpha-C 2e-10
1ydt_E 350 Structure Of Camp-Dependent Protein Kinase, Alpha-C 2e-06
4ae9_A343 Structure And Function Of The Human Sperm-specific 2e-10
4ae9_A 343 Structure And Function Of The Human Sperm-specific 2e-06
4ae6_A343 Structure And Function Of The Human Sperm-specific 2e-10
4ae6_A 343 Structure And Function Of The Human Sperm-specific 1e-06
1syk_A350 Crystal Structure Of E230q Mutant Of Camp-Dependent 2e-10
1syk_A 350 Crystal Structure Of E230q Mutant Of Camp-Dependent 1e-06
4apc_A350 Crystal Structure Of Human Nima-Related Kinase 1 (N 2e-10
4apc_A 350 Crystal Structure Of Human Nima-Related Kinase 1 (N 4e-06
3nx8_A351 Human Camp Dependent Protein Kinase In Complex With 2e-10
3nx8_A 351 Human Camp Dependent Protein Kinase In Complex With 1e-06
1q24_A350 Pka Double Mutant Model Of Pkb In Complex With Mgat 2e-10
1q24_A 350 Pka Double Mutant Model Of Pkb In Complex With Mgat 2e-06
1ctp_E350 Structure Of The Mammalian Catalytic Subunit Of Cam 2e-10
1ctp_E 350 Structure Of The Mammalian Catalytic Subunit Of Cam 1e-06
3agm_A351 Complex Of Pka With The Bisubstrate Protein Kinase 2e-10
3agm_A 351 Complex Of Pka With The Bisubstrate Protein Kinase 1e-06
2gng_A350 Protein Kinase A Fivefold Mutant Model Of Rho-Kinas 2e-10
2gng_A 350 Protein Kinase A Fivefold Mutant Model Of Rho-Kinas 4e-07
1cdk_A350 Camp-Dependent Protein Kinase Catalytic Subunit (E. 2e-10
1cdk_A 350 Camp-Dependent Protein Kinase Catalytic Subunit (E. 1e-06
3o7l_B350 Crystal Structure Of Phospholamban (1-19):pka C-Sub 2e-10
3o7l_B 350 Crystal Structure Of Phospholamban (1-19):pka C-Sub 2e-06
3dnd_A350 Camp-Dependent Protein Kinase Pka Catalytic Subunit 2e-10
3dnd_A 350 Camp-Dependent Protein Kinase Pka Catalytic Subunit 1e-06
2gnj_A350 Pka Three Fold Mutant Model Of Rho-Kinase With Y-27 2e-10
2gnj_A 350 Pka Three Fold Mutant Model Of Rho-Kinase With Y-27 4e-07
4dg3_E371 Crystal Structure Of R336a Mutant Of Camp-dependent 2e-10
4dg3_E 371 Crystal Structure Of R336a Mutant Of Camp-dependent 2e-06
1svh_A350 Crystal Structure Of Protein Kinase A In Complex Wi 2e-10
1svh_A 350 Crystal Structure Of Protein Kinase A In Complex Wi 1e-06
4dfx_E350 Crystal Structure Of Myristoylated K7c Catalytic Su 2e-10
4dfx_E 350 Crystal Structure Of Myristoylated K7c Catalytic Su 2e-06
3agl_A351 Complex Of Pka With The Bisubstrate Protein Kinase 2e-10
3agl_A 351 Complex Of Pka With The Bisubstrate Protein Kinase 1e-06
2gu8_A337 Discovery Of 2-pyrimidyl-5-amidothiophenes As Novel 2e-10
2gu8_A 337 Discovery Of 2-pyrimidyl-5-amidothiophenes As Novel 9e-07
2gnf_A350 Protein Kinase A Fivefold Mutant Model Of Rho-Kinas 2e-10
2gnf_A 350 Protein Kinase A Fivefold Mutant Model Of Rho-Kinas 4e-07
2c1a_A351 Structure Of Camp-Dependent Protein Kinase Complexe 2e-10
2c1a_A 351 Structure Of Camp-Dependent Protein Kinase Complexe 1e-06
2erz_E351 Crystal Structure Of C-amp Dependent Kinase (pka) B 2e-10
2erz_E 351 Crystal Structure Of C-amp Dependent Kinase (pka) B 1e-06
1q61_A350 Pka Triple Mutant Model Of Pkb Length = 350 2e-10
1q61_A 350 Pka Triple Mutant Model Of Pkb Length = 350 7e-07
1l3r_E350 Crystal Structure Of A Transition State Mimic Of Th 2e-10
1l3r_E 350 Crystal Structure Of A Transition State Mimic Of Th 3e-06
3l9m_A351 Crystal Structure Of Pkab3 (Pka Triple Mutant V123a 2e-10
3l9m_A 351 Crystal Structure Of Pkab3 (Pka Triple Mutant V123a 7e-07
1fmo_E350 Crystal Structure Of A Polyhistidine-Tagged Recombi 2e-10
1fmo_E 350 Crystal Structure Of A Polyhistidine-Tagged Recombi 1e-06
3ama_A351 Protein Kinase A Sixfold Mutant Model Of Aurora B W 2e-10
3ama_A 351 Protein Kinase A Sixfold Mutant Model Of Aurora B W 4e-07
2qcs_A350 A Complex Structure Between The Catalytic And Regul 2e-10
2qcs_A 350 A Complex Structure Between The Catalytic And Regul 3e-06
2jdt_A351 Structure Of Pka-Pkb Chimera Complexed With Isoquin 2e-10
2jdt_A 351 Structure Of Pka-Pkb Chimera Complexed With Isoquin 7e-07
1bkx_A350 A Binary Complex Of The Catalytic Subunit Of Camp-D 2e-10
1bkx_A 350 A Binary Complex Of The Catalytic Subunit Of Camp-D 2e-06
1smh_A350 Protein Kinase A Variant Complex With Completely Or 3e-10
1smh_A 350 Protein Kinase A Variant Complex With Completely Or 6e-07
1szm_A350 Dual Binding Mode Of Bisindolylmaleimide 2 To Prote 3e-10
1szm_A 350 Dual Binding Mode Of Bisindolylmaleimide 2 To Prote 1e-06
3pvb_A345 Crystal Structure Of (73-244)ria:c Holoenzyme Of Ca 3e-10
3pvb_A 345 Crystal Structure Of (73-244)ria:c Holoenzyme Of Ca 3e-06
3mvj_A371 Human Cyclic Amp-Dependent Protein Kinase Pka Inhib 3e-10
3mvj_A 371 Human Cyclic Amp-Dependent Protein Kinase Pka Inhib 2e-06
1cmk_E350 Crystal Structures Of The Myristylated Catalytic Su 3e-10
1cmk_E 350 Crystal Structures Of The Myristylated Catalytic Su 2e-06
1apm_E350 2.0 Angstrom Refined Crystal Structure Of The Catal 3e-10
1apm_E 350 2.0 Angstrom Refined Crystal Structure Of The Catal 2e-06
2qur_A350 Crystal Structure Of F327aK285P MUTANT OF CAMP-Depe 3e-10
2qur_A 350 Crystal Structure Of F327aK285P MUTANT OF CAMP-Depe 1e-06
2vo0_A351 Structure Of Pka-Pkb Chimera Complexed With C-(4-(4 3e-10
2vo0_A 351 Structure Of Pka-Pkb Chimera Complexed With C-(4-(4 7e-07
2uvy_A351 Structure Of Pka-pkb Chimera Complexed With Methyl- 3e-10
2uvy_A 351 Structure Of Pka-pkb Chimera Complexed With Methyl- 1e-06
1xh7_A350 Crystal Structures Of Protein Kinase B Selective In 3e-10
1xh7_A 350 Crystal Structures Of Protein Kinase B Selective In 3e-06
1q8w_A350 The Catalytic Subunit Of Camp-Dependent Protein Kin 3e-10
1q8w_A 350 The Catalytic Subunit Of Camp-Dependent Protein Kin 3e-06
2jds_A351 Structure Of Camp-Dependent Protein Kinase Complexe 3e-10
2jds_A 351 Structure Of Camp-Dependent Protein Kinase Complexe 3e-06
1stc_E350 Camp-Dependent Protein Kinase, Alpha-Catalytic Subu 3e-10
1stc_E 350 Camp-Dependent Protein Kinase, Alpha-Catalytic Subu 2e-06
1xh9_A350 Crystal Structures Of Protein Kinase B Selective In 3e-10
1xh9_A 350 Crystal Structures Of Protein Kinase B Selective In 3e-07
1jbp_E350 Crystal Structure Of The Catalytic Subunit Of Camp- 3e-10
1jbp_E 350 Crystal Structure Of The Catalytic Subunit Of Camp- 2e-06
3mfr_A351 Cask-4m Cam Kinase Domain, Native Length = 351 4e-10
3mfr_A 351 Cask-4m Cam Kinase Domain, Native Length = 351 5e-07
4fsn_A278 Crystal Structure Of The Chk1 Length = 278 5e-10
4fsn_A 278 Crystal Structure Of The Chk1 Length = 278 1e-06
4fsu_A279 Crystal Structure Of The Chk1 Length = 279 5e-10
4fsu_A 279 Crystal Structure Of The Chk1 Length = 279 1e-06
2x8e_A276 Discovery Of A Novel Class Of Triazolones As Checkp 5e-10
2x8e_A 276 Discovery Of A Novel Class Of Triazolones As Checkp 1e-06
2br1_A297 Structure-Based Design Of Novel Chk1 Inhibitors: In 5e-10
2br1_A 297 Structure-Based Design Of Novel Chk1 Inhibitors: In 1e-06
1ia8_A289 The 1.7 A Crystal Structure Of Human Cell Cycle Che 5e-10
1ia8_A 289 The 1.7 A Crystal Structure Of Human Cell Cycle Che 1e-06
1zlt_A295 Crystal Structure Of Chk1 Complexed With A Hymenald 5e-10
1zlt_A 295 Crystal Structure Of Chk1 Complexed With A Hymenald 1e-06
4fsm_A279 Crystal Structure Of The Chk1 Length = 279 5e-10
4fsm_A 279 Crystal Structure Of The Chk1 Length = 279 1e-06
4fsy_A279 Crystal Structure Of The Chk1 Length = 279 5e-10
4fsy_A 279 Crystal Structure Of The Chk1 Length = 279 1e-06
2hog_A322 Crystal Structure Of Chek1 In Complex With Inhibito 5e-10
2hog_A 322 Crystal Structure Of Chek1 In Complex With Inhibito 9e-07
2r0u_A323 Crystal Structure Of Chek1 In Complex With Inhibito 5e-10
2r0u_A 323 Crystal Structure Of Chek1 In Complex With Inhibito 9e-07
3ot3_A273 X-Ray Crystal Structure Of Compound 22k Bound To Hu 6e-10
3ot3_A 273 X-Ray Crystal Structure Of Compound 22k Bound To Hu 1e-06
3jvr_A271 Characterization Of The Chk1 Allosteric Inhibitor B 6e-10
3jvr_A 271 Characterization Of The Chk1 Allosteric Inhibitor B 1e-06
4fif_A346 Catalytic Domain Of Human Pak4 With Rpkplvdp Peptid 6e-10
4fif_A 346 Catalytic Domain Of Human Pak4 With Rpkplvdp Peptid 4e-04
2ghg_A269 H-Chk1 Complexed With A431994 Length = 269 6e-10
2ghg_A 269 H-Chk1 Complexed With A431994 Length = 269 1e-06
2cdz_A303 Crystal Structure Of The Human P21-Activated Kinase 7e-10
2cdz_A 303 Crystal Structure Of The Human P21-Activated Kinase 4e-04
2e9v_A268 Structure Of H-Chk1 Complexed With A859017 Length = 7e-10
2e9v_A 268 Structure Of H-Chk1 Complexed With A859017 Length = 1e-06
2ayp_A269 Crystal Structure Of Chk1 With An Indol Inhibitor L 7e-10
2ayp_A 269 Crystal Structure Of Chk1 With An Indol Inhibitor L 1e-06
4fie_A423 Full-Length Human Pak4 Length = 423 7e-10
4fie_A 423 Full-Length Human Pak4 Length = 423 3e-04
2q0n_A301 Structure Of Human P21 Activating Kinase 4 (Pak4) I 7e-10
2q0n_A 301 Structure Of Human P21 Activating Kinase 4 (Pak4) I 4e-04
3qal_E350 Crystal Structure Of Arg280ala Mutant Of Catalytic 8e-10
3qal_E 350 Crystal Structure Of Arg280ala Mutant Of Catalytic 1e-06
2x4z_A296 Crystal Structure Of The Human P21-Activated Kinase 8e-10
2x4z_A 296 Crystal Structure Of The Human P21-Activated Kinase 5e-04
2bva_A292 Crystal Structure Of The Human P21-Activated Kinase 9e-10
2bva_A 292 Crystal Structure Of The Human P21-Activated Kinase 5e-04
2zv2_A 298 Crystal Structure Of Human CalciumCALMODULIN-Depend 9e-10
3qam_E350 Crystal Structure Of Glu208ala Mutant Of Catalytic 1e-09
3qam_E 350 Crystal Structure Of Glu208ala Mutant Of Catalytic 1e-06
2jbo_A326 Protein Kinase Mk2 In Complex With An Inhibitor (Cr 1e-09
2jbo_A 326 Protein Kinase Mk2 In Complex With An Inhibitor (Cr 6e-05
2p3g_X327 Crystal Structure Of A Pyrrolopyridine Inhibitor Bo 1e-09
2p3g_X 327 Crystal Structure Of A Pyrrolopyridine Inhibitor Bo 6e-05
2pzy_A324 Structure Of Mk2 Complexed With Compound 76 Length 1e-09
2pzy_A 324 Structure Of Mk2 Complexed With Compound 76 Length 6e-05
1zys_A273 Co-Crystal Structure Of Checkpoint Kinase Chk1 With 1e-09
1zys_A 273 Co-Crystal Structure Of Checkpoint Kinase Chk1 With 1e-06
3tac_A361 Crystal Structure Of The Liprin-AlphaCASK COMPLEX L 2e-09
3tac_A 361 Crystal Structure Of The Liprin-AlphaCASK COMPLEX L 2e-05
2a19_B 284 Pkr Kinase Domain- Eif2alpha- Amp-Pnp Complex. Leng 2e-09
1kwp_A400 Crystal Structure Of Mapkap2 Length = 400 2e-09
1kwp_A 400 Crystal Structure Of Mapkap2 Length = 400 6e-05
2onl_C406 Crystal Structure Of The P38a-Mapkap Kinase 2 Heter 2e-09
2onl_C 406 Crystal Structure Of The P38a-Mapkap Kinase 2 Heter 6e-05
3r2y_A319 Mk2 Kinase Bound To Compound 1 Length = 319 2e-09
3r2y_A 319 Mk2 Kinase Bound To Compound 1 Length = 319 6e-05
3fpm_A325 Crystal Structure Of A Squarate Inhibitor Bound To 2e-09
3fpm_A 325 Crystal Structure Of A Squarate Inhibitor Bound To 6e-05
3gok_A334 Binding Site Mapping Of Protein Ligands Length = 33 2e-09
3gok_A 334 Binding Site Mapping Of Protein Ligands Length = 33 7e-05
2oza_A356 Structure Of P38alpha Complex Length = 356 2e-09
2oza_A 356 Structure Of P38alpha Complex Length = 356 7e-05
3r2b_A318 Mk2 Kinase Bound To Compound 5b Length = 318 2e-09
3r2b_A 318 Mk2 Kinase Bound To Compound 5b Length = 318 6e-05
3c0g_A351 Cask Cam-kinase Domain- 3'-amp Complex, P1 Form Len 2e-09
3c0g_A 351 Cask Cam-kinase Domain- 3'-amp Complex, P1 Form Len 3e-05
3ka0_A320 Mk2 Complex With Inhibitor 6-(5-(2-Aminopyrimidin-4 2e-09
3ka0_A 320 Mk2 Complex With Inhibitor 6-(5-(2-Aminopyrimidin-4 6e-05
3lm0_A327 Crystal Structure Of Human SerineTHREONINE KINASE 1 2e-09
3lm0_A 327 Crystal Structure Of Human SerineTHREONINE KINASE 1 8e-06
1rdq_E350 Hydrolysis Of Atp In The Crystal Of Y204a Mutant Of 3e-09
1rdq_E 350 Hydrolysis Of Atp In The Crystal Of Y204a Mutant Of 1e-06
3fhi_A350 Crystal Structure Of A Complex Between The Catalyti 3e-09
3fhi_A 350 Crystal Structure Of A Complex Between The Catalyti 1e-06
2j51_A 325 Crystal Structure Of Human Ste20-Like Kinase Bound 3e-09
2jfm_A 325 Crystal Structure Of Human Ste20-Like Kinase (Unlig 3e-09
2jfl_A 325 Crystal Structure Of Human Ste20-Like Kinase ( Diph 3e-09
1koa_A491 Twitchin Kinase Fragment (C.Elegans), Autoregulated 3e-09
4g31_A299 Crystal Structure Of Gsk6414 Bound To Perk (R587-R1 3e-09
4g31_A 299 Crystal Structure Of Gsk6414 Bound To Perk (R587-R1 9e-07
2uv2_A 287 Crystal Structure Of Human Ste20-Like Kinase Bound 3e-09
3nyn_A576 Crystal Structure Of G Protein-Coupled Receptor Kin 4e-09
3nyn_A 576 Crystal Structure Of G Protein-Coupled Receptor Kin 3e-05
2acx_A576 Crystal Structure Of G Protein Coupled Receptor Kin 4e-09
2acx_A 576 Crystal Structure Of G Protein Coupled Receptor Kin 3e-05
3uto_A573 Twitchin Kinase Region From C.Elegans (Fn31-Nl-Kin- 4e-09
3uto_A 573 Twitchin Kinase Region From C.Elegans (Fn31-Nl-Kin- 8e-04
2f57_A317 Crystal Structure Of The Human P21-activated Kinase 5e-09
2f57_A 317 Crystal Structure Of The Human P21-activated Kinase 2e-04
1j3h_A350 Crystal Structure Of Apoenzyme Camp-Dependent Prote 5e-09
1j3h_A 350 Crystal Structure Of Apoenzyme Camp-Dependent Prote 2e-06
4ft3_A279 Crystal Structure Of The Chk1 Length = 279 5e-09
4ft3_A 279 Crystal Structure Of The Chk1 Length = 279 1e-06
2v55_A406 Mechanism Of Multi-site Phosphorylation From A Rock 5e-09
2esm_A415 Crystal Structure Of Rock 1 Bound To Fasudil Length 6e-09
3v8s_A410 Human Rho-Associated Protein Kinase 1 (Rock 1) In C 6e-09
1nxk_A400 Crystal Structure Of Staurosporine Bound To Map Kap 7e-09
1nxk_A 400 Crystal Structure Of Staurosporine Bound To Map Kap 3e-04
2i6l_A 320 Crystal Structure Of Human Mitogen Activated Protei 7e-09
4ic7_A 442 Crystal Structure Of The Erk5 Kinase Domain In Comp 7e-09
4fsw_A279 Crystal Structure Of The Chk1 Length = 279 9e-09
4fsw_A 279 Crystal Structure Of The Chk1 Length = 279 1e-06
4b99_A 398 Crystal Structure Of Mapk7 (Erk5) With Inhibitor Le 1e-08
2wqm_A310 Structure Of Apo Human Nek7 Length = 310 1e-08
2wqm_A 310 Structure Of Apo Human Nek7 Length = 310 1e-05
1ua2_A 346 Crystal Structure Of Human Cdk7 Length = 346 1e-08
4fsz_A279 Crystal Structure Of The Chk1 Length = 279 1e-08
4fsz_A 279 Crystal Structure Of The Chk1 Length = 279 1e-06
4fr4_A384 Crystal Structure Of Human SerineTHREONINE-Protein 1e-08
2ydj_A276 Discovery Of Checkpoint Kinase Inhibitor Azd7762 By 1e-08
2ydj_A 276 Discovery Of Checkpoint Kinase Inhibitor Azd7762 By 1e-06
3ii5_A 306 The Complex Of Wild-Type B-Raf With Pyrazolo Pyrimi 1e-08
3c4c_A 280 B-Raf Kinase In Complex With Plx4720 Length = 280 1e-08
4fk3_A 292 B-Raf Kinase V600e Oncogenic Mutant In Complex With 1e-08
3og7_A 289 B-Raf Kinase V600e Oncogenic Mutant In Complex With 1e-08
4g9r_A 307 B-Raf V600e Kinase Domain Bound To A Type Ii Dihydr 1e-08
3d4q_A 307 Pyrazole-Based Inhibitors Of B-Raf Kinase Length = 1e-08
3idp_A 300 B-Raf V600e Kinase Domain In Complex With An Aminoi 1e-08
4fst_A269 Crystal Structure Of The Chk1 Length = 269 1e-08
4fst_A 269 Crystal Structure Of The Chk1 Length = 269 1e-06
3q96_A 282 B-Raf Kinase Domain In Complex With A Tetrahydronap 1e-08
2fb8_A 281 Structure Of The B-Raf Kinase Domain Bound To Sb-59 1e-08
3niz_A 311 Cryptosporidium Parvum Cyclin-Dependent Kinase Cgd5 1e-08
1u5q_A 348 Crystal Structure Of The Tao2 Kinase Domain: Activa 1e-08
4dbn_A 284 Crystal Structure Of The Kinase Domain Of Human B-R 1e-08
2j7t_A 302 Crystal Structure Of Human Serine Threonine Kinase- 1e-08
1uwj_A 276 The Complex Of Mutant V599e B-raf And Bay439006 Len 1e-08
1uwh_A 276 The Complex Of Wild Type B-Raf And Bay439006 Length 1e-08
4bc6_A 293 Crystal Structure Of Human Serine Threonine Kinase- 2e-08
4h58_A 275 Braf In Complex With Compound 3 Length = 275 2e-08
2qkr_A 313 Cryptosporidium Parvum Cyclin-Dependent Kinase Cgd5 2e-08
2f2u_A402 Crystal Structure Of The Rho-Kinase Kinase Domain L 2e-08
2x4f_A373 The Crystal Structure Of The Human Myosin Light Cha 2e-08
2x4f_A 373 The Crystal Structure Of The Human Myosin Light Cha 3e-05
2gcd_A 309 Tao2 Kinase Domain-Staurosporine Structure Length = 2e-08
3omv_A 307 Crystal Structure Of C-Raf (Raf-1) Length = 307 2e-08
2x7f_A 326 Crystal Structure Of The Kinase Domain Of Human Tra 3e-08
1zyc_A 303 Crystal Structure Of Eif2alpha Protein Kinase Gcn2: 4e-08
1zy4_A 303 Crystal Structure Of Eif2alpha Protein Kinase Gcn2: 4e-08
2hw6_A307 Crystal Structure Of Mnk1 Catalytic Domain Length = 4e-08
4aw2_A437 Crystal Structure Of Cdc42 Binding Protein Kinase A 5e-08
3qd2_B332 Crsytal Structure Of Mouse Perk Kinase Domain Lengt 5e-08
3qd2_B 332 Crsytal Structure Of Mouse Perk Kinase Domain Lengt 6e-07
3dak_A 290 Crystal Structure Of Domain-Swapped Osr1 Kinase Dom 5e-08
2vwi_A 303 Structure Of The Osr1 Kinase, A Hypertension Drug T 5e-08
3lxn_A 318 Structural And Thermodynamic Characterization Of Th 7e-08
3com_A314 Crystal Structure Of Mst1 Kinase Length = 314 7e-08
3com_A 314 Crystal Structure Of Mst1 Kinase Length = 314 3e-07
3zhp_C 294 Human Mst3 (stk24) In Complex With Mo25beta Length 8e-08
3a7f_A 303 Human Mst3 Kinase Length = 303 8e-08
3ggf_A 301 Crystal Structure Of Human SerineTHREONINE-Protein 8e-08
3ckw_A 304 Crystal Structure Of Sterile 20-Like Kinase 3 (Mst3 8e-08
3ckx_A 304 Crystal Structure Of Sterile 20-Like Kinase 3 (Mst3 9e-08
3qfv_A415 Mrck Beta In Complex With Tpca-1 Length = 415 9e-08
3qfv_A 415 Mrck Beta In Complex With Tpca-1 Length = 415 7e-04
3tku_A433 Mrck Beta In Complex With Fasudil Length = 433 1e-07
3tku_A 433 Mrck Beta In Complex With Fasudil Length = 433 7e-04
4dn5_A 356 Crystal Structure Of Nf-kb-inducing Kinase (nik) Le 1e-07
1zxe_A 303 Crystal Structure Of Eif2alpha Protein Kinase Gcn2: 1e-07
4g3d_A 371 Crystal Structure Of Human Nf-kappab Inducing Kinas 1e-07
1ung_A292 Structural Mechanism For The Inhibition Of Cdk5-P25 2e-07
1ung_A 292 Structural Mechanism For The Inhibition Of Cdk5-P25 1e-04
1oit_A 299 Imidazopyridines: A Potent And Selective Class Of C 2e-07
2xik_A294 Structure Of Human Ysk1 (Yeast Sps1-Ste20-Related K 2e-07
2xik_A 294 Structure Of Human Ysk1 (Yeast Sps1-Ste20-Related K 4e-07
3nyx_A 302 Non-Phosphorylated Tyk2 Jh1 Domain With Quinoline-T 2e-07
3d83_A 360 Crystal Structure Of P38 Kinase In Complex With A B 2e-07
3qc9_A 543 Crystal Structure Of Cross-Linked Bovine Grk1 T8cN4 3e-07
3nz0_A 302 Non-Phosphorylated Tyk2 Kinase With Cmp6 Length = 3 3e-07
3c4x_A 543 Crystal Structure Of G Protein Coupled Receptor Kin 3e-07
3c4w_A 543 Crystal Structure Of G Protein Coupled Receptor Kin 3e-07
3t8o_A 543 Rhodopsin Kinase (grk1) L166k Mutant At 2.5a Resolu 3e-07
3pxf_A 306 Cdk2 In Complex With Two Molecules Of 8-Anilino-1-N 3e-07
4eoj_A 302 Thr 160 Phosphorylated Cdk2 H84s, Q85m, K89d - Huma 3e-07
4eoq_A 301 Thr 160 Phosphorylated Cdk2 Wt - Human Cyclin A3 Co 3e-07
4bcq_A 301 Structure Of Cdk2 In Complex With Cyclin A And A 2- 3e-07
3d7z_A 360 Crystal Structure Of P38 Kinase In Complex With A B 3e-07
4eos_A 300 Thr 160 Phosphorylated Cdk2 Wt - Human Cyclin A3 Co 3e-07
1e9h_A 297 Thr 160 Phosphorylated Cdk2-Human Cyclin A3 Complex 3e-07
4erw_A 306 Cdk2 In Complex With Staurosporine Length = 306 3e-07
3ezr_A 300 Cdk-2 With Indazole Inhibitor 17 Bound At Its Activ 3e-07
1h1p_A 303 Structure Of Human Thr160-Phospho Cdk2CYCLIN A COMP 3e-07
1tki_A321 Autoinhibited Serine Kinase Domain Of The Giant Mus 3e-07
1qmz_A 299 Phosphorylated Cdk2-Cyclyin A-Substrate Peptide Com 3e-07
2jgz_A 289 Crystal Structure Of Phospho-Cdk2 In Complex With C 3e-07
2iw6_A 302 Structure Of Human Thr160-Phospho Cdk2-Cyclin A Com 3e-07
4eok_A 300 Thr 160 Phosphorylated Cdk2 H84s, Q85m, K89d - Huma 3e-07
4i3z_A 296 Structure Of Pcdk2CYCLINA BOUND TO ADP AND 2 MAGNES 3e-07
2w17_A 299 Cdk2 In Complex With The Imidazole Pyrimidine Amide 3e-07
1w98_A 298 The Structural Basis Of Cdk2 Activation By Cyclin E 3e-07
1fin_A 298 Cyclin A-Cyclin-Dependent Kinase 2 Complex Length = 3e-07
4eom_A 301 Thr 160 Phosphorylated Cdk2 H84s, Q85m, Q131e - Hum 3e-07
2iw8_A 302 Structure Of Human Thr160-Phospho Cdk2-Cyclin A F82 3e-07
1pf8_A 298 Crystal Structure Of Human Cyclin-dependent Kinase 3e-07
1ogu_A 302 Structure Of Human Thr160-phospho Cdk2/cyclin A Com 3e-07
1gii_A 298 Human Cyclin Dependent Kinase 2 Complexed With The 3e-07
3bht_A 300 Structure Of Phosphorylated Thr160 Cdk2CYCLIN A IN 3e-07
3pj8_A 299 Structure Of Cdk2 In Complex With A Pyrazolo[4,3-D] 3e-07
1vyw_A 309 Structure Of Cdk2CYCLIN A WITH PNU-292137 Length = 3e-07
1jst_A 298 Phosphorylated Cyclin-Dependent Kinase-2 Bound To C 3e-07
1oir_A 299 Imidazopyridines: A Potent And Selective Class Of C 3e-07
1h01_A 298 Cdk2 In Complex With A Disubstituted 2, 4-Bis Anili 3e-07
1gz8_A 299 Human Cyclin Dependent Kinase 2 Complexed With The 3e-07
4eon_A 300 Thr 160 Phosphorylated Cdk2 H84s, Q85m, Q131e - Hum 3e-07
3qhr_A 298 Structure Of A Pcdk2CYCLINA TRANSITION-State Mimic 4e-07
4eop_A 300 Thr 160 Phosphorylated Cdk2 Q131e - Human Cyclin A3 4e-07
4eoo_A 299 Thr 160 Phosphorylated Cdk2 Q131e - Human Cyclin A3 4e-07
4eoi_A 299 Thr 160 Phosphorylated Cdk2 K89d, Q131e - Human Cyc 4e-07
4g3g_A 350 Crystal Structure Of Murine Nf-kappab Inducing Kina 4e-07
4g3c_A 352 Crystal Structure Of Apo Murine Nf-kappab Inducing 4e-07
4g3f_A 336 Crystal Structure Of Murine Nf-kappab Inducing Kina 4e-07
3gc8_A370 The Structure Of P38beta C162s In Complex With A Di 4e-07
3gc8_A 370 The Structure Of P38beta C162s In Complex With A Di 3e-06
2bal_A 365 P38alpha Map Kinase Bound To Pyrazoloamine Length = 5e-07
2baq_A 365 P38alpha Bound To Ro3201195 Length = 365 5e-07
3e92_A 371 Crystal Structure Of P38 Kinase In Complex With A B 5e-07
3oht_A 389 Crystal Structure Of Salmo Salar P38alpha Length = 5e-07
1kob_A387 Twitchin Kinase Fragment (Aplysia), Autoregulated P 5e-07
1kob_A 387 Twitchin Kinase Fragment (Aplysia), Autoregulated P 1e-05
2fsl_X 367 Mitogen Activated Protein Kinase P38alpha (D176a+f3 5e-07
4e5a_X 360 The W197a Mutant Of P38a Map Kinase Length = 360 6e-07
2fst_X 367 Mitogen Activated Protein Kinase P38alpha (d176a+f3 6e-07
3gc9_A370 The Structure Of P38beta C119s, C162s In Complex Wi 6e-07
3gc9_A 370 The Structure Of P38beta C119s, C162s In Complex Wi 2e-06
3gp0_A348 Crystal Structure Of Human Mitogen Activated Protei 6e-07
3gp0_A 348 Crystal Structure Of Human Mitogen Activated Protei 3e-06
1yw2_A 360 Mutated Mus Musculus P38 Kinase (Mp38) Length = 360 6e-07
3od6_X 360 Crystal Structure Of P38alpha Y323t Active Mutant L 6e-07
3nnu_A 354 Crystal Structure Of P38 Alpha In Complex With Dp13 6e-07
2fso_X 367 Mitogen Activated Protein Kinase P38alpha (D176a) A 6e-07
3odz_X 360 Crystal Structure Of P38alpha Y323r Active Mutant L 6e-07
3ody_X 360 Crystal Structure Of P38alpha Y323q Active Mutant L 6e-07
3k3j_A 362 P38alpha Bound To Novel Dfg-Out Compound Pf-0041612 6e-07
2lgc_A 359 Joint Nmr And X-Ray Refinement Reveals The Structur 6e-07
3oef_X 360 Crystal Structure Of Y323f Inactive Mutant Of P38al 6e-07
1m7q_A 366 Crystal Structure Of P38 Map Kinase In Complex With 6e-07
3nnx_A 354 Crystal Structure Of Phosphorylated P38 Alpha In Co 6e-07
2npq_A 367 A Novel Lipid Binding Site In The P38 Alpha Map Kin 6e-07
2baj_A 365 P38alpha Bound To Pyrazolourea Length = 365 6e-07
3p4k_A 370 The Third Conformation Of P38a Map Kinase Observed 6e-07
3hrb_A 359 P38 Kinase Crystal Structure In Complex With Small 6e-07
3hvc_A 362 Crystal Structure Of Human P38alpha Map Kinase Leng 6e-07
1di9_A 360 The Structure Of P38 Mitogen-Activated Protein Kina 6e-07
1oz1_A 372 P38 Mitogen-Activated Kinase In Complex With 4-Azai 6e-07
3s3i_A 349 P38 Kinase Crystal Structure In Complex With Small 6e-07
2y8o_A 362 Crystal Structure Of Human P38alpha Complexed With 6e-07
3hec_A 348 P38 In Complex With Imatinib Length = 348 6e-07
2gfs_A 372 P38 Kinase Crystal Structure In Complex With Ro3201 6e-07
1lew_A 360 Crystal Structure Of Map Kinase P38 Complexed To Th 6e-07
2ac3_A316 Structure Of Human Mnk2 Kinase Domain Length = 316 6e-07
1zzl_A 351 Crystal Structure Of P38 With Triazolopyridine Leng 6e-07
1ywr_A 360 Crystal Structure Analysis Of Inactive P38 Kinase D 6e-07
4ewq_A 383 Human P38 Alpha Mapk In Complex With A Pyridazine B 6e-07
3tg1_A 380 Crystal Structure Of P38alpha In Complex With A Map 6e-07
3fi4_A 372 P38 Kinase Crystal Structure In Complex With Ro4499 6e-07
3gcu_A 360 Human P38 Map Kinase In Complex With Rl48 Length = 6e-07
3zsg_A 362 X-Ray Structure Of P38alpha Bound To Tak-715 Length 6e-07
3kq7_A 380 Structure Of Human P38alpha With N-[4-Methyl-3-(6-{ 6e-07
3mpt_A 371 Crystal Structure Of P38 Kinase In Complex With A P 6e-07
3dt1_A 383 P38 Complexed With A Quinazoline Inhibitor Length = 6e-07
2gtm_A 348 Mutated Mouse P38 Map Kinase Domain In Complex With 6e-07
1ove_A 366 The Structure Of P38 Alpha In Complex With A Dihydr 6e-07
3py3_A 380 Crystal Structure Of Phosphorylated P38alpha Map Ki 6e-07
2ghl_A 348 Mutant Mus Musculus P38 Kinase Domain In Complex Wi 6e-07
1bmk_A 379 The Complex Structure Of The Map Kinase P38SB218655 6e-07
3k3i_A 350 P38alpha Bound To Novel Dgf-Out Compound Pf-0021595 6e-07
1bl6_A 379 The Complex Structure Of The Map Kinase P38SB216995 6e-07
1ian_A 366 Human P38 Map Kinase Inhibitor Complex Length = 366 7e-07
2oza_B 366 Structure Of P38alpha Complex Length = 366 7e-07
1cm8_A 367 Phosphorylated Map Kinase P38-Gamma Length = 367 7e-07
2puu_A 348 Crystal Structure Of P38 Complex With 1-(5-Tert-But 7e-07
4exu_A 371 Mapk13, Inactive Form Length = 371 8e-07
1f3m_C297 Crystal Structure Of Human SerineTHREONINE KINASE P 8e-07
1f3m_C 297 Crystal Structure Of Human SerineTHREONINE KINASE P 1e-04
3uim_A 326 Structural Basis For The Impact Of Phosphorylation 8e-07
2pk9_A 317 Structure Of The Pho85-pho80 Cdk-cyclin Complex Of 8e-07
4e1z_A 291 Structure Of Mouse Tyk-2 Complexed To A 3-Aminoinda 9e-07
3coi_A 353 Crystal Structure Of P38delta Kinase Length = 353 9e-07
4e20_A 290 Structure Of Mouse Tyk-2 Complexed To A 3-Aminoinda 9e-07
3tl8_A 349 The Avrptob-Bak1 Complex Reveals Two Structurally S 9e-07
3gcp_A 360 Human P38 Map Kinase In Complex With Sb203580 Lengt 1e-06
4ec8_A 373 Structure Of Full Length Cdk9 In Complex With Cycli 1e-06
4bcf_A 331 Structure Of Cdk9 In Complex With Cyclin T And A 2- 1e-06
3mi9_A 351 Crystal Structure Of Hiv-1 Tat Complexed With Human 1e-06
3blh_A 331 Crystal Structure Of Human Cdk9CYCLINT1 Length = 33 1e-06
3mh2_A 360 Mutagenesis Of P38 Map Kinase Establishes Key Roles 1e-06
1h4l_A292 Structure And Regulation Of The Cdk5-P25(Nck5a) Com 1e-06
1h4l_A 292 Structure And Regulation Of The Cdk5-P25(Nck5a) Com 3e-05
2buj_A317 Crystal Structure Of The Human Serine-Threonine Kin 2e-06
2zm1_A 285 Crystal Structure Of Imidazo Pyrazin 1 Bound To The 2e-06
3kxz_A 287 The Complex Crystal Structure Of Lck With A Probe M 2e-06
1qpd_A 279 Structural Analysis Of The Lymphocyte-specific Kina 2e-06
2ofu_A 273 X-Ray Crystal Structure Of 2-Aminopyrimidine Carbam 2e-06
2ofv_A 277 Crystal Structure Of Aminoquinazoline 1 Bound To Lc 2e-06
3kmm_A 288 Structure Of Human Lck Kinase With A Small Molecule 2e-06
2pl0_A 289 Lck Bound To Imatinib Length = 289 2e-06
3bys_A 277 Co-Crystal Structure Of Lck And Aminopyrimidine Ami 2e-06
1qpe_A 279 Structural Analysis Of The Lymphocyte-Specific Kina 2e-06
3bym_A 272 X-Ray Co-Crystal Structure Aminobenzimidazole Triaz 2e-06
4aaa_A 331 Crystal Structure Of The Human Cdkl2 Kinase Domain 2e-06
3lck_A 271 The Kinase Domain Of Human Lymphocyte Kinase (Lck), 2e-06
1k3a_A 299 Structure Of The Insulin-Like Growth Factor 1 Recep 2e-06
2of2_A 271 Crystal Structure Of Furanopyrimidine 8 Bound To Lc 2e-06
1bi8_A 326 Mechanism Of G1 Cyclin Dependent Kinase Inhibition 2e-06
2zm3_A 308 Complex Structure Of Insulin-Like Growth Factor Rec 2e-06
1jow_B 308 Crystal Structure Of A Complex Of Human Cdk6 And A 2e-06
3uib_A 362 Map Kinase Lmampk10 From Leishmania Major In Comple 2e-06
3nup_A 307 Cdk6 (Monomeric) In Complex With Inhibitor Length = 2e-06
2og8_A 265 Crystal Structure Of Aminoquinazoline 36 Bound To L 2e-06
3pg1_A 362 Map Kinase Lmampk10 From Leishmania Major (1.95 Ang 2e-06
1luf_A 343 Crystal Structure Of The Musk Tyrosine Kinase: Insi 2e-06
3hmn_A342 Crystal Structure Of Human Mps1 Catalytic Domain In 2e-06
3hmn_A 342 Crystal Structure Of Human Mps1 Catalytic Domain In 3e-06
2ac5_A316 Structure Of Human Mnk2 Kinase Domain Mutant D228g 2e-06
3dls_A 335 Crystal Structure Of Human Pas Kinase Bound To Adp 2e-06
2x9e_A 317 Human Mps1 In Complex With Nms-P715 Length = 317 3e-06
3fxz_A297 Crystal Structure Of Pak1 Kinase Domain With Ruthen 3e-06
3fxz_A 297 Crystal Structure Of Pak1 Kinase Domain With Ruthen 1e-04
3cek_A 313 Crystal Structure Of Human Dual Specificity Protein 3e-06
3dbq_A 343 Crystal Structure Of Ttk Kinase Domain Length = 343 3e-06
3vqu_A 320 Crystal Structure Of Human Mps1 Catalytic Domain In 3e-06
3h9f_A 313 Crystal Structure Of Human Dual Specificity Protein 3e-06
2zmc_A390 Crystal Structure Of Human Mitotic Checkpoint Kinas 3e-06
2zmc_A 390 Crystal Structure Of Human Mitotic Checkpoint Kinas 3e-06
2hk5_A 270 Hck Kinase In Complex With Lck Targetted Inhibitor 3e-06
2zmd_A 390 Crystal Structure Of Human Mps1 Catalytic Domain T6 3e-06
3hng_A 360 Crystal Structure Of Vegfr1 In Complex With N-(4-ch 3e-06
3a4o_X 286 Lyn Kinase Domain Length = 286 3e-06
2zv7_A 279 Lyn Tyrosine Kinase Domain, Apo Form Length = 279 3e-06
1p4o_A 322 Structure Of Apo Unactivated Igf-1r Kinase Domain A 4e-06
1v0o_A 288 Structure Of P. Falciparum Pfpk5-Indirubin-5-Sulpho 4e-06
3q4z_A306 Structure Of Unphosphorylated Pak1 Kinase Domain Le 4e-06
3q4z_A 306 Structure Of Unphosphorylated Pak1 Kinase Domain Le 4e-04
1m7n_A 322 Crystal Structure Of Unactivated Apo Insulin-Like G 4e-06
1yhv_A297 Crystal Structure Of Pak1 Kinase Domain With Two Po 4e-06
1yhv_A 297 Crystal Structure Of Pak1 Kinase Domain With Two Po 1e-04
1v0b_A 288 Crystal Structure Of The T198a Mutant Of Pfpk5 Leng 4e-06
1ob3_A 288 Structure Of P. Falciparum Pfpk5 Length = 288 4e-06
1qcf_A 454 Crystal Structure Of Hck In Complex With A Src Fami 4e-06
3o8p_A 360 Conformational Plasticity Of P38 Map Kinase Dfg Mot 4e-06
3i81_A 315 Crystal Structure Of Insulin-Like Growth Factor 1 R 4e-06
3o23_A 305 Human Unphosphorylated Igf1-R Kinase Domain In Comp 4e-06
3lw0_A 304 Igf-1rk In Complex With Ligand Msc1609119a-1 Length 4e-06
2oj9_A 307 Structure Of Igf-1r Kinase Domain Complexed With A 4e-06
1jqh_A 308 Igf-1 Receptor Kinase Domain Length = 308 4e-06
3tei_A 362 Crystal Structure Of Human Erk2 Complexed With A Ma 5e-06
3qqu_A 301 Cocrystal Structure Of Unphosphorylated Igf With Py 5e-06
3mh0_A 360 Mutagenesis Of P38 Map Kinase Eshtablishes Key Role 5e-06
3lvp_A 336 Crystal Structure Of Bisphosphorylated Igf1-R Kinas 5e-06
3sa0_A 360 Complex Of Erk2 With Norathyriol Length = 360 5e-06
4fux_A 360 Crystal Structure Of The Erk2 Complexed With E75 Le 5e-06
4h3q_A 362 Crystal Structure Of Human Erk2 Complexed With A Ma 5e-06
4fv7_A 360 Crystal Structure Of The Erk2 Complexed With E94 Le 6e-06
3q52_A306 Structure Of Phosphorylated Pak1 Kinase Domain Leng 6e-06
3q52_A 306 Structure Of Phosphorylated Pak1 Kinase Domain Leng 1e-04
4hzs_A 341 Crystal Structure Of Ack1 Kinase Domain With C-term 6e-06
4eqm_A 294 Structural Analysis Of Staphylococcus Aureus Serine 6e-06
3qyw_A 364 Crystal Structure Of Erk2 In Complex With An Inhibi 6e-06
1u54_A 291 Crystal Structures Of The Phosphorylated And Unphos 6e-06
4gsb_A 364 Monoclinic Crystal Form Of The Apo-Erk2 Length = 36 6e-06
3g33_A 308 Crystal Structure Of Cdk4CYCLIN D3 Length = 308 6e-06
3mh1_A 360 Mutagenesis Of P38 Map Kinase Establishes Key Roles 6e-06
1yoj_A 283 Crystal Structure Of Src Kinase Domain Length = 283 6e-06
1yol_A 283 Crystal Structure Of Src Kinase Domain In Complex W 6e-06
2w99_B 306 Crystal Structure Of Cdk4 In Complex With A D-Type 6e-06
4fv6_A 360 Crystal Structure Of The Erk2 Complexed With E57 Le 6e-06
3u4w_A 275 Src In Complex With Dna-Templated Macrocyclic Inhib 6e-06
2bdf_A 279 Src Kinase In Complex With Inhibitor Ap23451 Length 6e-06
1yi6_A 276 C-Term Tail Segment Of Human Tyrosine Kinase (258-5 6e-06
1pme_A 380 Structure Of Penta Mutant Human Erk2 Map Kinase Com 6e-06
1u46_A 291 Crystal Structure Of The Unphosphorylated Kinase Do 7e-06
2w9f_B 306 Crystal Structure Of Cdk4 In Complex With A D-Type 7e-06
3d94_A 301 Crystal Structure Of The Insulin-Like Growth Factor 7e-06
1gol_A 364 Coordinates Of Rat Map Kinase Erk2 With An Arginine 7e-06
2w96_B 306 Crystal Structure Of Cdk4 In Complex With A D-Type 7e-06
2y9q_A 362 Crystal Structure Of Human Erk2 Complexed With A Ma 7e-06
3d7u_B 277 Structural Basis For The Recognition Of C-Src By It 7e-06
3mh3_A 360 Mutagenesis Of P38 Map Kinase Establishes Key Roles 7e-06
1fmk_A 452 Crystal Structure Of Human Tyrosine-Protein Kinase 7e-06
3zu7_A 365 Crystal Structure Of A Designed Selected Ankyrin Re 7e-06
2z7l_A 366 Unphosphorylated Mitogen Activated Protein Kinase E 7e-06
3c9w_A 357 Crystal Structure Of Erk-2 With Hypothemycin Covale 7e-06
2gph_A 364 Docking Motif Interactions In The Map Kinase Erk2 L 7e-06
2fys_B 364 Crystal Structure Of Erk2 Complex With Kim Peptide 7e-06
3o71_A 358 Crystal Structure Of Erk2DCC PEPTIDE COMPLEX Length 7e-06
1y57_A 452 Structure Of Unphosphorylated C-Src In Complex With 7e-06
4ewh_B 275 Co-Crystal Structure Of Ack1 With Inhibitor Length 7e-06
3r63_A 358 Structure Of Erk2 (Spe) Mutant (S246e) Length = 358 7e-06
3mpm_A 267 Lck Complexed With A Pyrazolopyrimidine Length = 26 7e-06
1ksw_A 452 Structure Of Human C-Src Tyrosine Kinase (Thr338gly 7e-06
2hwo_A 286 Crystal Structure Of Src Kinase Domain In Complex W 7e-06
2ojg_A 380 Crystal Structure Of Erk2 In Complex With N,n-dimet 7e-06
3zuv_A 364 Crystal Structure Of A Designed Selected Ankyrin Re 7e-06
3svv_A 286 Crystal Structure Of T338c C-Src Covalently Bound T 7e-06
3eqp_B 276 Crystal Structure Of Ack1 With Compound T95 Length 7e-06
2qq7_A 286 Crystal Structure Of Drug Resistant Src Kinase Doma 7e-06
2erk_A 365 Phosphorylated Map Kinase Erk2 Length = 365 7e-06
1wzy_A 368 Crystal Structure Of Human Erk2 Complexed With A Py 7e-06
1tvo_A 368 The Structure Of Erk2 In Complex With A Small Molec 7e-06
2oiq_A 286 Crystal Structure Of Chicken C-Src Kinase Domain In 7e-06
2h8h_A 535 Src Kinase In Complex With A Quinazoline Inhibitor 7e-06
4hzr_A 277 Crystal Structure Of Ack1 Kinase Domain Length = 27 7e-06
3oez_A 286 Crystal Structure Of The L317i Mutant Of The Chicke 8e-06
4id7_A 273 Ack1 Kinase In Complex With The Inhibitor Cis-3-[8- 8e-06
3gi3_A 360 Crystal Structure Of A N-Phenyl-N'-Naphthylurea Ana 8e-06
3g6h_A 286 Src Thr338ile Inhibited In The Dfg-Asp-Out Conforma 8e-06
3dqw_A 286 C-Src Kinase Domain Thr338ile Mutant In Complex Wit 8e-06
2zoq_A 382 Structural Dissection Of Human Mitogen-Activated Ki 9e-06
1rqq_A 306 Crystal Structure Of The Insulin Receptor Kinase In 9e-06
2z8c_A 303 Phosphorylated Insulin Receptor Tyrosine Kinase In 9e-06
1ir3_A 306 Phosphorylated Insulin Receptor Tyrosine Kinase In 9e-06
3p23_A432 Crystal Structure Of The Human Kinase And Rnase Dom 1e-05
2pvf_A 334 Crystal Structure Of Tyrosine Phosphorylated Activa 1e-05
3mtl_A 324 Crystal Structure Of The Pctaire1 Kinase In Complex 1e-05
4e4l_A 302 Jak1 Kinase (Jh1 Domain) In Complex With Compound 3 1e-05
3eyg_A 290 Crystal Structures Of Jak1 And Jak2 Inhibitor Compl 1e-05
3nr9_A368 Structure Of Human Cdc2-Like Kinase 2 (Clk2) Length 1e-05
2b9f_A 353 Crystal Structure Of Non-Phosphorylated Fus3 Length 1e-05
2f9g_A 353 Crystal Structure Of Fus3 Phosphorylated On Tyr182 1e-05
3dtc_A271 Crystal Structure Of Mixed-Lineage Kinase Mlk1 Comp 1e-05
1gjo_A 316 The Fgfr2 Tyrosine Kinase Domain Length = 316 1e-05
2b9h_A 353 Crystal Structure Of Fus3 With A Docking Motif From 1e-05
3cik_A 689 Human Grk2 In Complex With Gbetagamma Subunits Leng 1e-05
3cly_A 334 Crystal Structure Of Fgf Receptor 2 (Fgfr2) Kinase 1e-05
3ri1_A 313 Crystal Structure Of The Catalytic Domain Of Fgfr2 1e-05
3nie_A 429 Crystal Structure Of Pf11_0147 Length = 429 1e-05
3krw_A 688 Human Grk2 In Complex With Gbetgamma Subunits And B 1e-05
2psq_A 370 Crystal Structure Of Unphosphorylated Unactivated W 1e-05
1omw_A 689 Crystal Structure Of The Complex Between G Protein- 1e-05
3psc_A 695 Bovine Grk2 In Complex With Gbetagamma Subunits Len 1e-05
3geq_A 286 Structural Basis For The Chemical Rescue Of Src Kin 1e-05
3b2t_A 311 Structure Of Phosphotransferase Length = 311 1e-05
2pzp_A 324 Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase D 1e-05
2pz5_A 324 Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase D 1e-05
2pvy_A 324 Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase D 1e-05
1ad5_A 438 Src Family Kinase Hck-Amp-Pnp Complex Length = 438 1e-05
2q0b_A 324 Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase D 1e-05
2py3_A 324 Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase D 1e-05
2vd5_A412 Structure Of Human Myotonic Dystrophy Protein Kinas 1e-05
3rp9_A 458 Crystal Structure Of The Apo Mapk From Toxoplasma G 2e-05
2pwl_A 324 Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase D 2e-05
3hko_A345 Crystal Structure Of A Cdpk Kinase Domain From Cryp 2e-05
3hko_A 345 Crystal Structure Of A Cdpk Kinase Domain From Cryp 5e-04
2p2h_A 314 Crystal Structure Of The Vegfr2 Kinase Domain In Co 2e-05
2ogv_A 317 Crystal Structure Of The Autoinhibited Human C-Fms 2e-05
4agu_A311 Crystal Structure Of The Human Cdkl1 Kinase Domain 2e-05
4agu_A 311 Crystal Structure Of The Human Cdkl1 Kinase Domain 3e-04
2p2i_A 314 Crystal Structure Of The Vegfr2 Kinase Domain In Co 2e-05
1ywn_A 316 Vegfr2 In Complex With A Novel 4-amino-furo[2,3-d]p 2e-05
2ptk_A 453 Chicken Src Tyrosine Kinase Length = 453 2e-05
1irk_A 306 Crystal Structure Of The Tyrosine Kinase Domain Of 2e-05
2oh4_A 316 Crystal Structure Of Vegfr2 With A Benzimidazole-Ur 2e-05
3fpq_A290 Crystal Structure Of The Kinase Domain Of Wnk1 Leng 2e-05
3pls_A 298 Ron In Complex With Ligand Amp-Pnp Length = 298 2e-05
3eta_A 317 Kinase Domain Of Insulin Receptor Complexed With A 2e-05
3lcd_A 329 Inhibitor Bound To A Dfg-In Structure Of The Kinase 2e-05
3ppz_A309 Crystal Structure Of Ctr1 Kinase Domain In Complex 2e-05
3ppz_A 309 Crystal Structure Of Ctr1 Kinase Domain In Complex 7e-04
3hgk_A 327 Crystal Structure Of Effect Protein Avrptob Complex 3e-05
3c7q_A 316 Structure Of Vegfr2 Kinase Domain In Complex With B 3e-05
3u6j_A 314 Crystal Structure Of The Vegfr2 Kinase Domain In Co 3e-05
2pzr_A 324 Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase D 3e-05
1i44_A 306 Crystallographic Studies Of An Activation Loop Muta 3e-05
3ewh_A 314 Crystal Structure Of The Vegfr2 Kinase Domain In Co 3e-05
2qok_A 373 Human Epha3 Kinase And Juxtamembrane Region, Y596f: 3e-05
2i1m_A 333 Cfms Tyrosine Kinase (Tie2 Kid) In Complex With An 3e-05
1vr2_A 316 Human Vascular Endothelial Growth Factor Receptor 2 3e-05
2xir_A 316 Crystal Structure Of The Vegfr2 Kinase Domain In Co 3e-05
3o17_A370 Crystal Structure Of Jnk1-Alpha1 Isoform Length = 3 3e-05
3o17_A 370 Crystal Structure Of Jnk1-Alpha1 Isoform Length = 3 8e-05
4agc_A 353 Crystal Structure Of Vegfr2 (Juxtamembrane And Kina 3e-05
3vhe_A 359 Crystal Structure Of Human Vegfr2 Kinase Domain Wit 3e-05
3vnt_A 318 Crystal Structure Of The Kinase Domain Of Human Veg 3e-05
3vhk_A 368 Crystal Structure Of The Vegfr2 Kinase Domain In Co 3e-05
1y6a_A 366 Crystal Structure Of Vegfr2 In Complex With A 2-Ani 3e-05
3vid_A 356 Crystal Structure Of Human Vegfr2 Kinase Domain Wit 3e-05
2qkw_B 321 Structural Basis For Activation Of Plant Immunity B 3e-05
3vuk_A370 Crystal Structure Of A Cysteine-deficient Mutant M5 3e-05
3vuk_A 370 Crystal Structure Of A Cysteine-deficient Mutant M5 7e-05
3kvx_A 364 Jnk3 Bound To Aminopyrimidine Inhibitor, Sr-3562 Le 3e-05
3fi3_A 364 Crystal Structure Of Jnk3 With Indazole Inhibitor, 4e-05
2nry_A 307 Crystal Structure Of Irak-4 Length = 307 4e-05
4e7w_A394 Structure Of Gsk3 From Ustilago Maydis Length = 394 4e-05
2r9s_A 356 C-Jun N-Terminal Kinase 3 With 3,5-Disubstituted Qu 4e-05
3sdj_A448 Structure Of Rnase-Inactive Point Mutant Of Oligome 4e-05
3sdj_A 448 Structure Of Rnase-Inactive Point Mutant Of Oligome 5e-04
2nru_A 307 Crystal Structure Of Irak-4 Length = 307 4e-05
3p86_A309 Crystal Structure Of Ctr1 Kinase Domain Mutant D676 4e-05
3fbv_A448 Crystal Structure Of The Oligomer Formed By The Kin 4e-05
3fbv_A 448 Crystal Structure Of The Oligomer Formed By The Kin 5e-04
3ll6_A337 Crystal Structure Of The Human Cyclin G Associated 4e-05
3ll6_A 337 Crystal Structure Of The Human Cyclin G Associated 5e-04
3cjf_A 309 Crystal Structure Of Vegfr2 In Complex With A 3,4,5 4e-05
3pp0_A 338 Crystal Structure Of The Kinase Domain Of Human Her 4e-05
4asz_A 299 Crystal Structure Of Apo Trkb Kinase Domain Length 4e-05
3n9x_A 432 Crystal Structure Of Map Kinase From Plasmodium Ber 4e-05
3cjg_A 309 Crystal Structure Of Vegfr2 In Complex With A 3,4,5 4e-05
2oib_A 301 Crystal Structure Of Irak4 Kinase Domain Apo Form L 4e-05
3gbz_A 329 Structure Of The Cmgc Cdk Kinase From Giardia Lambl 4e-05
2o8y_A 298 Apo Irak4 Kinase Domain Length = 298 4e-05
3bea_A 333 Cfms Tyrosine Kinase (Tie2 Kid) In Complex With A P 5e-05
2i0v_A 335 C-Fms Tyrosine Kinase In Complex With A Quinolone I 5e-05
4h1j_A 293 Crystal Structure Of Pyk2 With The Pyrazole 13a Len 5e-05
3fzo_A 277 Crystal Structure Of Pyk2-Apo, Proline-Rich Tyrosin 5e-05
2qoc_A 344 Human Epha3 Kinase Domain, Phosphorylated, Amp-Pnp 5e-05
3lco_A 324 Inhibitor Bound To A Dfg-Out Structure Of The Kinas 5e-05
3v3v_A379 Structural And Functional Analysis Of Quercetagetin 5e-05
3v3v_A 379 Structural And Functional Analysis Of Quercetagetin 8e-05
2qoo_A 373 Human Epha3 Kinase And Juxtamembrane Region, Y596f: 5e-05
3cc6_A 281 Crystal Structure Of Kinase Domain Of Protein Tyros 5e-05
2qob_A 344 Human Epha3 Kinase Domain, Base Structure Length = 5e-05
1z57_A339 Crystal Structure Of Human Clk1 In Complex With 10z 6e-05
3dzq_A 361 Human Epha3 Kinase Domain In Complex With Inhibitor 6e-05
2xs0_A386 Linear Binding Motifs For Jnk And For Calcineurin A 6e-05
2xs0_A 386 Linear Binding Motifs For Jnk And For Calcineurin A 9e-05
2qon_A 373 Human Epha3 Kinase And Juxtamembrane Region, Y596f: 6e-05
2rio_A434 Structure Of The Dual Enzyme Ire1 Reveals The Basis 6e-05
2rio_A 434 Structure Of The Dual Enzyme Ire1 Reveals The Basis 5e-04
1yvj_A 290 Crystal Structure Of The Jak3 Kinase Domain In Comp 6e-05
3lj0_A434 Ire1 Complexed With Adp And Quercetin Length = 434 6e-05
3lj0_A 434 Ire1 Complexed With Adp And Quercetin Length = 434 5e-04
1ukh_A369 Structural Basis For The Selective Inhibition Of Jn 6e-05
1ukh_A 369 Structural Basis For The Selective Inhibition Of Jn 1e-04
2xrw_A371 Linear Binding Motifs For Jnk And For Calcineurin A 6e-05
2xrw_A 371 Linear Binding Motifs For Jnk And For Calcineurin A 1e-04
3lxk_A 327 Structural And Thermodynamic Characterization Of Th 6e-05
2qo7_A 373 Human Epha3 Kinase And Juxtamembrane Region, Dephos 6e-05
3fxx_A 371 Human Epha3 Kinase And Juxtamembrane Region Bound T 7e-05
2qof_A 373 Human Epha3 Kinase And Juxtamembrane Region, Y596f 7e-05
2qod_A 373 Human Epha3 Kinase And Juxtamembrane Region, Y602f 7e-05
2gsf_A 373 The Human Epha3 Receptor Tyrosine Kinase And Juxtam 7e-05
3vul_A 370 Crystal Structure Of A Cysteine-deficient Mutant M1 7e-05
3vum_A 370 Crystal Structure Of A Cysteine-deficient Mutant M7 7e-05
4hvd_A 314 Jak3 Kinase Domain In Complex With 2-cyclopropyl-5h 7e-05
3pjc_A 315 Crystal Structure Of Jak3 Complexed With A Potent A 7e-05
2qoi_A 373 Human Epha3 Kinase And Juxtamembrane Region, Y596f: 7e-05
2dq7_X 283 Crystal Structure Of Fyn Kinase Domain Complexed Wi 7e-05
1p14_A 306 Crystal Structure Of A Catalytic-Loop Mutant Of The 7e-05
3ttj_A 464 Crystal Structure Of Jnk3 Complexed With Cc-359, A 7e-05
3npc_A 364 Crystal Structure Of Jnk2 Complexed With Birb796 Le 7e-05
3ekk_A 307 Insulin Receptor Kinase Complexed With An Inhibitor 7e-05
3f61_A311 Crystal Structure Of M. Tuberculosis Pknb Leu33aspV 7e-05
3kga_A 299 Crystal Structure Of Mapkap Kinase 2 (Mk2) Complexe 8e-05
2qol_A 373 Human Epha3 Kinase And Juxtamembrane Region, Y596:y 8e-05
3ori_A311 Mycobacterium Tuberculosis Pknb Kinase Domain L33d 8e-05
3f69_A311 Crystal Structure Of The Mycobacterium Tuberculosis 8e-05
3c4f_A 302 Fgfr Tyrosine Kinase Domain In Complex With 3-(3- M 8e-05
2rei_A 318 Kinase Domain Of Human Ephrin Type-a Receptor 7 (ep 8e-05
1mru_A311 Intracellular SerTHR PROTEIN KINASE DOMAIN OF Mycob 8e-05
1o6y_A299 Catalytic Domain Of Pknb Kinase From Mycobacterium 8e-05
3orm_A311 Mycobacterium Tuberculosis Pknb Kinase Domain D76a 8e-05
2g01_A 370 Pyrazoloquinolones As Novel, Selective Jnk1 Inhibit 8e-05
1fgk_A 310 Crystal Structure Of The Tyrosine Kinase Domain Of 8e-05
1pmn_A 364 Crystal Structure Of Jnk3 In Complex With An Imidaz 9e-05
4f63_A 309 Crystal Structure Of Human Fibroblast Growth Factor 9e-05
3rhx_B 306 Crystal Structure Of The Catalytic Domain Of Fgfr1 9e-05
3elj_A 369 Jnk1 Complexed With A Bis-Anilino-Pyrrolopyrimidine 9e-05
2b1p_A 355 Inhibitor Complex Of Jnk3 Length = 355 9e-05
4h36_A 356 Crystal Structure Of Jnk3 In Complex With Atf2 Pept 9e-05
3ptg_A 363 Design And Synthesis Of A Novel, Orally Efficacious 9e-05
3kxx_A 317 Structure Of The Mutant Fibroblast Growth Factor Re 9e-05
3js2_A 317 Crystal Structure Of Minimal Kinase Domain Of Fibro 9e-05
3gql_A 326 Crystal Structure Of Activated Receptor Tyrosine Ki 9e-05
3e7o_A 360 Crystal Structure Of Jnk2 Length = 360 9e-05
1jnk_A 423 The C-Jun N-Terminal Kinase (Jnk3s) Complexed With 9e-05
2o0u_A 364 Crystal Structure Of Human Jnk3 Complexed With N-{3 9e-05
3gqi_A 326 Crystal Structure Of Activated Receptor Tyrosine Ki 9e-05
2exc_X 356 Inhibitor Complex Of Jnk3 Length = 356 9e-05
3oxi_A 362 Design And Synthesis Of Disubstituted Thiophene And 9e-05
3pze_A 358 Jnk1 In Complex With Inhibitor Length = 358 9e-05
3fi2_A 353 Crystal Structure Of Jnk3 With Amino-Pyrazole Inhib 9e-05
2ok1_A 365 Crystal Structure Of Jnk3 Bound To N-Benzyl-4-(4-(3 9e-05
3vud_A370 Crystal Structure Of A Cysteine-deficient Mutant M1 9e-05
3vud_A 370 Crystal Structure Of A Cysteine-deficient Mutant M1 1e-04
3tt0_A 382 Co-Structure Of Fibroblast Growth Factor Receptor 1 9e-05
3fv8_A 355 Jnk3 Bound To Piperazine Amide Inhibitor, Sr2774 Le 9e-05
3vuh_A 370 Crystal Structure Of A Cysteine-deficient Mutant M3 1e-04
2iwi_A312 Crystal Structure Of The Human Pim2 In Complex With 1e-04
4ebw_A 304 Structure Of Focal Adhesion Kinase Catalytic Domain 1e-04
3vui_A 370 Crystal Structure Of A Cysteine-deficient Mutant M2 1e-04
3bz3_A 276 Crystal Structure Analysis Of Focal Adhesion Kinase 1e-04
2r2p_A 295 Kinase Domain Of Human Ephrin Type-A Receptor 5 (Ep 1e-04
3vug_A 370 Crystal Structure Of A Cysteine-deficient Mutant M2 1e-04
3pxk_A 282 Focal Adhesion Kinase Catalytic Domain In Complex W 1e-04
2jkm_A 276 Focal Adhesion Kinase Catalytic Domain In Complex W 1e-04
2etm_A 281 Crystal Structure Of Focal Adhesion Kinase Domain C 1e-04
2j0m_B 276 Crystal Structure A Two-Chain Complex Between The F 1e-04
1mp8_A 281 Crystal Structure Of Focal Adhesion Kinase (Fak) Le 1e-04
4gg5_A 319 Crystal Structure Of Cmet In Complex With Novel Inh 1e-04
3q6w_A 307 Structure Of Dually-phosphorylated Met Receptor Kin 1e-04
2wd1_A 292 Human C-Met Kinase In Complex With Azaindole Inhibi 1e-04
2j0l_A 276 Crystal Structure Of A The Active Conformation Of T 1e-04
3q6u_A 308 Structure Of The Apo Met Receptor Kinase In The Dua 1e-04
2wgj_A 306 X-Ray Structure Of Pf-02341066 Bound To The Kinase 1e-04
3i5n_A 309 Crystal Structure Of C-Met With Triazolopyridazine 1e-04
2rfn_A 310 X-ray Structure Of C-met With Inhibitor. Length = 3 1e-04
3f66_A 298 Human C-Met Kinase In Complex With Quinoxaline Inhi 1e-04
2g15_A 318 Structural Characterization Of Autoinhibited C-Met 1e-04
3miy_A 266 X-Ray Crystal Structure Of Itk Complexed With Sunit 1e-04
3lq8_A 302 Structure Of The Kinase Domain Of C-Met Bound To Xl 1e-04
1q5k_A 414 Crystal Structure Of Glycogen Synthase Kinase 3 In 1e-04
2rfd_A 324 Crystal Structure Of The Complex Between The Egfr K 1e-04
1pyx_A 422 Gsk-3 Beta Complexed With Amp-Pnp Length = 422 1e-04
1jpa_A 312 Crystal Structure Of Unphosphorylated Ephb2 Recepto 1e-04
1i09_A 420 Structure Of Glycogen Synthase Kinase-3 (Gsk3b) Len 1e-04
3say_A 430 Crystal Structure Of Human Glycogen Synthase Kinase 1e-04
1q3d_A 424 Gsk-3 Beta Complexed With Staurosporine Length = 42 1e-04
4e6d_A 298 Jak2 Kinase (Jh1 Domain) Triple Mutant In Complex W 1e-04
2j0j_A 656 Crystal Structure Of A Fragment Of Focal Adhesion K 1e-04
2hel_A 306 Crystal Structure Of A Mutant Epha4 Kinase Domain ( 1e-04
4acc_A 465 Gsk3b In Complex With Inhibitor Length = 465 1e-04
2w1i_A 326 Structure Determination Of Aurora Kinase In Complex 1e-04
3e62_A 293 Fragment Based Discovery Of Jak-2 Inhibitors Length 1e-04
3tjc_A 298 Co-Crystal Structure Of Jak2 With Thienopyridine 8 2e-04
2xa4_A 298 Inhibitors Of Jak2 Kinase Domain Length = 298 2e-04
2b7a_A 293 The Structural Basis Of Janus Kinase 2 Inhibition B 2e-04
3rvg_A 303 Crystals Structure Of Jak2 With A 1-Amino-5h-Pyrido 2e-04
3q32_A 301 Structure Of Janus Kinase 2 With A Pyrrolotriazine 2e-04
3lpb_A 295 Crystal Structure Of Jak2 Complexed With A Potent 2 2e-04
1r0e_A 391 Glycogen Synthase Kinase-3 Beta In Complex With 3-I 2e-04
4hge_A 300 Jak2 Kinase (Jh1 Domain) In Complex With Compound 8 2e-04
4e4m_A 302 Jak2 Kinase (Jh1 Domain) In Complex With Compound 3 2e-04
4aqc_A 301 Triazolopyridine-Based Inhibitor Of Janus Kinase 2 2e-04
2oo8_X 317 Synthesis, Structural Analysis, And Sar Studies Of 2e-04
4dit_A 382 Crystal Structure Of Gsk3beta In Complex With A Imi 2e-04
2o5k_A 372 Crystal Structure Of Gsk3beta In Complex With A Ben 2e-04
1fvr_A 327 Tie2 Kinase Domain Length = 327 2e-04
1o9u_A 350 Glycogen Synthase Kinase 3 Beta Complexed With Axin 2e-04
1gng_A 378 Glycogen Synthase Kinase-3 Beta (Gsk3) Complex With 2e-04
3f7z_A 350 X-ray Co-crystal Structure Of Glycogen Synthase Kin 2e-04
3f88_A 349 Glycogen Synthase Kinase 3beta Inhibitor Complex Le 2e-04
1h8f_A 352 Glycogen Synthase Kinase 3 Beta. Length = 352 2e-04
4afj_A 367 5-Aryl-4-Carboxamide-1,3-Oxazoles: Potent And Selec 2e-04
3sd0_A 350 Identification Of A Glycogen Synthase Kinase-3b Inh 2e-04
4gt4_A 308 Structure Of Unliganded, Inactive Ror2 Kinase Domai 2e-04
2ow3_A 352 Glycogen Synthase Kinase-3 Beta In Complex With Bis 2e-04
3zdi_A 350 Glycogen Synthase Kinase 3 Beta Complexed With Axin 2e-04
2y6m_A 291 Crystal Structure Of Epha4 Kinase Domain Length = 2 2e-04
3zrk_A 371 Identification Of 2-(4-Pyridyl)thienopyridinones As 2e-04
1uv5_A 350 Glycogen Synthase Kinase 3 Beta Complexed With 6-Br 2e-04
3gb2_A 353 Gsk3beta Inhibitor Complex Length = 353 2e-04
3jy9_A 311 Janus Kinase 2 Inhibitors Length = 311 2e-04
3ugc_A 295 Structural Basis Of Jak2 Inhibition By The Type Ii 2e-04
3io7_A 313 2-Aminopyrazolo[1,5-A]pyrimidines As Potent And Sel 2e-04
2xyu_A 285 Crystal Structure Of Epha4 Kinase Domain In Complex 2e-04
3zzw_A 289 Crystal Structure Of The Kinase Domain Of Ror2 Leng 2e-04
3s95_A 310 Crystal Structure Of The Human Limk1 Kinase Domain 2e-04
3t9t_A 267 Crystal Structure Of Btk Mutant (F435t,K596r) Compl 2e-04
3c1x_A 373 Crystal Structure Of The Tyrosine Kinase Domain Of 2e-04
1sm2_A 264 Crystal Structure Of The Phosphorylated Interleukin 2e-04
4hct_A 269 Crystal Structure Of Itk In Complex With Compound 5 2e-04
3v5j_A 266 Crystal Structure Of Interleukin-2 Inducible T-Cell 2e-04
2ivt_A 314 Crystal Structure Of Phosphorylated Ret Tyrosine Ki 2e-04
3dkc_A 317 Sgx Clone 5698a65kfg1h1 Length = 317 3e-04
3cth_A 314 Crystal Structure Of The Tyrosine Kinase Domain Of 3e-04
1r0p_A 312 Crystal Structure Of The Tyrosine Kinase Domain Of 3e-04
3a4p_A 319 Human C-Met Kinase Domain Complexed With 6-Benzylox 3e-04
3gvu_A 292 The Crystal Structure Of Human Abl2 In Complex With 3e-04
3qti_A 314 C-Met Kinase In Complex With Nvp-Bvu972 Length = 31 3e-04
3dkg_A 317 Sgx Clone 5698a109kfg1h1 Length = 317 3e-04
1mqb_A 333 Crystal Structure Of Ephrin A2 (Epha2) Receptor Pro 3e-04
3qgw_A 286 Crystal Structure Of Itk Kinase Bound To An Inhibit 3e-04
2r4b_A 321 Erbb4 Kinase Domain Complexed With A Thienopyrimidi 3e-04
1s9i_A354 X-Ray Structure Of The Human Mitogen-Activated Prot 3e-04
3oz6_A 388 Crystal Structure Of Mapk From Cryptosporidium Parv 3e-04
3gop_A 361 Crystal Structure Of The Egf Receptor Juxtamembrane 3e-04
2vag_A339 Crystal Structure Of Di-Phosphorylated Human Clk1 I 3e-04
2y4i_B 319 Ksr2-Mek1 Heterodimer Length = 319 3e-04
3g0f_A 336 Kit Kinase Domain Mutant D816h In Complex With Suni 3e-04
2ivs_A 314 Crystal Structure Of Non-Phosphorylated Ret Tyrosin 3e-04
4hjo_A 337 Crystal Structure Of The Inactive Egfr Tyrosine Kin 4e-04
3p1a_A311 Structure Of Human Membrane-Associated Tyrosine- An 4e-04
3v5q_A 297 Discovery Of A Selective Trk Inhibitor With Efficac 4e-04
2itn_A 327 Crystal Structure Of Egfr Kinase Domain G719s Mutat 4e-04
2j5f_A 327 Crystal Structure Of Egfr Kinase Domain In Complex 4e-04
2eb2_A 334 Crystal Structure Of Mutated Egfr Kinase Domain (G7 4e-04
2jiu_A 328 Crystal Structure Of Egfr Kinase Domain T790m Mutat 4e-04
3ika_A 331 Crystal Structure Of Egfr 696-1022 T790m Mutant Cov 4e-04
2j5e_A 327 Crystal Structure Of Egfr Kinase Domain In Complex 4e-04
4i23_A 329 Crystal Structure Of The Wild-type Egfr Kinase Doma 4e-04
3ug1_A 334 Crystal Structure Of The Mutated Egfr Kinase Domain 4e-04
2gs7_A 330 Crystal Structure Of The Inactive Egfr Kinase Domai 4e-04
3bbt_B 328 Crystal Structure Of The Erbb4 Kinase In Complex Wi 4e-04
3lzb_A 327 Egfr Kinase Domain Complexed With An Imidazo[2,1-B] 4e-04
2jiv_A 328 Crystal Structure Of Egfr Kinase Domain T790m Mutat 4e-04
2jit_A 327 Crystal Structure Of Egfr Kinase Domain T790m Mutat 4e-04
4g5j_A 330 Crystal Structure Of Egfr Kinase In Complex With Bi 4e-04
4g5p_A 330 Crystal Structure Of Egfr Kinase T790m In Complex W 4e-04
4i24_A 329 Structure Of T790m Egfr Kinase Domain Co-crystalliz 4e-04
3vjo_A 334 Crystal Structure Of The Wild-Type Egfr Kinase Doma 4e-04
2gs2_A 330 Crystal Structure Of The Active Egfr Kinase Domain 4e-04
1xkk_A 352 Egfr Kinase Domain Complexed With A Quinazoline Inh 4e-04
4dgl_C 335 Crystal Structure Of The Ck2 Tetrameric Holoenzyme 4e-04
1m14_A 333 Tyrosine Kinase Domain From Epidermal Growth Factor 4e-04
3bel_A 315 X-Ray Structure Of Egfr In Complex With Oxime Inhib 4e-04
3kul_A 325 Kinase Domain Of Human Ephrin Type-A Receptor 8 (Ep 5e-04
3kul_B 325 Kinase Domain Of Human Ephrin Type-A Receptor 8 (Ep 5e-04
3sls_A304 Crystal Structure Of Human Mek-1 Kinase In Complex 5e-04
1pkg_A 329 Structure Of A C-kit Kinase Product Complex Length 5e-04
3g0e_A 336 Kit Kinase Domain In Complex With Sunitinib Length 5e-04
4aw5_A 291 Complex Of The Ephb4 Kinase Domain With An Oxindole 5e-04
1t46_A 313 Structural Basis For The Autoinhibition And Sti-571 5e-04
1t45_A 331 Structural Basis For The Autoinhibition And Sti-571 5e-04
2wqb_A 324 Structure Of The Tie2 Kinase Domain In Complex With 5e-04
4bbe_A 298 Aminoalkylpyrimidine Inhibitor Complexes With Jak2 6e-04
2vwu_A 302 Ephb4 Kinase Domain Inhibitor Complex Length = 302 6e-04
4an2_A301 Crystal Structures Of Human Mek1 With Carboxamide-B 6e-04
2h34_A309 Apoenzyme Crystal Structure Of The Tuberculosis Ser 7e-04
2jkk_A 276 Focal Adhesion Kinase Catalytic Domain In Complex W 7e-04
3p08_A 267 Crystal Structure Of The Human Btk Kinase Domain Le 8e-04
3k54_A 283 Structures Of Human Bruton's Tyrosine Kinase In Act 8e-04
1k2p_A 263 Crystal Structure Of Bruton's Tyrosine Kinase Domai 8e-04
3gen_A 283 The 1.6 A Crystal Structure Of Human Bruton's Tyros 8e-04
3ocs_A 271 Crystal Structure Of Bruton's Tyrosine Kinase In Co 8e-04
2exe_A357 Crystal Structure Of The Phosphorylated Clk3 Length 8e-04
3oct_A 265 Crystal Structure Of Bruton's Tyrosine Kinase Mutan 8e-04
2eu9_A355 Crystal Structure Of Clk3 Length = 355 9e-04
2wu6_A381 Crystal Structure Of The Human Clk3 In Complex With 9e-04
2ivv_A 314 Crystal Structure Of Phosphorylated Ret Tyrosine Ki 9e-04
2hen_A 286 Crystal Structure Of The Ephb2 Receptor Kinase Doma 9e-04
3pix_A 274 Crystal Structure Of Btk Kinase Domain Complexed Wi 9e-04
>pdb|2V5Q|A Chain A, Crystal Structure Of Wild-type Plk-1 Kinase Domain In Complex With A Selective Darpin Length = 315 Back     alignment and structure

Iteration: 1

Score = 226 bits (577), Expect = 1e-59, Method: Compositional matrix adjust. Identities = 124/251 (49%), Positives = 160/251 (63%), Gaps = 18/251 (7%) Query: 1 MSQEIAIHRSLKHRNVVGFHSFFEDSKFVYIILELCRKRSMMELYNSACDLEEMSDPAAQ 60 MS EI+IHRSL H++VVGFH FFED+ FV+++LELCR+RS++EL+ + +++P A+ Sbjct: 68 MSMEISIHRSLAHQHVVGFHGFFEDNDFVFVVLELCRRRSLLELHKRR---KALTEPEAR 124 Query: 61 ----PVIWVSKW-----VDYSDKYGFGYQLNDDSSGVMFNDLTRMIMLA----NKNTLCG 107 ++ ++ V + D LN+D V D + K TLCG Sbjct: 125 YYLRQIVLGCQYLHRNRVIHRDLKLGNLFLNEDLE-VKIGDFGLATKVEYDGERKKTLCG 183 Query: 108 TPNYIAPEILNKNGHSFEVDVWSIGCIMYTLLVGKPPFETSTLKETYSRIKKVEYKLPAT 167 TPNYIAPE+L+K GHSFEVDVWSIGCIMYTLLVGKPPFETS LKETY RIKK EY +P Sbjct: 184 TPNYIAPEVLSKKGHSFEVDVWSIGCIMYTLLVGKPPFETSCLKETYLRIKKNEYSIPKH 243 Query: 168 LKKPAATMIKKMLLLDPVQRPPVAQLLHFEFF-NDYCPTSLPASCLMTAPRFDSVVPSFN 226 + AA++I+KML DP RP + +LL+ EFF + Y P LP +CL PRF S + Sbjct: 244 INPVAASLIQKMLQTDPTARPTINELLNDEFFTSGYIPARLPITCLTIPPRFSIAPSSLD 303 Query: 227 SPRRKPLMERN 237 RKPL N Sbjct: 304 PSNRKPLTVLN 314
>pdb|2V5Q|A Chain A, Crystal Structure Of Wild-type Plk-1 Kinase Domain In Complex With A Selective Darpin Length = 315 Back     alignment and structure
>pdb|2YAC|A Chain A, Crystal Structure Of Polo-Like Kinase 1 In Complex With Nms-P937 Length = 311 Back     alignment and structure
>pdb|2YAC|A Chain A, Crystal Structure Of Polo-Like Kinase 1 In Complex With Nms-P937 Length = 311 Back     alignment and structure
>pdb|3THB|A Chain A, Structure Of Plk1 Kinase Domain In Complex With A Benzolactam-Derived Inhibitor Length = 333 Back     alignment and structure
>pdb|3THB|A Chain A, Structure Of Plk1 Kinase Domain In Complex With A Benzolactam-Derived Inhibitor Length = 333 Back     alignment and structure
>pdb|2OU7|A Chain A, Structure Of The Catalytic Domain Of Human Polo-Like Kinase 1 Length = 335 Back     alignment and structure
>pdb|2OU7|A Chain A, Structure Of The Catalytic Domain Of Human Polo-Like Kinase 1 Length = 335 Back     alignment and structure
>pdb|3KB7|A Chain A, Crystal Structure Of Polo-Like Kinase 1 In Complex With A Pyrazoloquinazoline Inhibitor Length = 311 Back     alignment and structure
>pdb|3KB7|A Chain A, Crystal Structure Of Polo-Like Kinase 1 In Complex With A Pyrazoloquinazoline Inhibitor Length = 311 Back     alignment and structure
>pdb|2RKU|A Chain A, Structure Of Plk1 In Complex With Bi2536 Length = 294 Back     alignment and structure
>pdb|2RKU|A Chain A, Structure Of Plk1 In Complex With Bi2536 Length = 294 Back     alignment and structure
>pdb|3D5U|A Chain A, Crystal Structure Of A Wildtype Polo-Like Kinase 1 (Plk1) Catalytic Domain Length = 317 Back     alignment and structure
>pdb|3D5U|A Chain A, Crystal Structure Of A Wildtype Polo-Like Kinase 1 (Plk1) Catalytic Domain Length = 317 Back     alignment and structure
>pdb|3D5W|A Chain A, Crystal Structure Of A Phosphorylated Polo-Like Kinase 1 (Plk1) Catalytic Domain In Complex With Adp Length = 317 Back     alignment and structure
>pdb|3D5W|A Chain A, Crystal Structure Of A Phosphorylated Polo-Like Kinase 1 (Plk1) Catalytic Domain In Complex With Adp Length = 317 Back     alignment and structure
>pdb|3DB6|A Chain A, Crystal Structure Of An Activated (Thr->asp) Polo-Like Kinase 1 (Plk1) Catalytic Domain In Complex With Compound 902 Length = 301 Back     alignment and structure
>pdb|3DB6|A Chain A, Crystal Structure Of An Activated (Thr->asp) Polo-Like Kinase 1 (Plk1) Catalytic Domain In Complex With Compound 902 Length = 301 Back     alignment and structure
>pdb|3D5V|A Chain A, Crystal Structure Of An Activated (Thr->asp) Polo-Like Kinase 1 (Plk1) Catalytic Domain. Length = 317 Back     alignment and structure
>pdb|3D5V|A Chain A, Crystal Structure Of An Activated (Thr->asp) Polo-Like Kinase 1 (Plk1) Catalytic Domain. Length = 317 Back     alignment and structure
>pdb|3COK|A Chain A, Crystal Structure Of Plk4 Kinase Length = 278 Back     alignment and structure
>pdb|3COK|A Chain A, Crystal Structure Of Plk4 Kinase Length = 278 Back     alignment and structure
>pdb|4AF3|A Chain A, Human Aurora B Kinase In Complex With Incenp And Vx-680 Length = 292 Back     alignment and structure
>pdb|3UNZ|A Chain A, Aurora A In Complex With Rpm1679 Length = 279 Back     alignment and structure
>pdb|3UNZ|A Chain A, Aurora A In Complex With Rpm1679 Length = 279 Back     alignment and structure
>pdb|2DWB|A Chain A, Aurora-A Kinase Complexed With Amppnp Length = 285 Back     alignment and structure
>pdb|2DWB|A Chain A, Aurora-A Kinase Complexed With Amppnp Length = 285 Back     alignment and structure
>pdb|1OL6|A Chain A, Structure Of Unphosphorylated D274n Mutant Of Aurora-a Length = 282 Back     alignment and structure
>pdb|1OL6|A Chain A, Structure Of Unphosphorylated D274n Mutant Of Aurora-a Length = 282 Back     alignment and structure
>pdb|1MUO|A Chain A, Crystal Structure Of Aurora-2, An Oncogenic Serine- Threonine Kinase Length = 297 Back     alignment and structure
>pdb|1MUO|A Chain A, Crystal Structure Of Aurora-2, An Oncogenic Serine- Threonine Kinase Length = 297 Back     alignment and structure
>pdb|2XNG|A Chain A, Structure Of Aurora-A Bound To A Selective Imidazopyrazine Inhibitor Length = 283 Back     alignment and structure
>pdb|2XNG|A Chain A, Structure Of Aurora-A Bound To A Selective Imidazopyrazine Inhibitor Length = 283 Back     alignment and structure
>pdb|2J50|A Chain A, Structure Of Aurora-2 In Complex With Pha-739358 Length = 280 Back     alignment and structure
>pdb|2J50|A Chain A, Structure Of Aurora-2 In Complex With Pha-739358 Length = 280 Back     alignment and structure
>pdb|2X6D|A Chain A, Aurora-A Bound To An Inhibitor Length = 285 Back     alignment and structure
>pdb|2X6D|A Chain A, Aurora-A Bound To An Inhibitor Length = 285 Back     alignment and structure
>pdb|2WTW|A Chain A, Aurora-A Inhibitor Structure (2nd Crystal Form) Length = 285 Back     alignment and structure
>pdb|2WTW|A Chain A, Aurora-A Inhibitor Structure (2nd Crystal Form) Length = 285 Back     alignment and structure
>pdb|2J4Z|A Chain A, Structure Of Aurora-2 In Complex With Pha-680626 Length = 306 Back     alignment and structure
>pdb|2J4Z|A Chain A, Structure Of Aurora-2 In Complex With Pha-680626 Length = 306 Back     alignment and structure
>pdb|2BMC|A Chain A, Aurora-2 T287d T288d Complexed With Pha-680632 Length = 306 Back     alignment and structure
>pdb|2BMC|A Chain A, Aurora-2 T287d T288d Complexed With Pha-680632 Length = 306 Back     alignment and structure
>pdb|2XNE|A Chain A, Structure Of Aurora-A Bound To An Imidazopyrazine Inhibitor Length = 272 Back     alignment and structure
>pdb|2XNE|A Chain A, Structure Of Aurora-A Bound To An Imidazopyrazine Inhibitor Length = 272 Back     alignment and structure
>pdb|3O50|A Chain A, Crystal Structure Of Benzamide 9 Bound To Auroraa Length = 267 Back     alignment and structure
>pdb|3O50|A Chain A, Crystal Structure Of Benzamide 9 Bound To Auroraa Length = 267 Back     alignment and structure
>pdb|2WQE|A Chain A, Structure Of S155r Aurora-A Somatic Mutant Length = 262 Back     alignment and structure
>pdb|2WQE|A Chain A, Structure Of S155r Aurora-A Somatic Mutant Length = 262 Back     alignment and structure
>pdb|2W1D|A Chain A, Structure Determination Of Aurora Kinase In Complex With Inhibitor Length = 275 Back     alignment and structure
>pdb|2W1D|A Chain A, Structure Determination Of Aurora Kinase In Complex With Inhibitor Length = 275 Back     alignment and structure
>pdb|1MQ4|A Chain A, Crystal Structure Of Aurora-A Protein Kinase Length = 272 Back     alignment and structure
>pdb|1MQ4|A Chain A, Crystal Structure Of Aurora-A Protein Kinase Length = 272 Back     alignment and structure
>pdb|2XRU|A Chain A, Aurora-A T288e Complexed With Pha-828300 Length = 280 Back     alignment and structure
>pdb|2XRU|A Chain A, Aurora-A T288e Complexed With Pha-828300 Length = 280 Back     alignment and structure
>pdb|3FDN|A Chain A, Structure-Based Drug Design Of Novel Aurora Kinase A Inhibitors: Structure Basis For Potency And Specificity Length = 279 Back     alignment and structure
>pdb|3FDN|A Chain A, Structure-Based Drug Design Of Novel Aurora Kinase A Inhibitors: Structure Basis For Potency And Specificity Length = 279 Back     alignment and structure
>pdb|2C6D|A Chain A, Aurora A Kinase Activated Mutant (T287d) In Complex With Adpnp Length = 275 Back     alignment and structure
>pdb|2C6D|A Chain A, Aurora A Kinase Activated Mutant (T287d) In Complex With Adpnp Length = 275 Back     alignment and structure
>pdb|2C6E|A Chain A, Aurora A Kinase Activated Mutant (T287d) In Complex With A 5-Aminopyrimidinyl Quinazoline Inhibitor Length = 283 Back     alignment and structure
>pdb|2C6E|A Chain A, Aurora A Kinase Activated Mutant (T287d) In Complex With A 5-Aminopyrimidinyl Quinazoline Inhibitor Length = 283 Back     alignment and structure
>pdb|1OL5|A Chain A, Structure Of Aurora-A 122-403, Phosphorylated On Thr287, Thr288 And Bound To Tpx2 1-43 Length = 282 Back     alignment and structure
>pdb|1OL5|A Chain A, Structure Of Aurora-A 122-403, Phosphorylated On Thr287, Thr288 And Bound To Tpx2 1-43 Length = 282 Back     alignment and structure
>pdb|3NRM|A Chain A, Imidazo[1,2-A]pyrazine-Based Aurora Kinase Inhibitors Length = 283 Back     alignment and structure
>pdb|3NRM|A Chain A, Imidazo[1,2-A]pyrazine-Based Aurora Kinase Inhibitors Length = 283 Back     alignment and structure
>pdb|3LAU|A Chain A, Crystal Structure Of Aurora2 Kinase In Complex With A Gsk3beta Inhibitor Length = 287 Back     alignment and structure
>pdb|3LAU|A Chain A, Crystal Structure Of Aurora2 Kinase In Complex With A Gsk3beta Inhibitor Length = 287 Back     alignment and structure
>pdb|3R21|A Chain A, Design, Synthesis, And Biological Evaluation Of Pyrazolopyridine- Sulfonamides As Potent Multiple-Mitotic Kinase (Mmk) Inhibitors (Part I) Length = 271 Back     alignment and structure
>pdb|3R21|A Chain A, Design, Synthesis, And Biological Evaluation Of Pyrazolopyridine- Sulfonamides As Potent Multiple-Mitotic Kinase (Mmk) Inhibitors (Part I) Length = 271 Back     alignment and structure
>pdb|3E5A|A Chain A, Crystal Structure Of Aurora A In Complex With Vx-680 And Tpx2 Length = 268 Back     alignment and structure
>pdb|3E5A|A Chain A, Crystal Structure Of Aurora A In Complex With Vx-680 And Tpx2 Length = 268 Back     alignment and structure
>pdb|3H0Y|A Chain A, Aurora A In Complex With A Bisanilinopyrimidine Length = 268 Back     alignment and structure
>pdb|3H0Y|A Chain A, Aurora A In Complex With A Bisanilinopyrimidine Length = 268 Back     alignment and structure
>pdb|3HA6|A Chain A, Crystal Structure Of Aurora A In Complex With Tpx2 And Compound 10 Length = 268 Back     alignment and structure
>pdb|3HA6|A Chain A, Crystal Structure Of Aurora A In Complex With Tpx2 And Compound 10 Length = 268 Back     alignment and structure
>pdb|2W1C|A Chain A, Structure Determination Of Aurora Kinase In Complex With Inhibitor Length = 275 Back     alignment and structure
>pdb|2W1C|A Chain A, Structure Determination Of Aurora Kinase In Complex With Inhibitor Length = 275 Back     alignment and structure
>pdb|3COH|A Chain A, Crystal Structure Of Aurora-A In Complex With A Pentacyclic Inhibitor Length = 268 Back     alignment and structure
>pdb|3COH|A Chain A, Crystal Structure Of Aurora-A In Complex With A Pentacyclic Inhibitor Length = 268 Back     alignment and structure
>pdb|2WTV|A Chain A, Aurora-A Inhibitor Structure Length = 285 Back     alignment and structure
>pdb|2WTV|A Chain A, Aurora-A Inhibitor Structure Length = 285 Back     alignment and structure
>pdb|3QBN|A Chain A, Structure Of Human Aurora A In Complex With A Diaminopyrimidine Length = 281 Back     alignment and structure
>pdb|3QBN|A Chain A, Structure Of Human Aurora A In Complex With A Diaminopyrimidine Length = 281 Back     alignment and structure
>pdb|3DAJ|A Chain A, Crystal Structure Of Aurora A Complexed With An Inhibitor Discovered Through Site-Directed Dynamic Tethering Length = 272 Back     alignment and structure
>pdb|3DAJ|A Chain A, Crystal Structure Of Aurora A Complexed With An Inhibitor Discovered Through Site-Directed Dynamic Tethering Length = 272 Back     alignment and structure
>pdb|3D14|A Chain A, Crystal Structure Of Mouse Aurora A (Asn186->gly, Lys240->arg, Met302- >leu) In Complex With 1-{5-[2-(Thieno[3,2-D]pyrimidin-4-Ylamino)- Ethyl]- Thiazol-2-Yl}-3-(3-Trifluoromethyl-Phenyl)-Urea Length = 272 Back     alignment and structure
>pdb|3D14|A Chain A, Crystal Structure Of Mouse Aurora A (Asn186->gly, Lys240->arg, Met302- >leu) In Complex With 1-{5-[2-(Thieno[3,2-D]pyrimidin-4-Ylamino)- Ethyl]- Thiazol-2-Yl}-3-(3-Trifluoromethyl-Phenyl)-Urea Length = 272 Back     alignment and structure
>pdb|2JC6|A Chain A, Crystal Structure Of Human Calmodulin-Dependent Protein Kinase 1d Length = 334 Back     alignment and structure
>pdb|2VRX|A Chain A, Structure Of Aurora B Kinase In Complex With Zm447439 Length = 285 Back     alignment and structure
>pdb|2BFY|A Chain A, Complex Of Aurora-B With Incenp And Hesperidin. Length = 284 Back     alignment and structure
>pdb|2R0I|A Chain A, Crystal Structure Of A Kinase Mark2PAR-1 Mutant Length = 327 Back     alignment and structure
>pdb|2R0I|A Chain A, Crystal Structure Of A Kinase Mark2PAR-1 Mutant Length = 327 Back     alignment and structure
>pdb|2JAM|A Chain A, Crystal Structure Of Human Calmodulin-Dependent Protein Kinase I G Length = 304 Back     alignment and structure
>pdb|2JAM|A Chain A, Crystal Structure Of Human Calmodulin-Dependent Protein Kinase I G Length = 304 Back     alignment and structure
>pdb|1ZMU|A Chain A, Catalytic And Ubiqutin-Associated Domains Of Mark2PAR-1: Wild Type Length = 327 Back     alignment and structure
>pdb|1ZMU|A Chain A, Catalytic And Ubiqutin-Associated Domains Of Mark2PAR-1: Wild Type Length = 327 Back     alignment and structure
>pdb|1ZMV|A Chain A, Catalytic And Ubiqutin-Associated Domains Of Mark2PAR-1: K82r Mutant Length = 327 Back     alignment and structure
>pdb|1ZMV|A Chain A, Catalytic And Ubiqutin-Associated Domains Of Mark2PAR-1: K82r Mutant Length = 327 Back     alignment and structure
>pdb|3IEC|A Chain A, Helicobacter Pylori Caga Inhibits Par1MARK FAMILY KINASES BY Mimicking Host Substrates Length = 319 Back     alignment and structure
>pdb|3IEC|A Chain A, Helicobacter Pylori Caga Inhibits Par1MARK FAMILY KINASES BY Mimicking Host Substrates Length = 319 Back     alignment and structure
>pdb|1A06|A Chain A, Calmodulin-Dependent Protein Kinase From Rat Length = 332 Back     alignment and structure
>pdb|1A06|A Chain A, Calmodulin-Dependent Protein Kinase From Rat Length = 332 Back     alignment and structure
>pdb|4FG9|A Chain A, Crystal Structure Of Human Calcium/calmodulin-dependent Protein Kinase I 1-320 In Complex With Atp Length = 320 Back     alignment and structure
>pdb|4FG9|A Chain A, Crystal Structure Of Human Calcium/calmodulin-dependent Protein Kinase I 1-320 In Complex With Atp Length = 320 Back     alignment and structure
>pdb|4FG7|A Chain A, Crystal Structure Of Human Calcium/calmodulin-dependent Protein Kinase I 1-293 In Complex With Atp Length = 293 Back     alignment and structure
>pdb|4FG7|A Chain A, Crystal Structure Of Human Calcium/calmodulin-dependent Protein Kinase I 1-293 In Complex With Atp Length = 293 Back     alignment and structure
>pdb|4FG8|A Chain A, Crystal Structure Of Human Calcium/calmodulin-dependent Protein Kinase I 1-315 In Complex With Atp Length = 315 Back     alignment and structure
>pdb|4FG8|A Chain A, Crystal Structure Of Human Calcium/calmodulin-dependent Protein Kinase I 1-315 In Complex With Atp Length = 315 Back     alignment and structure
>pdb|3BHY|A Chain A, Crystal Structure Of Human Death Associated Protein Kinase 3 (Dapk3) In Complex With A Beta-Carboline Ligand Length = 283 Back     alignment and structure
>pdb|3BHY|A Chain A, Crystal Structure Of Human Death Associated Protein Kinase 3 (Dapk3) In Complex With A Beta-Carboline Ligand Length = 283 Back     alignment and structure
>pdb|2J90|A Chain A, Crystal Structure Of Human Zip Kinase In Complex With A Tetracyclic Pyridone Inhibitor (pyridone 6) Length = 304 Back     alignment and structure
>pdb|2J90|A Chain A, Crystal Structure Of Human Zip Kinase In Complex With A Tetracyclic Pyridone Inhibitor (pyridone 6) Length = 304 Back     alignment and structure
>pdb|2WZJ|A Chain A, Catalytic And Uba Domain Of Kinase Mark2(PAR-1) K82r, T208e Double Mutant Length = 327 Back     alignment and structure
>pdb|2WZJ|A Chain A, Catalytic And Uba Domain Of Kinase Mark2(PAR-1) K82r, T208e Double Mutant Length = 327 Back     alignment and structure
>pdb|1ZMW|A Chain A, Catalytic And Ubiqutin-Associated Domains Of Mark2PAR-1: T208aS212A INACTIVE DOUBLE MUTANT Length = 327 Back     alignment and structure
>pdb|1ZMW|A Chain A, Catalytic And Ubiqutin-Associated Domains Of Mark2PAR-1: T208aS212A INACTIVE DOUBLE MUTANT Length = 327 Back     alignment and structure
>pdb|1YRP|A Chain A, Catalytic Domain Of Human Zip Kinase Phosphorylated At Thr265 Length = 278 Back     alignment and structure
>pdb|1YRP|A Chain A, Catalytic Domain Of Human Zip Kinase Phosphorylated At Thr265 Length = 278 Back     alignment and structure
>pdb|3H4J|B Chain B, Crystal Structure Of Pombe Ampk Kdaid Fragment Length = 336 Back     alignment and structure
>pdb|3H4J|B Chain B, Crystal Structure Of Pombe Ampk Kdaid Fragment Length = 336 Back     alignment and structure
>pdb|2QNJ|A Chain A, Kinase And Ubiquitin-Associated Domains Of Mark3PAR-1 Length = 328 Back     alignment and structure
>pdb|2QNJ|A Chain A, Kinase And Ubiquitin-Associated Domains Of Mark3PAR-1 Length = 328 Back     alignment and structure
>pdb|3MN3|A Chain A, An Inhibited Conformation For The Protein Kinase Domain Of The Saccharomyces Cerevisiae Ampk Homolog Snf1 Length = 271 Back     alignment and structure
>pdb|3MN3|A Chain A, An Inhibited Conformation For The Protein Kinase Domain Of The Saccharomyces Cerevisiae Ampk Homolog Snf1 Length = 271 Back     alignment and structure
>pdb|2FH9|A Chain A, Structure And Dimerization Of The Kinase Domain From Yeast Snf1 Length = 274 Back     alignment and structure
>pdb|2FH9|A Chain A, Structure And Dimerization Of The Kinase Domain From Yeast Snf1 Length = 274 Back     alignment and structure
>pdb|3DAE|A Chain A, Crystal Structure Of Phosphorylated Snf1 Kinase Domain Length = 283 Back     alignment and structure
>pdb|3DAE|A Chain A, Crystal Structure Of Phosphorylated Snf1 Kinase Domain Length = 283 Back     alignment and structure
>pdb|3HYH|A Chain A, Crystal Structure Of The Protein Kinase Domain Of Yeast Amp-Activated Protein Kinase Snf1 Length = 275 Back     alignment and structure
>pdb|3HYH|A Chain A, Crystal Structure Of The Protein Kinase Domain Of Yeast Amp-Activated Protein Kinase Snf1 Length = 275 Back     alignment and structure
>pdb|2WEL|A Chain A, Crystal Structure Of Su6656-Bound CalciumCALMODULIN- Dependent Protein Kinase Ii Delta In Complex With Calmodulin Length = 327 Back     alignment and structure
>pdb|2WEL|A Chain A, Crystal Structure Of Su6656-Bound CalciumCALMODULIN- Dependent Protein Kinase Ii Delta In Complex With Calmodulin Length = 327 Back     alignment and structure
>pdb|2VN9|A Chain A, Crystal Structure Of Human Calcium Calmodulin Dependent Protein Kinase Ii Delta Isoform 1, Camkd Length = 301 Back     alignment and structure
>pdb|2VN9|A Chain A, Crystal Structure Of Human Calcium Calmodulin Dependent Protein Kinase Ii Delta Isoform 1, Camkd Length = 301 Back     alignment and structure
>pdb|1Q4K|B Chain B, The Polo-Box Domain Of Plk1 In Complex With A Phospho- Peptide Length = 259 Back     alignment and structure
>pdb|2OGQ|A Chain A, Molecular And Structural Basis Of Plk1 Substrate Recognition: Implications In Centrosomal Localization Length = 239 Back     alignment and structure
>pdb|2BDW|A Chain A, Crystal Structure Of The Auto-Inhibited Kinase Domain Of CalciumCALMODULIN ACTIVATED KINASE II Length = 362 Back     alignment and structure
>pdb|2BDW|A Chain A, Crystal Structure Of The Auto-Inhibited Kinase Domain Of CalciumCALMODULIN ACTIVATED KINASE II Length = 362 Back     alignment and structure
>pdb|1UMW|A Chain A, Structure Of A Human Plk1 Polo-Box DomainPHOSPHOPEPTIDE Complex Length = 237 Back     alignment and structure
>pdb|4H5X|B Chain B, Human Plk1-Pbd With A Glycerol Bound At The Phophopeptide Binding Site Length = 240 Back     alignment and structure
>pdb|3FVH|A Chain A, Polo-Like Kinase 1 Polo Box Domain In Complex With Ac-Lhspta-Nh2 Peptide Length = 237 Back     alignment and structure
>pdb|3C5L|A Chain A, Polo-Like Kinase 1 Polo Box Domain In Complex With Pphspt Peptide Length = 221 Back     alignment and structure
>pdb|3HIH|A Chain A, Structure Of Human Plk1-pbd With Glycerol And Sulfate In The Phophopeptide Binding Site Length = 223 Back     alignment and structure
>pdb|3P2W|A Chain A, Unliganded Form Of Polo-Like Kinase I Polo-Box Domain Length = 232 Back     alignment and structure
>pdb|3KK8|A Chain A, Camkii Substrate Complex A Length = 284 Back     alignment and structure
>pdb|3KK8|A Chain A, Camkii Substrate Complex A Length = 284 Back     alignment and structure
>pdb|3KK9|A Chain A, Camkii Substrate Complex B Length = 282 Back     alignment and structure
>pdb|3KK9|A Chain A, Camkii Substrate Complex B Length = 282 Back     alignment and structure
>pdb|3KL8|A Chain A, Camkiintide Inhibitor Complex Length = 269 Back     alignment and structure
>pdb|3KL8|A Chain A, Camkiintide Inhibitor Complex Length = 269 Back     alignment and structure
>pdb|3FE3|A Chain A, Crystal Structure Of The Kinase Mark3PAR-1: T211a-S215a Double Mutant Length = 328 Back     alignment and structure
>pdb|3FE3|A Chain A, Crystal Structure Of The Kinase Mark3PAR-1: T211a-S215a Double Mutant Length = 328 Back     alignment and structure
>pdb|3BHH|A Chain A, Crystal Structure Of Human Calcium/calmodulin-dependent Protein Kinase Iib Isoform 1 (camk2b) Length = 295 Back     alignment and structure
>pdb|3BHH|A Chain A, Crystal Structure Of Human Calcium/calmodulin-dependent Protein Kinase Iib Isoform 1 (camk2b) Length = 295 Back     alignment and structure
>pdb|2QR8|A Chain A, 2.0a X-ray Structure Of C-terminal Kinase Domain Of P90 Ribosomal S6 Kinase 2 (rsk2) Length = 342 Back     alignment and structure
>pdb|3IS5|A Chain A, Crystal Structure Of Cdpk Kinase Domain From Toxoplasma Gondii, Tgme49_018720 Length = 285 Back     alignment and structure
>pdb|3IS5|A Chain A, Crystal Structure Of Cdpk Kinase Domain From Toxoplasma Gondii, Tgme49_018720 Length = 285 Back     alignment and structure
>pdb|3RNY|A Chain A, Crystal Structure Of Human Rsk1 C-Terminal Kinase Domain Length = 346 Back     alignment and structure
>pdb|3RNY|A Chain A, Crystal Structure Of Human Rsk1 C-Terminal Kinase Domain Length = 346 Back     alignment and structure
>pdb|3SOA|A Chain A, Full-Length Human Camkii Length = 444 Back     alignment and structure
>pdb|3SOA|A Chain A, Full-Length Human Camkii Length = 444 Back     alignment and structure
>pdb|2VZ6|A Chain A, Structure Of Human Calcium Calmodulin Dependent Protein Kinase Type Ii Alpha (Camk2a) In Complex With Indirubin E804 Length = 313 Back     alignment and structure
>pdb|2VZ6|A Chain A, Structure Of Human Calcium Calmodulin Dependent Protein Kinase Type Ii Alpha (Camk2a) In Complex With Indirubin E804 Length = 313 Back     alignment and structure
>pdb|3F3Z|A Chain A, Crystal Structure Of Cryptosporidium Parvum Calcium Dependent Protein Kinase Cgd7_1840 In Presence Of Indirubin E804 Length = 277 Back     alignment and structure
>pdb|3F3Z|A Chain A, Crystal Structure Of Cryptosporidium Parvum Calcium Dependent Protein Kinase Cgd7_1840 In Presence Of Indirubin E804 Length = 277 Back     alignment and structure
>pdb|2QG5|A Chain A, Cryptosporidium Parvum Calcium Dependent Protein Kinase Cgd7_1840 Length = 294 Back     alignment and structure
>pdb|2QG5|A Chain A, Cryptosporidium Parvum Calcium Dependent Protein Kinase Cgd7_1840 Length = 294 Back     alignment and structure
>pdb|2V7O|A Chain A, Crystal Structure Of Human Calcium-Calmodulin-Dependent Protein Kinase Ii Gamma Length = 336 Back     alignment and structure
>pdb|2V7O|A Chain A, Crystal Structure Of Human Calcium-Calmodulin-Dependent Protein Kinase Ii Gamma Length = 336 Back     alignment and structure
>pdb|2WNT|A Chain A, Crystal Structure Of The Human Ribosomal Protein S6 Kinase Length = 330 Back     alignment and structure
>pdb|2WNT|A Chain A, Crystal Structure Of The Human Ribosomal Protein S6 Kinase Length = 330 Back     alignment and structure
>pdb|1Y8G|A Chain A, Catalytic And Ubiqutin-Associated Domains Of Mark2PAR-1: Inactive Double Mutant With Selenomethionine Length = 327 Back     alignment and structure
>pdb|1Y8G|A Chain A, Catalytic And Ubiqutin-Associated Domains Of Mark2PAR-1: Inactive Double Mutant With Selenomethionine Length = 327 Back     alignment and structure
>pdb|3LIJ|A Chain A, Crystal Structure Of Full Length Cpcdpk3 (Cgd5_820) In Complex With Ca2+ And Amppnp Length = 494 Back     alignment and structure
>pdb|3LIJ|A Chain A, Crystal Structure Of Full Length Cpcdpk3 (Cgd5_820) In Complex With Ca2+ And Amppnp Length = 494 Back     alignment and structure
>pdb|2H6D|A Chain A, Protein Kinase Domain Of The Human 5'-Amp-Activated Protein Kinase Catalytic Subunit Alpha-2 (Ampk Alpha-2 Chain) Length = 276 Back     alignment and structure
>pdb|2H6D|A Chain A, Protein Kinase Domain Of The Human 5'-Amp-Activated Protein Kinase Catalytic Subunit Alpha-2 (Ampk Alpha-2 Chain) Length = 276 Back     alignment and structure
>pdb|3A60|A Chain A, Crystal Structure Of Unphosphorylated P70s6k1 (Form I) Length = 327 Back     alignment and structure
>pdb|3A60|A Chain A, Crystal Structure Of Unphosphorylated P70s6k1 (Form I) Length = 327 Back     alignment and structure
>pdb|2A27|A Chain A, Human Drp-1 Kinase, W305s S308a D40 Mutant, Crystal Form With 8 Monomers In The Asymmetric Unit Length = 321 Back     alignment and structure
>pdb|2A27|A Chain A, Human Drp-1 Kinase, W305s S308a D40 Mutant, Crystal Form With 8 Monomers In The Asymmetric Unit Length = 321 Back     alignment and structure
>pdb|1Z9X|A Chain A, Human Drp-1 Kinase, W305s S308a D40 Mutant, Crystal Form With 3 Monomers In The Asymmetric Unit Length = 321 Back     alignment and structure
>pdb|1Z9X|A Chain A, Human Drp-1 Kinase, W305s S308a D40 Mutant, Crystal Form With 3 Monomers In The Asymmetric Unit Length = 321 Back     alignment and structure
>pdb|2YZA|A Chain A, Crystal Structure Of Kinase Domain Of Human 5'-Amp-Activated Protein Kinase Alpha-2 Subunit Mutant (T172d) Length = 276 Back     alignment and structure
>pdb|2YZA|A Chain A, Crystal Structure Of Kinase Domain Of Human 5'-Amp-Activated Protein Kinase Alpha-2 Subunit Mutant (T172d) Length = 276 Back     alignment and structure
>pdb|2CLQ|A Chain A, Structure Of Mitogen-Activated Protein Kinase Kinase Kinase 5 Length = 295 Back     alignment and structure
>pdb|2CLQ|A Chain A, Structure Of Mitogen-Activated Protein Kinase Kinase Kinase 5 Length = 295 Back     alignment and structure
>pdb|3VW6|A Chain A, Crystal Structure Of Human Apoptosis Signal-Regulating Kinase 1 (Ask1) With Imidazopyridine Inhibitor Length = 269 Back     alignment and structure
>pdb|3VW6|A Chain A, Crystal Structure Of Human Apoptosis Signal-Regulating Kinase 1 (Ask1) With Imidazopyridine Inhibitor Length = 269 Back     alignment and structure
>pdb|2QR7|A Chain A, 2.0a X-Ray Structure Of C-Terminal Kinase Domain Of P90 Ribosomal S6 Kinase 2: Se-Met Derivative Length = 342 Back     alignment and structure
>pdb|3UDB|A Chain A, Crystal Structure Of Snrk2.6 Length = 317 Back     alignment and structure
>pdb|3UDB|A Chain A, Crystal Structure Of Snrk2.6 Length = 317 Back     alignment and structure
>pdb|1WMK|A Chain A, Human Death-Associated Kinase Drp-1, Mutant S308d D40 Length = 321 Back     alignment and structure
>pdb|1WMK|A Chain A, Human Death-Associated Kinase Drp-1, Mutant S308d D40 Length = 321 Back     alignment and structure
>pdb|3A62|A Chain A, Crystal Structure Of Phosphorylated P70s6k1 Length = 327 Back     alignment and structure
>pdb|3A62|A Chain A, Crystal Structure Of Phosphorylated P70s6k1 Length = 327 Back     alignment and structure
>pdb|2A2A|A Chain A, High-resolution Crystallographic Analysis Of The Autoinhibited Conformation Of A Human Death-associated Protein Kinase Length = 321 Back     alignment and structure
>pdb|2A2A|A Chain A, High-resolution Crystallographic Analysis Of The Autoinhibited Conformation Of A Human Death-associated Protein Kinase Length = 321 Back     alignment and structure
>pdb|1ZWS|A Chain A, Crystal Structure Of The Catalytic Domain Of Human Drp-1 Kinase Length = 288 Back     alignment and structure
>pdb|1ZWS|A Chain A, Crystal Structure Of The Catalytic Domain Of Human Drp-1 Kinase Length = 288 Back     alignment and structure
>pdb|2W4K|A Chain A, X-Ray Structure Of A Dap-Kinase 2-302 Length = 302 Back     alignment and structure
>pdb|2W4K|A Chain A, X-Ray Structure Of A Dap-Kinase 2-302 Length = 302 Back     alignment and structure
>pdb|2W4J|A Chain A, X-Ray Structure Of A Dap-Kinase 2-277 Length = 277 Back     alignment and structure
>pdb|2W4J|A Chain A, X-Ray Structure Of A Dap-Kinase 2-277 Length = 277 Back     alignment and structure
>pdb|2YAK|A Chain A, Structure Of Death-Associated Protein Kinase 1 (Dapk1) In Complex With A Ruthenium Octasporine Ligand (Osv) Length = 285 Back     alignment and structure
>pdb|2YAK|A Chain A, Structure Of Death-Associated Protein Kinase 1 (Dapk1) In Complex With A Ruthenium Octasporine Ligand (Osv) Length = 285 Back     alignment and structure
>pdb|1WVW|A Chain A, Crystal Structures Of Kinase Domain Of Dap Kinase In Complex With Small Molecular Inhibitors Length = 278 Back     alignment and structure
>pdb|1WVW|A Chain A, Crystal Structures Of Kinase Domain Of Dap Kinase In Complex With Small Molecular Inhibitors Length = 278 Back     alignment and structure
>pdb|2XZS|A Chain A, Death Associated Protein Kinase 1 Residues 1-312 Length = 312 Back     alignment and structure
>pdb|2XZS|A Chain A, Death Associated Protein Kinase 1 Residues 1-312 Length = 312 Back     alignment and structure
>pdb|2X0G|A Chain A, X-ray Structure Of A Dap-kinase Calmodulin Complex Length = 334 Back     alignment and structure
>pdb|2X0G|A Chain A, X-ray Structure Of A Dap-kinase Calmodulin Complex Length = 334 Back     alignment and structure
>pdb|2HAK|A Chain A, Catalytic And Ubiqutin-Associated Domains Of Mark1PAR-1 Length = 328 Back     alignment and structure
>pdb|2HAK|A Chain A, Catalytic And Ubiqutin-Associated Domains Of Mark1PAR-1 Length = 328 Back     alignment and structure
>pdb|2Y0A|A Chain A, Structure Of Dapk1 Construct Residues 1-304 Length = 326 Back     alignment and structure
>pdb|2Y0A|A Chain A, Structure Of Dapk1 Construct Residues 1-304 Length = 326 Back     alignment and structure
>pdb|3GU4|A Chain A, Crystal Structure Of Dapkq23v-Amppnp Length = 295 Back     alignment and structure
>pdb|3GU4|A Chain A, Crystal Structure Of Dapkq23v-Amppnp Length = 295 Back     alignment and structure
>pdb|1P4F|A Chain A, Death Associated Protein Kinase Catalytic Domain With Bound Inhibitor Fragment Length = 293 Back     alignment and structure
>pdb|1P4F|A Chain A, Death Associated Protein Kinase Catalytic Domain With Bound Inhibitor Fragment Length = 293 Back     alignment and structure
>pdb|1IG1|A Chain A, 1.8a X-Ray Structure Of Ternary Complex Of A Catalytic Domain Of Death-Associated Protein Kinase With Atp Analogue And Mn. Length = 294 Back     alignment and structure
>pdb|1IG1|A Chain A, 1.8a X-Ray Structure Of Ternary Complex Of A Catalytic Domain Of Death-Associated Protein Kinase With Atp Analogue And Mn. Length = 294 Back     alignment and structure
>pdb|3F5U|A Chain A, Crystal Structure Of The Death Associated Protein Kinase In Complex With Amppnp And Mg2+ Length = 295 Back     alignment and structure
>pdb|3F5U|A Chain A, Crystal Structure Of The Death Associated Protein Kinase In Complex With Amppnp And Mg2+ Length = 295 Back     alignment and structure
>pdb|3DFC|B Chain B, Crystal Structure Of A Glycine-Rich Loop Mutant Of The Death Associated Protein Kinase Catalytic Domain With Amppnp Length = 295 Back     alignment and structure
>pdb|3DFC|B Chain B, Crystal Structure Of A Glycine-Rich Loop Mutant Of The Death Associated Protein Kinase Catalytic Domain With Amppnp Length = 295 Back     alignment and structure
>pdb|2XUU|A Chain A, Crystal Structure Of A Dap-Kinase 1 Mutant Length = 334 Back     alignment and structure
>pdb|2XUU|A Chain A, Crystal Structure Of A Dap-Kinase 1 Mutant Length = 334 Back     alignment and structure
>pdb|2YA9|A Chain A, Crystal Structure Of The Autoinhibited Form Of Mouse Dapk2 Length = 361 Back     alignment and structure
>pdb|2YA9|A Chain A, Crystal Structure Of The Autoinhibited Form Of Mouse Dapk2 Length = 361 Back     alignment and structure
>pdb|3ZUT|A Chain A, The Structure Of Ost1 (D160a) Kinase Length = 362 Back     alignment and structure
>pdb|3ZUT|A Chain A, The Structure Of Ost1 (D160a) Kinase Length = 362 Back     alignment and structure
>pdb|3UC4|A Chain A, The Crystal Structure Of Snf1-Related Kinase 2.6 Length = 362 Back     alignment and structure
>pdb|3UC4|A Chain A, The Crystal Structure Of Snf1-Related Kinase 2.6 Length = 362 Back     alignment and structure
>pdb|3ZUU|A Chain A, The Structure Of Ost1 (D160a, S175d) Kinase In Complex With Gold Length = 362 Back     alignment and structure
>pdb|3ZUU|A Chain A, The Structure Of Ost1 (D160a, S175d) Kinase In Complex With Gold Length = 362 Back     alignment and structure
>pdb|3PWY|A Chain A, Crystal Structure Of An Extender (Spd28345)-Modified Human Pdk1 Complex 2 Length = 311 Back     alignment and structure
>pdb|3PWY|A Chain A, Crystal Structure Of An Extender (Spd28345)-Modified Human Pdk1 Complex 2 Length = 311 Back     alignment and structure
>pdb|3QC4|A Chain A, Pdk1 In Complex With Dfg-Out Inhibitor Xxx Length = 314 Back     alignment and structure
>pdb|3QC4|A Chain A, Pdk1 In Complex With Dfg-Out Inhibitor Xxx Length = 314 Back     alignment and structure
>pdb|3DXN|A Chain A, Crystal Structure Of The Calcium-dependent Kinase From Toxoplasma Gondii, 541.m00134, Kinase Domain Length = 287 Back     alignment and structure
>pdb|3DXN|A Chain A, Crystal Structure Of The Calcium-dependent Kinase From Toxoplasma Gondii, 541.m00134, Kinase Domain Length = 287 Back     alignment and structure
>pdb|3UJG|A Chain A, Crystal Structure Of Snrk2.6 In Complex With Hab1 Length = 361 Back     alignment and structure
>pdb|3UJG|A Chain A, Crystal Structure Of Snrk2.6 In Complex With Hab1 Length = 361 Back     alignment and structure
>pdb|3HZT|A Chain A, Crystal Structure Of Toxoplasma Gondii Cdpk3, Tgme49_105860 Length = 467 Back     alignment and structure
>pdb|3HZT|A Chain A, Crystal Structure Of Toxoplasma Gondii Cdpk3, Tgme49_105860 Length = 467 Back     alignment and structure
>pdb|2Z7Q|A Chain A, Crystal Structure Of The N-Terminal Kinase Domain Of Human Rsk-1 Bound To Amp-Pcp Length = 321 Back     alignment and structure
>pdb|2Z7Q|A Chain A, Crystal Structure Of The N-Terminal Kinase Domain Of Human Rsk-1 Bound To Amp-Pcp Length = 321 Back     alignment and structure
>pdb|3GU8|A Chain A, Crystal Structure Of Dapkl93g With N6-Cyclopentyladenosine Length = 295 Back     alignment and structure
>pdb|3GU8|A Chain A, Crystal Structure Of Dapkl93g With N6-Cyclopentyladenosine Length = 295 Back     alignment and structure
>pdb|1GZN|A Chain A, Structure Of Pkb Kinase Domain Length = 335 Back     alignment and structure
>pdb|1GZN|A Chain A, Structure Of Pkb Kinase Domain Length = 335 Back     alignment and structure
>pdb|1MRV|A Chain A, Crystal Structure Of An Inactive Akt2 Kinase Domain Length = 339 Back     alignment and structure
>pdb|1MRV|A Chain A, Crystal Structure Of An Inactive Akt2 Kinase Domain Length = 339 Back     alignment and structure
>pdb|1GZK|A Chain A, Molecular Mechanism For The Regulation Of Protein Kinase B Akt By Hydrophobic Motif Phosphorylation Length = 315 Back     alignment and structure
>pdb|1GZK|A Chain A, Molecular Mechanism For The Regulation Of Protein Kinase B Akt By Hydrophobic Motif Phosphorylation Length = 315 Back     alignment and structure
>pdb|4EJN|A Chain A, Crystal Structure Of Autoinhibited Form Of Akt1 In Complex With N-(4- (5-(3-Acetamidophenyl)-2-(2-Aminopyridin-3-Yl)-3h- Imidazo[4,5- B]pyridin-3-Yl)benzyl)-3-Fluorobenzamide Length = 446 Back     alignment and structure
>pdb|4EJN|A Chain A, Crystal Structure Of Autoinhibited Form Of Akt1 In Complex With N-(4- (5-(3-Acetamidophenyl)-2-(2-Aminopyridin-3-Yl)-3h- Imidazo[4,5- B]pyridin-3-Yl)benzyl)-3-Fluorobenzamide Length = 446 Back     alignment and structure
>pdb|3O96|A Chain A, Crystal Structure Of Human Akt1 With An Allosteric Inhibitor Length = 446 Back     alignment and structure
>pdb|3O96|A Chain A, Crystal Structure Of Human Akt1 With An Allosteric Inhibitor Length = 446 Back     alignment and structure
>pdb|4A07|A Chain A, Human Pdk1 Kinase Domain In Complex With Allosteric Activator Ps171 Bound To The Pif-Pocket Length = 311 Back     alignment and structure
>pdb|4A07|A Chain A, Human Pdk1 Kinase Domain In Complex With Allosteric Activator Ps171 Bound To The Pif-Pocket Length = 311 Back     alignment and structure
>pdb|3NAX|A Chain A, Pdk1 In Complex With Inhibitor Mp7 Length = 311 Back     alignment and structure
>pdb|3NAX|A Chain A, Pdk1 In Complex With Inhibitor Mp7 Length = 311 Back     alignment and structure
>pdb|3HRC|A Chain A, Crystal Structure Of A Mutant Of Human Pdk1 Kinase Domain In Complex With Atp Length = 311 Back     alignment and structure
>pdb|3HRC|A Chain A, Crystal Structure Of A Mutant Of Human Pdk1 Kinase Domain In Complex With Atp Length = 311 Back     alignment and structure
>pdb|2R7B|A Chain A, Crystal Structure Of The Phosphoinositide-Dependent Kinase- 1 (Pdk-1)catalytic Domain Bound To A Dibenzonaphthyridine Inhibitor Length = 312 Back     alignment and structure
>pdb|2R7B|A Chain A, Crystal Structure Of The Phosphoinositide-Dependent Kinase- 1 (Pdk-1)catalytic Domain Bound To A Dibenzonaphthyridine Inhibitor Length = 312 Back     alignment and structure
>pdb|4DC2|A Chain A, Structure Of Pkc In Complex With A Substrate Peptide From Par-3 Length = 396 Back     alignment and structure
>pdb|4DC2|A Chain A, Structure Of Pkc In Complex With A Substrate Peptide From Par-3 Length = 396 Back     alignment and structure
>pdb|2JED|A Chain A, The Crystal Structure Of The Kinase Domain Of The Protein Kinase C Theta In Complex With Nvp-Xaa228 At 2.32a Resolution. Length = 352 Back     alignment and structure
>pdb|2JED|A Chain A, The Crystal Structure Of The Kinase Domain Of The Protein Kinase C Theta In Complex With Nvp-Xaa228 At 2.32a Resolution. Length = 352 Back     alignment and structure
>pdb|3NAY|A Chain A, Pdk1 In Complex With Inhibitor Mp6 Length = 311 Back     alignment and structure
>pdb|3NAY|A Chain A, Pdk1 In Complex With Inhibitor Mp6 Length = 311 Back     alignment and structure
>pdb|2BIY|A Chain A, Structure Of Pdk1-S241a Mutant Kinase Domain Length = 310 Back     alignment and structure
>pdb|2BIY|A Chain A, Structure Of Pdk1-S241a Mutant Kinase Domain Length = 310 Back     alignment and structure
>pdb|3NUN|A Chain A, Phosphoinositide-Dependent Kinase-1 (Pdk1) With Lead Compound Length = 292 Back     alignment and structure
>pdb|3NUN|A Chain A, Phosphoinositide-Dependent Kinase-1 (Pdk1) With Lead Compound Length = 292 Back     alignment and structure
>pdb|1XJD|A Chain A, Crystal Structure Of Pkc-Theta Complexed With Staurosporine At 2a Resolution Length = 345 Back     alignment and structure
>pdb|1XJD|A Chain A, Crystal Structure Of Pkc-Theta Complexed With Staurosporine At 2a Resolution Length = 345 Back     alignment and structure
>pdb|2Y94|A Chain A, Structure Of An Active Form Of Mammalian Ampk Length = 476 Back     alignment and structure
>pdb|2Y94|A Chain A, Structure Of An Active Form Of Mammalian Ampk Length = 476 Back     alignment and structure
>pdb|2XCH|A Chain A, Crystal Structure Of Pdk1 In Complex With A Pyrazoloquinazoline Inhibitor Length = 309 Back     alignment and structure
>pdb|2XCH|A Chain A, Crystal Structure Of Pdk1 In Complex With A Pyrazoloquinazoline Inhibitor Length = 309 Back     alignment and structure
>pdb|3ORX|A Chain A, Pdk1 Mutant Bound To Allosteric Disulfide Fragment Inhibitor 1f8 Length = 316 Back     alignment and structure
>pdb|3ORX|A Chain A, Pdk1 Mutant Bound To Allosteric Disulfide Fragment Inhibitor 1f8 Length = 316 Back     alignment and structure
>pdb|3RWP|A Chain A, Discovery Of A Novel, Potent And Selective Inhibitor Of 3- Phosphoinositide Dependent Kinase (Pdk1) Length = 311 Back     alignment and structure
>pdb|3RWP|A Chain A, Discovery Of A Novel, Potent And Selective Inhibitor Of 3- Phosphoinositide Dependent Kinase (Pdk1) Length = 311 Back     alignment and structure
>pdb|1UU3|A Chain A, Structure Of Human Pdk1 Kinase Domain In Complex With Ly333531 Length = 310 Back     alignment and structure
>pdb|1UU3|A Chain A, Structure Of Human Pdk1 Kinase Domain In Complex With Ly333531 Length = 310 Back     alignment and structure
>pdb|3NUS|A Chain A, Phosphoinositide-Dependent Kinase-1 (Pdk1) With Fragment8 Length = 286 Back     alignment and structure
>pdb|3NUS|A Chain A, Phosphoinositide-Dependent Kinase-1 (Pdk1) With Fragment8 Length = 286 Back     alignment and structure
>pdb|1O6L|A Chain A, Crystal Structure Of An Activated Akt/protein Kinase B (pkb-pif Chimera) Ternary Complex With Amp-pnp And Gsk3 Peptide Length = 337 Back     alignment and structure
>pdb|1O6L|A Chain A, Crystal Structure Of An Activated Akt/protein Kinase B (pkb-pif Chimera) Ternary Complex With Amp-pnp And Gsk3 Peptide Length = 337 Back     alignment and structure
>pdb|3SC1|A Chain A, Novel Isoquinolone Pdk1 Inhibitors Discovered Through Fragment-Based Lead Discovery Length = 311 Back     alignment and structure
>pdb|3SC1|A Chain A, Novel Isoquinolone Pdk1 Inhibitors Discovered Through Fragment-Based Lead Discovery Length = 311 Back     alignment and structure
>pdb|2XCK|A Chain A, Crystal Structure Of Pdk1 In Complex With A Pyrazoloquinazoline Inhibitor Length = 309 Back     alignment and structure
>pdb|2XCK|A Chain A, Crystal Structure Of Pdk1 In Complex With A Pyrazoloquinazoline Inhibitor Length = 309 Back     alignment and structure
>pdb|2JDO|A Chain A, Structure Of Pkb-Beta (Akt2) Complexed With Isoquinoline-5- Sulfonic Acid (2-(2-(4-Chlorobenzyloxy) Ethylamino)ethyl) Amide Length = 342 Back     alignment and structure
>pdb|2JDO|A Chain A, Structure Of Pkb-Beta (Akt2) Complexed With Isoquinoline-5- Sulfonic Acid (2-(2-(4-Chlorobenzyloxy) Ethylamino)ethyl) Amide Length = 342 Back     alignment and structure
>pdb|1Z5M|A Chain A, Crystal Structure Of N1-[3-[[5-bromo-2-[[3-[(1-pyrrolidinylcarbonyl) Amino]phenyl]amino]-4-pyrimidinyl]amino]propyl]-2,2- Dimethylpropanediamide Complexed With Human Pdk1 Length = 286 Back     alignment and structure
>pdb|1Z5M|A Chain A, Crystal Structure Of N1-[3-[[5-bromo-2-[[3-[(1-pyrrolidinylcarbonyl) Amino]phenyl]amino]-4-pyrimidinyl]amino]propyl]-2,2- Dimethylpropanediamide Complexed With Human Pdk1 Length = 286 Back     alignment and structure
>pdb|3UBD|A Chain A, Structure Of N-Terminal Domain Of Rsk2 Kinase In Complex With Flavonoid Glycoside Sl0101 Length = 304 Back     alignment and structure
>pdb|3UBD|A Chain A, Structure Of N-Terminal Domain Of Rsk2 Kinase In Complex With Flavonoid Glycoside Sl0101 Length = 304 Back     alignment and structure
>pdb|4EL9|A Chain A, Structure Of N-Terminal Kinase Domain Of Rsk2 With Afzelin Length = 305 Back     alignment and structure
>pdb|4EL9|A Chain A, Structure Of N-Terminal Kinase Domain Of Rsk2 With Afzelin Length = 305 Back     alignment and structure
>pdb|3H9O|A Chain A, Phosphoinositide-Dependent Protein Kinase 1 (Pdk-1) In Complex With Compound 9 Length = 311 Back     alignment and structure
>pdb|3H9O|A Chain A, Phosphoinositide-Dependent Protein Kinase 1 (Pdk-1) In Complex With Compound 9 Length = 311 Back     alignment and structure
>pdb|3E87|A Chain A, Crystal Structures Of The Kinase Domain Of Akt2 In Complex With Atp- Competitive Inhibitors Length = 335 Back     alignment and structure
>pdb|3E87|A Chain A, Crystal Structures Of The Kinase Domain Of Akt2 In Complex With Atp- Competitive Inhibitors Length = 335 Back     alignment and structure
>pdb|1UU9|A Chain A, Structure Of Human Pdk1 Kinase Domain In Complex With Bim-3 Length = 286 Back     alignment and structure
>pdb|1UU9|A Chain A, Structure Of Human Pdk1 Kinase Domain In Complex With Bim-3 Length = 286 Back     alignment and structure
>pdb|1O6K|A Chain A, Structure Of Activated Form Of Pkb Kinase Domain S474d With Gsk3 Peptide And Amp-Pnp Length = 336 Back     alignment and structure
>pdb|1O6K|A Chain A, Structure Of Activated Form Of Pkb Kinase Domain S474d With Gsk3 Peptide And Amp-Pnp Length = 336 Back     alignment and structure
>pdb|3IOP|A Chain A, Pdk-1 In Complex With The Inhibitor Compound-8i Length = 312 Back     alignment and structure
>pdb|3IOP|A Chain A, Pdk-1 In Complex With The Inhibitor Compound-8i Length = 312 Back     alignment and structure
>pdb|1H1W|A Chain A, High Resolution Crystal Structure Of The Human Pdk1 Catalytic Domain Length = 289 Back     alignment and structure
>pdb|1H1W|A Chain A, High Resolution Crystal Structure Of The Human Pdk1 Catalytic Domain Length = 289 Back     alignment and structure
>pdb|3OCB|A Chain A, Akt1 Kinase Domain With Pyrrolopyrimidine Inhibitor Length = 341 Back     alignment and structure
>pdb|3OCB|A Chain A, Akt1 Kinase Domain With Pyrrolopyrimidine Inhibitor Length = 341 Back     alignment and structure
>pdb|4GV1|A Chain A, Pkb Alpha In Complex With Azd5363 Length = 340 Back     alignment and structure
>pdb|4GV1|A Chain A, Pkb Alpha In Complex With Azd5363 Length = 340 Back     alignment and structure
>pdb|3G51|A Chain A, Structural Diversity Of The Active Conformation Of The N- Terminal Kinase Domain Of P90 Ribosomal S6 Kinase 2 Length = 325 Back     alignment and structure
>pdb|3G51|A Chain A, Structural Diversity Of The Active Conformation Of The N- Terminal Kinase Domain Of P90 Ribosomal S6 Kinase 2 Length = 325 Back     alignment and structure
>pdb|3CQU|A Chain A, Crystal Structure Of Akt-1 Complexed With Substrate Peptide And Inhibitor Length = 342 Back     alignment and structure
>pdb|3CQU|A Chain A, Crystal Structure Of Akt-1 Complexed With Substrate Peptide And Inhibitor Length = 342 Back     alignment and structure
>pdb|2WTK|C Chain C, Structure Of The Heterotrimeric Lkb1-Stradalpha-Mo25alpha Complex Length = 305 Back     alignment and structure
>pdb|2WTK|C Chain C, Structure Of The Heterotrimeric Lkb1-Stradalpha-Mo25alpha Complex Length = 305 Back     alignment and structure
>pdb|2R5T|A Chain A, Crystal Structure Of Inactive Serum And Glucocorticoid- Regulated Kinase 1 In Complex With Amp-Pnp Length = 373 Back     alignment and structure
>pdb|2R5T|A Chain A, Crystal Structure Of Inactive Serum And Glucocorticoid- Regulated Kinase 1 In Complex With Amp-Pnp Length = 373 Back     alignment and structure
>pdb|3UC3|A Chain A, The Crystal Structure Of Snf1-Related Kinase 2.3 Length = 361 Back     alignment and structure
>pdb|3UC3|A Chain A, The Crystal Structure Of Snf1-Related Kinase 2.3 Length = 361 Back     alignment and structure
>pdb|3Q5I|A Chain A, Crystal Structure Of Pbanka_031420 Length = 504 Back     alignment and structure
>pdb|3Q5I|A Chain A, Crystal Structure Of Pbanka_031420 Length = 504 Back     alignment and structure
>pdb|3ZH8|A Chain A, A Novel Small Molecule Apkc Inhibitor Length = 349 Back     alignment and structure
>pdb|3ZH8|A Chain A, A Novel Small Molecule Apkc Inhibitor Length = 349 Back     alignment and structure
>pdb|3A8W|A Chain A, Crystal Structure Of Pkciota Kinase Domain Length = 345 Back     alignment and structure
>pdb|3A8W|A Chain A, Crystal Structure Of Pkciota Kinase Domain Length = 345 Back     alignment and structure
>pdb|1ZRZ|A Chain A, Crystal Structure Of The Catalytic Domain Of Atypical Protein Kinase C-Iota Length = 364 Back     alignment and structure
>pdb|1ZRZ|A Chain A, Crystal Structure Of The Catalytic Domain Of Atypical Protein Kinase C-Iota Length = 364 Back     alignment and structure
>pdb|3KN5|A Chain A, Crystal Structure Of The C-Terminal Kinase Domain Of Msk1 In With Amp-Pnp Length = 325 Back     alignment and structure
>pdb|3KN5|A Chain A, Crystal Structure Of The C-Terminal Kinase Domain Of Msk1 In With Amp-Pnp Length = 325 Back     alignment and structure
>pdb|3IW4|A Chain A, Crystal Structure Of Pkc Alpha In Complex With Nvp-Aeb071 Length = 360 Back     alignment and structure
>pdb|3IW4|A Chain A, Crystal Structure Of Pkc Alpha In Complex With Nvp-Aeb071 Length = 360 Back     alignment and structure
>pdb|2W5A|A Chain A, Human Nek2 Kinase Adp-Bound Length = 279 Back     alignment and structure
>pdb|2W5A|A Chain A, Human Nek2 Kinase Adp-Bound Length = 279 Back     alignment and structure
>pdb|1FOT|A Chain A, Structure Of The Unliganded Camp-Dependent Protein Kinase Catalytic Subunit From Saccharomyces Cerevisiae Length = 318 Back     alignment and structure
>pdb|1FOT|A Chain A, Structure Of The Unliganded Camp-Dependent Protein Kinase Catalytic Subunit From Saccharomyces Cerevisiae Length = 318 Back     alignment and structure
>pdb|2CN5|A Chain A, Crystal Structure Of Human Chk2 In Complex With Adp Length = 329 Back     alignment and structure
>pdb|2CN5|A Chain A, Crystal Structure Of Human Chk2 In Complex With Adp Length = 329 Back     alignment and structure
>pdb|2YCF|A Chain A, Crystal Structure Of Checkpoint Kinase 2 In Complex With Inhibitor Pv1531 Length = 322 Back     alignment and structure
>pdb|2YCF|A Chain A, Crystal Structure Of Checkpoint Kinase 2 In Complex With Inhibitor Pv1531 Length = 322 Back     alignment and structure
>pdb|2W0J|A Chain A, Crystal Structure Of Chk2 In Complex With Nsc 109555, A Specific Inhibitor Length = 323 Back     alignment and structure
>pdb|2W0J|A Chain A, Crystal Structure Of Chk2 In Complex With Nsc 109555, A Specific Inhibitor Length = 323 Back     alignment and structure
>pdb|2YCR|A Chain A, Crystal Structure Of Checkpoint Kinase 2 In Complex With Inhibitor Pv976 Length = 323 Back     alignment and structure
>pdb|2YCR|A Chain A, Crystal Structure Of Checkpoint Kinase 2 In Complex With Inhibitor Pv976 Length = 323 Back     alignment and structure
>pdb|2XK9|A Chain A, Structural Analysis Of Checkpoint Kinase 2 (Chk2) In Complex With Inhibitor Pv1533 Length = 322 Back     alignment and structure
>pdb|2XK9|A Chain A, Structural Analysis Of Checkpoint Kinase 2 (Chk2) In Complex With Inhibitor Pv1533 Length = 322 Back     alignment and structure
>pdb|3I6W|A Chain A, Structure And Activation Mechanism Of The Chk2 Dna-Damage Checkpoint Kinase Length = 443 Back     alignment and structure
>pdb|3I6W|A Chain A, Structure And Activation Mechanism Of The Chk2 Dna-Damage Checkpoint Kinase Length = 443 Back     alignment and structure
>pdb|3I6U|A Chain A, Structure And Activation Mechanism Of The Chk2 Dna-Damage Checkpoint Kinase Length = 419 Back     alignment and structure
>pdb|3I6U|A Chain A, Structure And Activation Mechanism Of The Chk2 Dna-Damage Checkpoint Kinase Length = 419 Back     alignment and structure
>pdb|3TXO|A Chain A, Pkc Eta Kinase In Complex With A Naphthyridine Length = 353 Back     alignment and structure
>pdb|3TXO|A Chain A, Pkc Eta Kinase In Complex With A Naphthyridine Length = 353 Back     alignment and structure
>pdb|3IGO|A Chain A, Crystal Structure Of Cryptosporidium Parvum Cdpk1, Cgd3_920 Length = 486 Back     alignment and structure
>pdb|3IGO|A Chain A, Crystal Structure Of Cryptosporidium Parvum Cdpk1, Cgd3_920 Length = 486 Back     alignment and structure
>pdb|3R1N|A Chain A, Mk3 Kinase Bound To Compound 5b Length = 317 Back     alignment and structure
>pdb|3R1N|A Chain A, Mk3 Kinase Bound To Compound 5b Length = 317 Back     alignment and structure
>pdb|3FHR|A Chain A, High Resolution Crystal Structure Of Mitogen-Activated Protein Kinase-Activated Protein Kinase 3 (Mk3)-Inhibitor Complex Length = 336 Back     alignment and structure
>pdb|3FHR|A Chain A, High Resolution Crystal Structure Of Mitogen-Activated Protein Kinase-Activated Protein Kinase 3 (Mk3)-Inhibitor Complex Length = 336 Back     alignment and structure
>pdb|2JAV|A Chain A, Human Kinase With Pyrrole-Indolinone Ligand Length = 279 Back     alignment and structure
>pdb|2JAV|A Chain A, Human Kinase With Pyrrole-Indolinone Ligand Length = 279 Back     alignment and structure
>pdb|1QL6|A Chain A, The Catalytic Mechanism Of Phosphorylase Kinase Probed By Mutational Studies Length = 298 Back     alignment and structure
>pdb|1QL6|A Chain A, The Catalytic Mechanism Of Phosphorylase Kinase Probed By Mutational Studies Length = 298 Back     alignment and structure
>pdb|3DFA|A Chain A, Crystal Structure Of Kinase Domain Of Calcium-dependent Protein Kinase Cgd3_920 From Cryptosporidium Parvum Length = 286 Back     alignment and structure
>pdb|3DFA|A Chain A, Crystal Structure Of Kinase Domain Of Calcium-dependent Protein Kinase Cgd3_920 From Cryptosporidium Parvum Length = 286 Back     alignment and structure
>pdb|1PHK|A Chain A, Two Structures Of The Catalytic Domain Of Phosphorylase, Kinase: An Active Protein Kinase Complexed With Nucleotide, Substrate-Analogue And Product Length = 298 Back     alignment and structure
>pdb|1PHK|A Chain A, Two Structures Of The Catalytic Domain Of Phosphorylase, Kinase: An Active Protein Kinase Complexed With Nucleotide, Substrate-Analogue And Product Length = 298 Back     alignment and structure
>pdb|4A4X|A Chain A, Nek2-Ede Bound To Cct248662 Length = 279 Back     alignment and structure
>pdb|4A4X|A Chain A, Nek2-Ede Bound To Cct248662 Length = 279 Back     alignment and structure
>pdb|2WEI|A Chain A, Crystal Structure Of The Kinase Domain Of Cryptosporidium Parvum Calcium Dependent Protein Kinase In Complex With 3- Mb-Pp1 Length = 287 Back     alignment and structure
>pdb|2WEI|A Chain A, Crystal Structure Of The Kinase Domain Of Cryptosporidium Parvum Calcium Dependent Protein Kinase In Complex With 3- Mb-Pp1 Length = 287 Back     alignment and structure
>pdb|2UZT|A Chain A, Pka Structures Of Akt, Indazole-Pyridine Inhibitors Length = 336 Back     alignment and structure
>pdb|2UZT|A Chain A, Pka Structures Of Akt, Indazole-Pyridine Inhibitors Length = 336 Back     alignment and structure
>pdb|4DFY|A Chain A, Crystal Structure Of R194a Mutant Of Camp-Dependent Protein Kinase With Unphosphorylated Activation Loop Length = 371 Back     alignment and structure
>pdb|4DFY|A Chain A, Crystal Structure Of R194a Mutant Of Camp-Dependent Protein Kinase With Unphosphorylated Activation Loop Length = 371 Back     alignment and structure
>pdb|2F7E|E Chain E, Pka Complexed With (S)-2-(1h-Indol-3-Yl)-1-(5-Isoquinolin-6- Yl-Pyridin-3-Yloxymethyl-Etylamine Length = 351 Back     alignment and structure
>pdb|2F7E|E Chain E, Pka Complexed With (S)-2-(1h-Indol-3-Yl)-1-(5-Isoquinolin-6- Yl-Pyridin-3-Yloxymethyl-Etylamine Length = 351 Back     alignment and structure
>pdb|2PHK|A Chain A, The Crystal Structure Of A Phosphorylase Kinase Peptide Substrate Complex: Kinase Substrate Recognition Length = 277 Back     alignment and structure
>pdb|2PHK|A Chain A, The Crystal Structure Of A Phosphorylase Kinase Peptide Substrate Complex: Kinase Substrate Recognition Length = 277 Back     alignment and structure
>pdb|2W4O|A Chain A, Crystal Structure Of Human Camk4 In Complex With 4-Amino( Sulfamoyl-Phenylamino)-Triazole-Carbothioic Acid (2,6- Difluoro-Phenyl)-Amide) Length = 349 Back     alignment and structure
>pdb|2W4O|A Chain A, Crystal Structure Of Human Camk4 In Complex With 4-Amino( Sulfamoyl-Phenylamino)-Triazole-Carbothioic Acid (2,6- Difluoro-Phenyl)-Amide) Length = 349 Back     alignment and structure
>pdb|3KU2|A Chain A, Crystal Structure Of Inactivated Form Of Cdpk1 From Toxoplasma Gondii, Tgme49.101440 Length = 507 Back     alignment and structure
>pdb|3KU2|A Chain A, Crystal Structure Of Inactivated Form Of Cdpk1 From Toxoplasma Gondii, Tgme49.101440 Length = 507 Back     alignment and structure
>pdb|3HX4|A Chain A, Crystal Structure Of Cdpk1 Of Toxoplasma Gondii, Tgme49_101440, In Presence Of Calcium Length = 508 Back     alignment and structure
>pdb|3HX4|A Chain A, Crystal Structure Of Cdpk1 Of Toxoplasma Gondii, Tgme49_101440, In Presence Of Calcium Length = 508 Back     alignment and structure
>pdb|3I79|A Chain A, Calcium-Dependent Protein Kinase 1 From Toxoplasma Gondii (Tgcdpk1) Length = 484 Back     alignment and structure
>pdb|3I79|A Chain A, Calcium-Dependent Protein Kinase 1 From Toxoplasma Gondii (Tgcdpk1) Length = 484 Back     alignment and structure
>pdb|2I0E|A Chain A, Structure Of Catalytic Domain Of Human Protein Kinase C Beta Ii Complexed With A Bisindolylmaleimide Inhibitor Length = 353 Back     alignment and structure
>pdb|2I0E|A Chain A, Structure Of Catalytic Domain Of Human Protein Kinase C Beta Ii Complexed With A Bisindolylmaleimide Inhibitor Length = 353 Back     alignment and structure
>pdb|3PFQ|A Chain A, Crystal Structure And Allosteric Activation Of Protein Kinase C Beta Ii Length = 674 Back     alignment and structure
>pdb|3PFQ|A Chain A, Crystal Structure And Allosteric Activation Of Protein Kinase C Beta Ii Length = 674 Back     alignment and structure
>pdb|3MA6|A Chain A, Crystal Structure Of Kinase Domain Of Tgcdpk1 In Presence Of 3brb-Pp1 Length = 298 Back     alignment and structure
>pdb|3MA6|A Chain A, Crystal Structure Of Kinase Domain Of Tgcdpk1 In Presence Of 3brb-Pp1 Length = 298 Back     alignment and structure
>pdb|2C30|A Chain A, Crystal Structure Of The Human P21-Activated Kinase 6 Length = 321 Back     alignment and structure
>pdb|2C30|A Chain A, Crystal Structure Of The Human P21-Activated Kinase 6 Length = 321 Back     alignment and structure
>pdb|2Y7J|A Chain A, Structure Of Human Phosphorylase Kinase, Gamma 2 Length = 365 Back     alignment and structure
>pdb|2Y7J|A Chain A, Structure Of Human Phosphorylase Kinase, Gamma 2 Length = 365 Back     alignment and structure
>pdb|1VZO|A Chain A, The Structure Of The N-Terminal Kinase Domain Of Msk1 Reveals A Novel Autoinhibitory Conformation For A Dual Kinase Protein Length = 355 Back     alignment and structure
>pdb|1VZO|A Chain A, The Structure Of The N-Terminal Kinase Domain Of Msk1 Reveals A Novel Autoinhibitory Conformation For A Dual Kinase Protein Length = 355 Back     alignment and structure
>pdb|3UIU|A Chain A, Crystal Structure Of Apo-Pkr Kinase Domain Length = 306 Back     alignment and structure
>pdb|3I7C|A Chain A, Calcium-Dependent Protein Kinase 1 From Toxoplasma Gondii (Tgcdpk1) In Complex With Bumped Kinase Inhibitor Na-Pp2 Length = 484 Back     alignment and structure
>pdb|3I7C|A Chain A, Calcium-Dependent Protein Kinase 1 From Toxoplasma Gondii (Tgcdpk1) In Complex With Bumped Kinase Inhibitor Na-Pp2 Length = 484 Back     alignment and structure
>pdb|1YDT|E Chain E, Structure Of Camp-Dependent Protein Kinase, Alpha-Catalytic Subunit In Complex With H89 Protein Kinase Inhibitor N-[2- (4-Bromocinnamylamino)ethyl]-5-Isoquinoline Length = 350 Back     alignment and structure
>pdb|1YDT|E Chain E, Structure Of Camp-Dependent Protein Kinase, Alpha-Catalytic Subunit In Complex With H89 Protein Kinase Inhibitor N-[2- (4-Bromocinnamylamino)ethyl]-5-Isoquinoline Length = 350 Back     alignment and structure
>pdb|4AE9|A Chain A, Structure And Function Of The Human Sperm-specific Isoform Of Protein Kinase A (pka) Catalytic Subunit C Alpha 2 Length = 343 Back     alignment and structure
>pdb|4AE9|A Chain A, Structure And Function Of The Human Sperm-specific Isoform Of Protein Kinase A (pka) Catalytic Subunit C Alpha 2 Length = 343 Back     alignment and structure
>pdb|4AE6|A Chain A, Structure And Function Of The Human Sperm-specific Isoform Of Protein Kinase A (pka) Catalytic Subunit Calpha 2 Length = 343 Back     alignment and structure
>pdb|4AE6|A Chain A, Structure And Function Of The Human Sperm-specific Isoform Of Protein Kinase A (pka) Catalytic Subunit Calpha 2 Length = 343 Back     alignment and structure
>pdb|1SYK|A Chain A, Crystal Structure Of E230q Mutant Of Camp-Dependent Protein Kinase Reveals Unexpected Apoenzyme Conformation Length = 350 Back     alignment and structure
>pdb|1SYK|A Chain A, Crystal Structure Of E230q Mutant Of Camp-Dependent Protein Kinase Reveals Unexpected Apoenzyme Conformation Length = 350 Back     alignment and structure
>pdb|4APC|A Chain A, Crystal Structure Of Human Nima-Related Kinase 1 (Nek1) Length = 350 Back     alignment and structure
>pdb|4APC|A Chain A, Crystal Structure Of Human Nima-Related Kinase 1 (Nek1) Length = 350 Back     alignment and structure
>pdb|3NX8|A Chain A, Human Camp Dependent Protein Kinase In Complex With Phenol Length = 351 Back     alignment and structure
>pdb|3NX8|A Chain A, Human Camp Dependent Protein Kinase In Complex With Phenol Length = 351 Back     alignment and structure
>pdb|1Q24|A Chain A, Pka Double Mutant Model Of Pkb In Complex With Mgatp Length = 350 Back     alignment and structure
>pdb|1Q24|A Chain A, Pka Double Mutant Model Of Pkb In Complex With Mgatp Length = 350 Back     alignment and structure
>pdb|1CTP|E Chain E, Structure Of The Mammalian Catalytic Subunit Of Camp-Dependent Protein Kinase And An Inhibitor Peptide Displays An Open Conformation Length = 350 Back     alignment and structure
>pdb|1CTP|E Chain E, Structure Of The Mammalian Catalytic Subunit Of Camp-Dependent Protein Kinase And An Inhibitor Peptide Displays An Open Conformation Length = 350 Back     alignment and structure
>pdb|3AGM|A Chain A, Complex Of Pka With The Bisubstrate Protein Kinase Inhibitor Arc-670 Length = 351 Back     alignment and structure
>pdb|3AGM|A Chain A, Complex Of Pka With The Bisubstrate Protein Kinase Inhibitor Arc-670 Length = 351 Back     alignment and structure
>pdb|2GNG|A Chain A, Protein Kinase A Fivefold Mutant Model Of Rho-Kinase Length = 350 Back     alignment and structure
>pdb|2GNG|A Chain A, Protein Kinase A Fivefold Mutant Model Of Rho-Kinase Length = 350 Back     alignment and structure
>pdb|1CDK|A Chain A, Camp-Dependent Protein Kinase Catalytic Subunit (E.C.2.7.1.37) (Protein Kinase A) Complexed With Protein Kinase Inhibitor Peptide Fragment 5-24 (Pki(5-24) Isoelectric Variant Ca) And Mn2+ Adenylyl Imidodiphosphate (Mnamp-Pnp) At Ph 5.6 And 7c And 4c Length = 350 Back     alignment and structure
>pdb|1CDK|A Chain A, Camp-Dependent Protein Kinase Catalytic Subunit (E.C.2.7.1.37) (Protein Kinase A) Complexed With Protein Kinase Inhibitor Peptide Fragment 5-24 (Pki(5-24) Isoelectric Variant Ca) And Mn2+ Adenylyl Imidodiphosphate (Mnamp-Pnp) At Ph 5.6 And 7c And 4c Length = 350 Back     alignment and structure
>pdb|3O7L|B Chain B, Crystal Structure Of Phospholamban (1-19):pka C-Subunit:amp-Pnp:mg2+ Complex Length = 350 Back     alignment and structure
>pdb|3O7L|B Chain B, Crystal Structure Of Phospholamban (1-19):pka C-Subunit:amp-Pnp:mg2+ Complex Length = 350 Back     alignment and structure
>pdb|3DND|A Chain A, Camp-Dependent Protein Kinase Pka Catalytic Subunit With Pki-5-24 Length = 350 Back     alignment and structure
>pdb|3DND|A Chain A, Camp-Dependent Protein Kinase Pka Catalytic Subunit With Pki-5-24 Length = 350 Back     alignment and structure
>pdb|2GNJ|A Chain A, Pka Three Fold Mutant Model Of Rho-Kinase With Y-27632 Length = 350 Back     alignment and structure
>pdb|2GNJ|A Chain A, Pka Three Fold Mutant Model Of Rho-Kinase With Y-27632 Length = 350 Back     alignment and structure
>pdb|4DG3|E Chain E, Crystal Structure Of R336a Mutant Of Camp-dependent Protein Kinase With Unphosphorylated Turn Motif Length = 371 Back     alignment and structure
>pdb|4DG3|E Chain E, Crystal Structure Of R336a Mutant Of Camp-dependent Protein Kinase With Unphosphorylated Turn Motif Length = 371 Back     alignment and structure
>pdb|1SVH|A Chain A, Crystal Structure Of Protein Kinase A In Complex With Azepane Derivative 8 Length = 350 Back     alignment and structure
>pdb|1SVH|A Chain A, Crystal Structure Of Protein Kinase A In Complex With Azepane Derivative 8 Length = 350 Back     alignment and structure
>pdb|4DFX|E Chain E, Crystal Structure Of Myristoylated K7c Catalytic Subunit Of Camp- Dependent Protein Kinase In Complex With Sp20 And Amp-Pnp Length = 350 Back     alignment and structure
>pdb|4DFX|E Chain E, Crystal Structure Of Myristoylated K7c Catalytic Subunit Of Camp- Dependent Protein Kinase In Complex With Sp20 And Amp-Pnp Length = 350 Back     alignment and structure
>pdb|3AGL|A Chain A, Complex Of Pka With The Bisubstrate Protein Kinase Inhibitor Arc-1039 Length = 351 Back     alignment and structure
>pdb|3AGL|A Chain A, Complex Of Pka With The Bisubstrate Protein Kinase Inhibitor Arc-1039 Length = 351 Back     alignment and structure
>pdb|2GU8|A Chain A, Discovery Of 2-pyrimidyl-5-amidothiophenes As Novel And Potent Inhibitors For Akt: Synthesis And Sar Studies Length = 337 Back     alignment and structure
>pdb|2GU8|A Chain A, Discovery Of 2-pyrimidyl-5-amidothiophenes As Novel And Potent Inhibitors For Akt: Synthesis And Sar Studies Length = 337 Back     alignment and structure
>pdb|2GNF|A Chain A, Protein Kinase A Fivefold Mutant Model Of Rho-Kinase With Y- 27632 Length = 350 Back     alignment and structure
>pdb|2GNF|A Chain A, Protein Kinase A Fivefold Mutant Model Of Rho-Kinase With Y- 27632 Length = 350 Back     alignment and structure
>pdb|2C1A|A Chain A, Structure Of Camp-Dependent Protein Kinase Complexed With Isoquinoline-5-Sulfonic Acid (2-(2-(4-Chlorobenzyloxy) Ethylamino)ethyl)amide Length = 351 Back     alignment and structure
>pdb|2C1A|A Chain A, Structure Of Camp-Dependent Protein Kinase Complexed With Isoquinoline-5-Sulfonic Acid (2-(2-(4-Chlorobenzyloxy) Ethylamino)ethyl)amide Length = 351 Back     alignment and structure
>pdb|2ERZ|E Chain E, Crystal Structure Of C-amp Dependent Kinase (pka) Bound To Hydroxyfasudil Length = 351 Back     alignment and structure
>pdb|2ERZ|E Chain E, Crystal Structure Of C-amp Dependent Kinase (pka) Bound To Hydroxyfasudil Length = 351 Back     alignment and structure
>pdb|1Q61|A Chain A, Pka Triple Mutant Model Of Pkb Length = 350 Back     alignment and structure
>pdb|1Q61|A Chain A, Pka Triple Mutant Model Of Pkb Length = 350 Back     alignment and structure
>pdb|1L3R|E Chain E, Crystal Structure Of A Transition State Mimic Of The Catalytic Subunit Of Camp-Dependent Protein Kinase Length = 350 Back     alignment and structure
>pdb|1L3R|E Chain E, Crystal Structure Of A Transition State Mimic Of The Catalytic Subunit Of Camp-Dependent Protein Kinase Length = 350 Back     alignment and structure
>pdb|3L9M|A Chain A, Crystal Structure Of Pkab3 (Pka Triple Mutant V123a, L173m, Q181k) With Compound 18 Length = 351 Back     alignment and structure
>pdb|3L9M|A Chain A, Crystal Structure Of Pkab3 (Pka Triple Mutant V123a, L173m, Q181k) With Compound 18 Length = 351 Back     alignment and structure
>pdb|1FMO|E Chain E, Crystal Structure Of A Polyhistidine-Tagged Recombinant Catalytic Subunit Of Camp-Dependent Protein Kinase Complexed With The Peptide Inhibitor Pki(5-24) And Adenosine Length = 350 Back     alignment and structure
>pdb|1FMO|E Chain E, Crystal Structure Of A Polyhistidine-Tagged Recombinant Catalytic Subunit Of Camp-Dependent Protein Kinase Complexed With The Peptide Inhibitor Pki(5-24) And Adenosine Length = 350 Back     alignment and structure
>pdb|3AMA|A Chain A, Protein Kinase A Sixfold Mutant Model Of Aurora B With Inhibitor Jnj- 7706621 Length = 351 Back     alignment and structure
>pdb|3AMA|A Chain A, Protein Kinase A Sixfold Mutant Model Of Aurora B With Inhibitor Jnj- 7706621 Length = 351 Back     alignment and structure
>pdb|2QCS|A Chain A, A Complex Structure Between The Catalytic And Regulatory Subunit Of Protein Kinase A That Represents The Inhibited State Length = 350 Back     alignment and structure
>pdb|2QCS|A Chain A, A Complex Structure Between The Catalytic And Regulatory Subunit Of Protein Kinase A That Represents The Inhibited State Length = 350 Back     alignment and structure
>pdb|2JDT|A Chain A, Structure Of Pka-Pkb Chimera Complexed With Isoquinoline-5- Sulfonic Acid (2-(2-(4-Chlorobenzyloxy) Ethylamino)ethyl) Amide Length = 351 Back     alignment and structure
>pdb|2JDT|A Chain A, Structure Of Pka-Pkb Chimera Complexed With Isoquinoline-5- Sulfonic Acid (2-(2-(4-Chlorobenzyloxy) Ethylamino)ethyl) Amide Length = 351 Back     alignment and structure
>pdb|1BKX|A Chain A, A Binary Complex Of The Catalytic Subunit Of Camp-Dependent Protein Kinase And Adenosine Further Defines Conformational Flexibility Length = 350 Back     alignment and structure
>pdb|1BKX|A Chain A, A Binary Complex Of The Catalytic Subunit Of Camp-Dependent Protein Kinase And Adenosine Further Defines Conformational Flexibility Length = 350 Back     alignment and structure
>pdb|1SMH|A Chain A, Protein Kinase A Variant Complex With Completely Ordered N- Terminal Helix Length = 350 Back     alignment and structure
>pdb|1SMH|A Chain A, Protein Kinase A Variant Complex With Completely Ordered N- Terminal Helix Length = 350 Back     alignment and structure
>pdb|1SZM|A Chain A, Dual Binding Mode Of Bisindolylmaleimide 2 To Protein Kinase A (Pka) Length = 350 Back     alignment and structure
>pdb|1SZM|A Chain A, Dual Binding Mode Of Bisindolylmaleimide 2 To Protein Kinase A (Pka) Length = 350 Back     alignment and structure
>pdb|3PVB|A Chain A, Crystal Structure Of (73-244)ria:c Holoenzyme Of Camp-Dependent Protein Kinase Length = 345 Back     alignment and structure
>pdb|3PVB|A Chain A, Crystal Structure Of (73-244)ria:c Holoenzyme Of Camp-Dependent Protein Kinase Length = 345 Back     alignment and structure
>pdb|3MVJ|A Chain A, Human Cyclic Amp-Dependent Protein Kinase Pka Inhibitor Complex Length = 371 Back     alignment and structure
>pdb|3MVJ|A Chain A, Human Cyclic Amp-Dependent Protein Kinase Pka Inhibitor Complex Length = 371 Back     alignment and structure
>pdb|1CMK|E Chain E, Crystal Structures Of The Myristylated Catalytic Subunit Of Camp- Dependent Protein Kinase Reveal Open And Closed Conformations Length = 350 Back     alignment and structure
>pdb|1CMK|E Chain E, Crystal Structures Of The Myristylated Catalytic Subunit Of Camp- Dependent Protein Kinase Reveal Open And Closed Conformations Length = 350 Back     alignment and structure
>pdb|1APM|E Chain E, 2.0 Angstrom Refined Crystal Structure Of The Catalytic Subunit Of Camp-Dependent Protein Kinase Complexed With A Peptide Inhibitor And Detergent Length = 350 Back     alignment and structure
>pdb|1APM|E Chain E, 2.0 Angstrom Refined Crystal Structure Of The Catalytic Subunit Of Camp-Dependent Protein Kinase Complexed With A Peptide Inhibitor And Detergent Length = 350 Back     alignment and structure
>pdb|2QUR|A Chain A, Crystal Structure Of F327aK285P MUTANT OF CAMP-Dependent Protein Kinase Length = 350 Back     alignment and structure
>pdb|2QUR|A Chain A, Crystal Structure Of F327aK285P MUTANT OF CAMP-Dependent Protein Kinase Length = 350 Back     alignment and structure
>pdb|2VO0|A Chain A, Structure Of Pka-Pkb Chimera Complexed With C-(4-(4- Chlorophenyl)-1-(7h-Pyrrolo(2, 3-D)pyrimidin-4-Yl)piperidin- 4-Yl)methylamine Length = 351 Back     alignment and structure
>pdb|2VO0|A Chain A, Structure Of Pka-Pkb Chimera Complexed With C-(4-(4- Chlorophenyl)-1-(7h-Pyrrolo(2, 3-D)pyrimidin-4-Yl)piperidin- 4-Yl)methylamine Length = 351 Back     alignment and structure
>pdb|2UVY|A Chain A, Structure Of Pka-pkb Chimera Complexed With Methyl-(4-(9h- Purin-6-yl)-benzyl)-amine Length = 351 Back     alignment and structure
>pdb|2UVY|A Chain A, Structure Of Pka-pkb Chimera Complexed With Methyl-(4-(9h- Purin-6-yl)-benzyl)-amine Length = 351 Back     alignment and structure
>pdb|1XH7|A Chain A, Crystal Structures Of Protein Kinase B Selective Inhibitors In Complex With Protein Kinase A And Mutants Length = 350 Back     alignment and structure
>pdb|1XH7|A Chain A, Crystal Structures Of Protein Kinase B Selective Inhibitors In Complex With Protein Kinase A And Mutants Length = 350 Back     alignment and structure
>pdb|1Q8W|A Chain A, The Catalytic Subunit Of Camp-Dependent Protein Kinase In Complex With Rho-Kinase Inhibitor Fasudil (Ha-1077) Length = 350 Back     alignment and structure
>pdb|1Q8W|A Chain A, The Catalytic Subunit Of Camp-Dependent Protein Kinase In Complex With Rho-Kinase Inhibitor Fasudil (Ha-1077) Length = 350 Back     alignment and structure
>pdb|2JDS|A Chain A, Structure Of Camp-Dependent Protein Kinase Complexed With A- 443654 Length = 351 Back     alignment and structure
>pdb|2JDS|A Chain A, Structure Of Camp-Dependent Protein Kinase Complexed With A- 443654 Length = 351 Back     alignment and structure
>pdb|1STC|E Chain E, Camp-Dependent Protein Kinase, Alpha-Catalytic Subunit In Complex With Staurosporine Length = 350 Back     alignment and structure
>pdb|1STC|E Chain E, Camp-Dependent Protein Kinase, Alpha-Catalytic Subunit In Complex With Staurosporine Length = 350 Back     alignment and structure
>pdb|1XH9|A Chain A, Crystal Structures Of Protein Kinase B Selective Inhibitors In Complex With Protein Kinase A And Mutants Length = 350 Back     alignment and structure
>pdb|1XH9|A Chain A, Crystal Structures Of Protein Kinase B Selective Inhibitors In Complex With Protein Kinase A And Mutants Length = 350 Back     alignment and structure
>pdb|1JBP|E Chain E, Crystal Structure Of The Catalytic Subunit Of Camp- Dependent Protein Kinase Complexed With A Substrate Peptide, Adp And Detergent Length = 350 Back     alignment and structure
>pdb|1JBP|E Chain E, Crystal Structure Of The Catalytic Subunit Of Camp- Dependent Protein Kinase Complexed With A Substrate Peptide, Adp And Detergent Length = 350 Back     alignment and structure
>pdb|3MFR|A Chain A, Cask-4m Cam Kinase Domain, Native Length = 351 Back     alignment and structure
>pdb|3MFR|A Chain A, Cask-4m Cam Kinase Domain, Native Length = 351 Back     alignment and structure
>pdb|4FSN|A Chain A, Crystal Structure Of The Chk1 Length = 278 Back     alignment and structure
>pdb|4FSN|A Chain A, Crystal Structure Of The Chk1 Length = 278 Back     alignment and structure
>pdb|4FSU|A Chain A, Crystal Structure Of The Chk1 Length = 279 Back     alignment and structure
>pdb|4FSU|A Chain A, Crystal Structure Of The Chk1 Length = 279 Back     alignment and structure
>pdb|2X8E|A Chain A, Discovery Of A Novel Class Of Triazolones As Checkpoint Kinase Inhibitors - Hit To Lead Exploration Length = 276 Back     alignment and structure
>pdb|2X8E|A Chain A, Discovery Of A Novel Class Of Triazolones As Checkpoint Kinase Inhibitors - Hit To Lead Exploration Length = 276 Back     alignment and structure
>pdb|2BR1|A Chain A, Structure-Based Design Of Novel Chk1 Inhibitors: Insights Into Hydrogen Bonding And Protein-Ligand Affinity Length = 297 Back     alignment and structure
>pdb|2BR1|A Chain A, Structure-Based Design Of Novel Chk1 Inhibitors: Insights Into Hydrogen Bonding And Protein-Ligand Affinity Length = 297 Back     alignment and structure
>pdb|1IA8|A Chain A, The 1.7 A Crystal Structure Of Human Cell Cycle Checkpoint Kinase Chk1 Length = 289 Back     alignment and structure
>pdb|1IA8|A Chain A, The 1.7 A Crystal Structure Of Human Cell Cycle Checkpoint Kinase Chk1 Length = 289 Back     alignment and structure
>pdb|1ZLT|A Chain A, Crystal Structure Of Chk1 Complexed With A Hymenaldisine Analog Length = 295 Back     alignment and structure
>pdb|1ZLT|A Chain A, Crystal Structure Of Chk1 Complexed With A Hymenaldisine Analog Length = 295 Back     alignment and structure
>pdb|4FSM|A Chain A, Crystal Structure Of The Chk1 Length = 279 Back     alignment and structure
>pdb|4FSM|A Chain A, Crystal Structure Of The Chk1 Length = 279 Back     alignment and structure
>pdb|4FSY|A Chain A, Crystal Structure Of The Chk1 Length = 279 Back     alignment and structure
>pdb|4FSY|A Chain A, Crystal Structure Of The Chk1 Length = 279 Back     alignment and structure
>pdb|2HOG|A Chain A, Crystal Structure Of Chek1 In Complex With Inhibitor 20 Length = 322 Back     alignment and structure
>pdb|2HOG|A Chain A, Crystal Structure Of Chek1 In Complex With Inhibitor 20 Length = 322 Back     alignment and structure
>pdb|2R0U|A Chain A, Crystal Structure Of Chek1 In Complex With Inhibitor 54 Length = 323 Back     alignment and structure
>pdb|2R0U|A Chain A, Crystal Structure Of Chek1 In Complex With Inhibitor 54 Length = 323 Back     alignment and structure
>pdb|3OT3|A Chain A, X-Ray Crystal Structure Of Compound 22k Bound To Human Chk1 Kinase Domain Length = 273 Back     alignment and structure
>pdb|3OT3|A Chain A, X-Ray Crystal Structure Of Compound 22k Bound To Human Chk1 Kinase Domain Length = 273 Back     alignment and structure
>pdb|3JVR|A Chain A, Characterization Of The Chk1 Allosteric Inhibitor Binding Site Length = 271 Back     alignment and structure
>pdb|3JVR|A Chain A, Characterization Of The Chk1 Allosteric Inhibitor Binding Site Length = 271 Back     alignment and structure
>pdb|4FIF|A Chain A, Catalytic Domain Of Human Pak4 With Rpkplvdp Peptide Length = 346 Back     alignment and structure
>pdb|4FIF|A Chain A, Catalytic Domain Of Human Pak4 With Rpkplvdp Peptide Length = 346 Back     alignment and structure
>pdb|2GHG|A Chain A, H-Chk1 Complexed With A431994 Length = 269 Back     alignment and structure
>pdb|2GHG|A Chain A, H-Chk1 Complexed With A431994 Length = 269 Back     alignment and structure
>pdb|2CDZ|A Chain A, Crystal Structure Of The Human P21-Activated Kinase 4 In Complex With Cgp74514a Length = 303 Back     alignment and structure
>pdb|2CDZ|A Chain A, Crystal Structure Of The Human P21-Activated Kinase 4 In Complex With Cgp74514a Length = 303 Back     alignment and structure
>pdb|2E9V|A Chain A, Structure Of H-Chk1 Complexed With A859017 Length = 268 Back     alignment and structure
>pdb|2E9V|A Chain A, Structure Of H-Chk1 Complexed With A859017 Length = 268 Back     alignment and structure
>pdb|2AYP|A Chain A, Crystal Structure Of Chk1 With An Indol Inhibitor Length = 269 Back     alignment and structure
>pdb|2AYP|A Chain A, Crystal Structure Of Chk1 With An Indol Inhibitor Length = 269 Back     alignment and structure
>pdb|4FIE|A Chain A, Full-Length Human Pak4 Length = 423 Back     alignment and structure
>pdb|4FIE|A Chain A, Full-Length Human Pak4 Length = 423 Back     alignment and structure
>pdb|2Q0N|A Chain A, Structure Of Human P21 Activating Kinase 4 (Pak4) In Complex With A Consensus Peptide Length = 301 Back     alignment and structure
>pdb|2Q0N|A Chain A, Structure Of Human P21 Activating Kinase 4 (Pak4) In Complex With A Consensus Peptide Length = 301 Back     alignment and structure
>pdb|3QAL|E Chain E, Crystal Structure Of Arg280ala Mutant Of Catalytic Subunit Of Camp- Dependent Protein Kinase Length = 350 Back     alignment and structure
>pdb|3QAL|E Chain E, Crystal Structure Of Arg280ala Mutant Of Catalytic Subunit Of Camp- Dependent Protein Kinase Length = 350 Back     alignment and structure
>pdb|2X4Z|A Chain A, Crystal Structure Of The Human P21-Activated Kinase 4 In Complex With Pf-03758309 Length = 296 Back     alignment and structure
>pdb|2X4Z|A Chain A, Crystal Structure Of The Human P21-Activated Kinase 4 In Complex With Pf-03758309 Length = 296 Back     alignment and structure
>pdb|2BVA|A Chain A, Crystal Structure Of The Human P21-Activated Kinase 4 Length = 292 Back     alignment and structure
>pdb|2BVA|A Chain A, Crystal Structure Of The Human P21-Activated Kinase 4 Length = 292 Back     alignment and structure
>pdb|2ZV2|A Chain A, Crystal Structure Of Human CalciumCALMODULIN-Dependent Protein Kinase Kinase 2, Beta, Camkk2 Kinase Domain In Complex With Sto-609 Length = 298 Back     alignment and structure
>pdb|3QAM|E Chain E, Crystal Structure Of Glu208ala Mutant Of Catalytic Subunit Of Camp- Dependent Protein Kinase Length = 350 Back     alignment and structure
>pdb|3QAM|E Chain E, Crystal Structure Of Glu208ala Mutant Of Catalytic Subunit Of Camp- Dependent Protein Kinase Length = 350 Back     alignment and structure
>pdb|2JBO|A Chain A, Protein Kinase Mk2 In Complex With An Inhibitor (Crystal Form-1, Soaking) Length = 326 Back     alignment and structure
>pdb|2JBO|A Chain A, Protein Kinase Mk2 In Complex With An Inhibitor (Crystal Form-1, Soaking) Length = 326 Back     alignment and structure
>pdb|2P3G|X Chain X, Crystal Structure Of A Pyrrolopyridine Inhibitor Bound To Mapkap Kinase-2 Length = 327 Back     alignment and structure
>pdb|2P3G|X Chain X, Crystal Structure Of A Pyrrolopyridine Inhibitor Bound To Mapkap Kinase-2 Length = 327 Back     alignment and structure
>pdb|2PZY|A Chain A, Structure Of Mk2 Complexed With Compound 76 Length = 324 Back     alignment and structure
>pdb|2PZY|A Chain A, Structure Of Mk2 Complexed With Compound 76 Length = 324 Back     alignment and structure
>pdb|1ZYS|A Chain A, Co-Crystal Structure Of Checkpoint Kinase Chk1 With A Pyrrolo-Pyridine Inhibitor Length = 273 Back     alignment and structure
>pdb|1ZYS|A Chain A, Co-Crystal Structure Of Checkpoint Kinase Chk1 With A Pyrrolo-Pyridine Inhibitor Length = 273 Back     alignment and structure
>pdb|3TAC|A Chain A, Crystal Structure Of The Liprin-AlphaCASK COMPLEX Length = 361 Back     alignment and structure
>pdb|3TAC|A Chain A, Crystal Structure Of The Liprin-AlphaCASK COMPLEX Length = 361 Back     alignment and structure
>pdb|2A19|B Chain B, Pkr Kinase Domain- Eif2alpha- Amp-Pnp Complex. Length = 284 Back     alignment and structure
>pdb|1KWP|A Chain A, Crystal Structure Of Mapkap2 Length = 400 Back     alignment and structure
>pdb|1KWP|A Chain A, Crystal Structure Of Mapkap2 Length = 400 Back     alignment and structure
>pdb|2ONL|C Chain C, Crystal Structure Of The P38a-Mapkap Kinase 2 Heterodimer Length = 406 Back     alignment and structure
>pdb|2ONL|C Chain C, Crystal Structure Of The P38a-Mapkap Kinase 2 Heterodimer Length = 406 Back     alignment and structure
>pdb|3R2Y|A Chain A, Mk2 Kinase Bound To Compound 1 Length = 319 Back     alignment and structure
>pdb|3R2Y|A Chain A, Mk2 Kinase Bound To Compound 1 Length = 319 Back     alignment and structure
>pdb|3FPM|A Chain A, Crystal Structure Of A Squarate Inhibitor Bound To Mapkap Kinase-2 Length = 325 Back     alignment and structure
>pdb|3FPM|A Chain A, Crystal Structure Of A Squarate Inhibitor Bound To Mapkap Kinase-2 Length = 325 Back     alignment and structure
>pdb|3GOK|A Chain A, Binding Site Mapping Of Protein Ligands Length = 334 Back     alignment and structure
>pdb|3GOK|A Chain A, Binding Site Mapping Of Protein Ligands Length = 334 Back     alignment and structure
>pdb|2OZA|A Chain A, Structure Of P38alpha Complex Length = 356 Back     alignment and structure
>pdb|2OZA|A Chain A, Structure Of P38alpha Complex Length = 356 Back     alignment and structure
>pdb|3R2B|A Chain A, Mk2 Kinase Bound To Compound 5b Length = 318 Back     alignment and structure
>pdb|3R2B|A Chain A, Mk2 Kinase Bound To Compound 5b Length = 318 Back     alignment and structure
>pdb|3C0G|A Chain A, Cask Cam-kinase Domain- 3'-amp Complex, P1 Form Length = 351 Back     alignment and structure
>pdb|3C0G|A Chain A, Cask Cam-kinase Domain- 3'-amp Complex, P1 Form Length = 351 Back     alignment and structure
>pdb|3KA0|A Chain A, Mk2 Complex With Inhibitor 6-(5-(2-Aminopyrimidin-4-Ylamino)-2- Hydroxyphenyl)-N-Methylbenzo[b]thiophene-2-Carboxamide Length = 320 Back     alignment and structure
>pdb|3KA0|A Chain A, Mk2 Complex With Inhibitor 6-(5-(2-Aminopyrimidin-4-Ylamino)-2- Hydroxyphenyl)-N-Methylbenzo[b]thiophene-2-Carboxamide Length = 320 Back     alignment and structure
>pdb|3LM0|A Chain A, Crystal Structure Of Human SerineTHREONINE KINASE 17B (STK17B) Length = 327 Back     alignment and structure
>pdb|3LM0|A Chain A, Crystal Structure Of Human SerineTHREONINE KINASE 17B (STK17B) Length = 327 Back     alignment and structure
>pdb|1RDQ|E Chain E, Hydrolysis Of Atp In The Crystal Of Y204a Mutant Of Camp-Dependent Protein Kinase Length = 350 Back     alignment and structure
>pdb|1RDQ|E Chain E, Hydrolysis Of Atp In The Crystal Of Y204a Mutant Of Camp-Dependent Protein Kinase Length = 350 Back     alignment and structure
>pdb|3FHI|A Chain A, Crystal Structure Of A Complex Between The Catalytic And Regulatory (Ri{alpha}) Subunits Of Pka Length = 350 Back     alignment and structure
>pdb|3FHI|A Chain A, Crystal Structure Of A Complex Between The Catalytic And Regulatory (Ri{alpha}) Subunits Of Pka Length = 350 Back     alignment and structure
>pdb|2J51|A Chain A, Crystal Structure Of Human Ste20-Like Kinase Bound To 5- Amino-3-((4-(Aminosulfonyl)phenyl)amino)-N-(2,6- Difluorophenyl)-1h-1,2,4-Triazole-1-Carbothioamide Length = 325 Back     alignment and structure
>pdb|2JFM|A Chain A, Crystal Structure Of Human Ste20-Like Kinase (Unliganded Form) Length = 325 Back     alignment and structure
>pdb|2JFL|A Chain A, Crystal Structure Of Human Ste20-Like Kinase ( Diphosphorylated Form) Bound To 5- Amino-3-((4-( Aminosulfonyl)phenyl)amino)-N-(2,6- Difluorophenyl)-1h-1,2, 4-Triazole-1-Carbothioamide Length = 325 Back     alignment and structure
>pdb|1KOA|A Chain A, Twitchin Kinase Fragment (C.Elegans), Autoregulated Protein Kinase And Immunoglobulin Domains Length = 491 Back     alignment and structure
>pdb|4G31|A Chain A, Crystal Structure Of Gsk6414 Bound To Perk (R587-R1092, Delete A660- T867) At 2.28 A Resolution Length = 299 Back     alignment and structure
>pdb|4G31|A Chain A, Crystal Structure Of Gsk6414 Bound To Perk (R587-R1092, Delete A660- T867) At 2.28 A Resolution Length = 299 Back     alignment and structure
>pdb|3NYN|A Chain A, Crystal Structure Of G Protein-Coupled Receptor Kinase 6 In Complex With Sangivamycin Length = 576 Back     alignment and structure
>pdb|3NYN|A Chain A, Crystal Structure Of G Protein-Coupled Receptor Kinase 6 In Complex With Sangivamycin Length = 576 Back     alignment and structure
>pdb|2ACX|A Chain A, Crystal Structure Of G Protein Coupled Receptor Kinase 6 Bound To Amppnp Length = 576 Back     alignment and structure
>pdb|2ACX|A Chain A, Crystal Structure Of G Protein Coupled Receptor Kinase 6 Bound To Amppnp Length = 576 Back     alignment and structure
>pdb|3UTO|A Chain A, Twitchin Kinase Region From C.Elegans (Fn31-Nl-Kin-Crd-Ig26) Length = 573 Back     alignment and structure
>pdb|3UTO|A Chain A, Twitchin Kinase Region From C.Elegans (Fn31-Nl-Kin-Crd-Ig26) Length = 573 Back     alignment and structure
>pdb|2F57|A Chain A, Crystal Structure Of The Human P21-activated Kinase 5 Length = 317 Back     alignment and structure
>pdb|2F57|A Chain A, Crystal Structure Of The Human P21-activated Kinase 5 Length = 317 Back     alignment and structure
>pdb|1J3H|A Chain A, Crystal Structure Of Apoenzyme Camp-Dependent Protein Kinase Catalytic Subunit Length = 350 Back     alignment and structure
>pdb|1J3H|A Chain A, Crystal Structure Of Apoenzyme Camp-Dependent Protein Kinase Catalytic Subunit Length = 350 Back     alignment and structure
>pdb|4FT3|A Chain A, Crystal Structure Of The Chk1 Length = 279 Back     alignment and structure
>pdb|4FT3|A Chain A, Crystal Structure Of The Chk1 Length = 279 Back     alignment and structure
>pdb|2V55|A Chain A, Mechanism Of Multi-site Phosphorylation From A Rock-i:rhoe Complex Structure Length = 406 Back     alignment and structure
>pdb|2ESM|A Chain A, Crystal Structure Of Rock 1 Bound To Fasudil Length = 415 Back     alignment and structure
>pdb|3V8S|A Chain A, Human Rho-Associated Protein Kinase 1 (Rock 1) In Complex With Indazole Derivative (Compound 18) Length = 410 Back     alignment and structure
>pdb|1NXK|A Chain A, Crystal Structure Of Staurosporine Bound To Map Kap Kinase 2 Length = 400 Back     alignment and structure
>pdb|1NXK|A Chain A, Crystal Structure Of Staurosporine Bound To Map Kap Kinase 2 Length = 400 Back     alignment and structure
>pdb|2I6L|A Chain A, Crystal Structure Of Human Mitogen Activated Protein Kinase 6 (Mapk6) Length = 320 Back     alignment and structure
>pdb|4IC7|A Chain A, Crystal Structure Of The Erk5 Kinase Domain In Complex With An Mkk5 Binding Fragment Length = 442 Back     alignment and structure
>pdb|4FSW|A Chain A, Crystal Structure Of The Chk1 Length = 279 Back     alignment and structure
>pdb|4FSW|A Chain A, Crystal Structure Of The Chk1 Length = 279 Back     alignment and structure
>pdb|4B99|A Chain A, Crystal Structure Of Mapk7 (Erk5) With Inhibitor Length = 398 Back     alignment and structure
>pdb|2WQM|A Chain A, Structure Of Apo Human Nek7 Length = 310 Back     alignment and structure
>pdb|2WQM|A Chain A, Structure Of Apo Human Nek7 Length = 310 Back     alignment and structure
>pdb|1UA2|A Chain A, Crystal Structure Of Human Cdk7 Length = 346 Back     alignment and structure
>pdb|4FSZ|A Chain A, Crystal Structure Of The Chk1 Length = 279 Back     alignment and structure
>pdb|4FSZ|A Chain A, Crystal Structure Of The Chk1 Length = 279 Back     alignment and structure
>pdb|4FR4|A Chain A, Crystal Structure Of Human SerineTHREONINE-Protein Kinase 32a (Yank1) Length = 384 Back     alignment and structure
>pdb|2YDJ|A Chain A, Discovery Of Checkpoint Kinase Inhibitor Azd7762 By Structure Based Design And Optimization Of Thiophene Carboxamide Ureas Length = 276 Back     alignment and structure
>pdb|2YDJ|A Chain A, Discovery Of Checkpoint Kinase Inhibitor Azd7762 By Structure Based Design And Optimization Of Thiophene Carboxamide Ureas Length = 276 Back     alignment and structure
>pdb|3II5|A Chain A, The Complex Of Wild-Type B-Raf With Pyrazolo Pyrimidine Inhibitor Length = 306 Back     alignment and structure
>pdb|3C4C|A Chain A, B-Raf Kinase In Complex With Plx4720 Length = 280 Back     alignment and structure
>pdb|4FK3|A Chain A, B-Raf Kinase V600e Oncogenic Mutant In Complex With Plx3203 Length = 292 Back     alignment and structure
>pdb|3OG7|A Chain A, B-Raf Kinase V600e Oncogenic Mutant In Complex With Plx4032 Length = 289 Back     alignment and structure
>pdb|4G9R|A Chain A, B-Raf V600e Kinase Domain Bound To A Type Ii Dihydroquinazoline Inhibitor Length = 307 Back     alignment and structure
>pdb|3D4Q|A Chain A, Pyrazole-Based Inhibitors Of B-Raf Kinase Length = 307 Back     alignment and structure
>pdb|3IDP|A Chain A, B-Raf V600e Kinase Domain In Complex With An Aminoisoquinoline Inhibitor Length = 300 Back     alignment and structure
>pdb|4FST|A Chain A, Crystal Structure Of The Chk1 Length = 269 Back     alignment and structure
>pdb|4FST|A Chain A, Crystal Structure Of The Chk1 Length = 269 Back     alignment and structure
>pdb|3Q96|A Chain A, B-Raf Kinase Domain In Complex With A Tetrahydronaphthalene Inhibitor Length = 282 Back     alignment and structure
>pdb|2FB8|A Chain A, Structure Of The B-Raf Kinase Domain Bound To Sb-590885 Length = 281 Back     alignment and structure
>pdb|3NIZ|A Chain A, Cryptosporidium Parvum Cyclin-Dependent Kinase Cgd5_2510 With Adp Bound Length = 311 Back     alignment and structure
>pdb|1U5Q|A Chain A, Crystal Structure Of The Tao2 Kinase Domain: Activation And Specifity Of A Ste20p Map3k Length = 348 Back     alignment and structure
>pdb|4DBN|A Chain A, Crystal Structure Of The Kinase Domain Of Human B-Raf With A [1, 3]thiazolo[5,4-B]pyridine Derivative Length = 284 Back     alignment and structure
>pdb|2J7T|A Chain A, Crystal Structure Of Human Serine Threonine Kinase-10 Bound To Su11274 Length = 302 Back     alignment and structure
>pdb|1UWJ|A Chain A, The Complex Of Mutant V599e B-raf And Bay439006 Length = 276 Back     alignment and structure
>pdb|1UWH|A Chain A, The Complex Of Wild Type B-Raf And Bay439006 Length = 276 Back     alignment and structure
>pdb|4BC6|A Chain A, Crystal Structure Of Human Serine Threonine Kinase-10 Bound To Novel Bosutinib Isoform 1, Previously Thought To Be Bosutinib Length = 293 Back     alignment and structure
>pdb|4H58|A Chain A, Braf In Complex With Compound 3 Length = 275 Back     alignment and structure
>pdb|2QKR|A Chain A, Cryptosporidium Parvum Cyclin-Dependent Kinase Cgd5_2510 With Indirubin 3'-Monoxime Bound Length = 313 Back     alignment and structure
>pdb|2F2U|A Chain A, Crystal Structure Of The Rho-Kinase Kinase Domain Length = 402 Back     alignment and structure
>pdb|2X4F|A Chain A, The Crystal Structure Of The Human Myosin Light Chain Kinase Loc340156. Length = 373 Back     alignment and structure
>pdb|2X4F|A Chain A, The Crystal Structure Of The Human Myosin Light Chain Kinase Loc340156. Length = 373 Back     alignment and structure
>pdb|2GCD|A Chain A, Tao2 Kinase Domain-Staurosporine Structure Length = 309 Back     alignment and structure
>pdb|3OMV|A Chain A, Crystal Structure Of C-Raf (Raf-1) Length = 307 Back     alignment and structure
>pdb|2X7F|A Chain A, Crystal Structure Of The Kinase Domain Of Human Traf2- And Nck-Interacting Kinase With Wee1chk1 Inhibitor Length = 326 Back     alignment and structure
>pdb|1ZYC|A Chain A, Crystal Structure Of Eif2alpha Protein Kinase Gcn2: Wild- Type In Apo Form. Length = 303 Back     alignment and structure
>pdb|1ZY4|A Chain A, Crystal Structure Of Eif2alpha Protein Kinase Gcn2: R794g Hyperactivating Mutant In Apo Form. Length = 303 Back     alignment and structure
>pdb|2HW6|A Chain A, Crystal Structure Of Mnk1 Catalytic Domain Length = 307 Back     alignment and structure
>pdb|4AW2|A Chain A, Crystal Structure Of Cdc42 Binding Protein Kinase Alpha (Mrck Alpha) Length = 437 Back     alignment and structure
>pdb|3QD2|B Chain B, Crsytal Structure Of Mouse Perk Kinase Domain Length = 332 Back     alignment and structure
>pdb|3QD2|B Chain B, Crsytal Structure Of Mouse Perk Kinase Domain Length = 332 Back     alignment and structure
>pdb|3DAK|A Chain A, Crystal Structure Of Domain-Swapped Osr1 Kinase Domain Length = 290 Back     alignment and structure
>pdb|2VWI|A Chain A, Structure Of The Osr1 Kinase, A Hypertension Drug Target Length = 303 Back     alignment and structure
>pdb|3LXN|A Chain A, Structural And Thermodynamic Characterization Of The Tyk2 And Jak3 Kinase Domains In Complex With Cp-690550 And Cmp-6 Length = 318 Back     alignment and structure
>pdb|3COM|A Chain A, Crystal Structure Of Mst1 Kinase Length = 314 Back     alignment and structure
>pdb|3COM|A Chain A, Crystal Structure Of Mst1 Kinase Length = 314 Back     alignment and structure
>pdb|3ZHP|C Chain C, Human Mst3 (stk24) In Complex With Mo25beta Length = 294 Back     alignment and structure
>pdb|3A7F|A Chain A, Human Mst3 Kinase Length = 303 Back     alignment and structure
>pdb|3GGF|A Chain A, Crystal Structure Of Human SerineTHREONINE-Protein Kinase Mst4 In Complex With An Quinazolin Length = 301 Back     alignment and structure
>pdb|3CKW|A Chain A, Crystal Structure Of Sterile 20-Like Kinase 3 (Mst3, Stk24) Length = 304 Back     alignment and structure
>pdb|3CKX|A Chain A, Crystal Structure Of Sterile 20-Like Kinase 3 (Mst3, Stk24) In Complex With Staurosporine Length = 304 Back     alignment and structure
>pdb|3QFV|A Chain A, Mrck Beta In Complex With Tpca-1 Length = 415 Back     alignment and structure
>pdb|3QFV|A Chain A, Mrck Beta In Complex With Tpca-1 Length = 415 Back     alignment and structure
>pdb|3TKU|A Chain A, Mrck Beta In Complex With Fasudil Length = 433 Back     alignment and structure
>pdb|3TKU|A Chain A, Mrck Beta In Complex With Fasudil Length = 433 Back     alignment and structure
>pdb|4DN5|A Chain A, Crystal Structure Of Nf-kb-inducing Kinase (nik) Length = 356 Back     alignment and structure
>pdb|1ZXE|A Chain A, Crystal Structure Of Eif2alpha Protein Kinase Gcn2: D835n Inactivating Mutant In Apo Form Length = 303 Back     alignment and structure
>pdb|4G3D|A Chain A, Crystal Structure Of Human Nf-kappab Inducing Kinase (nik) Length = 371 Back     alignment and structure
>pdb|1UNG|A Chain A, Structural Mechanism For The Inhibition Of Cdk5-P25 By Roscovitine, Aloisine And Indirubin. Length = 292 Back     alignment and structure
>pdb|1UNG|A Chain A, Structural Mechanism For The Inhibition Of Cdk5-P25 By Roscovitine, Aloisine And Indirubin. Length = 292 Back     alignment and structure
>pdb|1OIT|A Chain A, Imidazopyridines: A Potent And Selective Class Of Cyclin-dependent Kinase Inhibitors Identified Through Structure-based Hybridisation Length = 299 Back     alignment and structure
>pdb|2XIK|A Chain A, Structure Of Human Ysk1 (Yeast Sps1-Ste20-Related Kinase 1) Length = 294 Back     alignment and structure
>pdb|2XIK|A Chain A, Structure Of Human Ysk1 (Yeast Sps1-Ste20-Related Kinase 1) Length = 294 Back     alignment and structure
>pdb|3NYX|A Chain A, Non-Phosphorylated Tyk2 Jh1 Domain With Quinoline-Thiadiazole- Thiophene Inhibitor Length = 302 Back     alignment and structure
>pdb|3D83|A Chain A, Crystal Structure Of P38 Kinase In Complex With A Biphenyl Amide Inhibitor Length = 360 Back     alignment and structure
>pdb|3QC9|A Chain A, Crystal Structure Of Cross-Linked Bovine Grk1 T8cN480C DOUBLE MUTANT Complexed With Adp And Mg Length = 543 Back     alignment and structure
>pdb|3NZ0|A Chain A, Non-Phosphorylated Tyk2 Kinase With Cmp6 Length = 302 Back     alignment and structure
>pdb|3C4X|A Chain A, Crystal Structure Of G Protein Coupled Receptor Kinase 1 Bound To Atp And Magnesium Chloride At 2.9a Length = 543 Back     alignment and structure
>pdb|3C4W|A Chain A, Crystal Structure Of G Protein Coupled Receptor Kinase 1 Bound To Atp And Magnesium Chloride At 2.7a Length = 543 Back     alignment and structure
>pdb|3T8O|A Chain A, Rhodopsin Kinase (grk1) L166k Mutant At 2.5a Resolution Length = 543 Back     alignment and structure
>pdb|3PXF|A Chain A, Cdk2 In Complex With Two Molecules Of 8-Anilino-1-Naphthalene Sulfonate Length = 306 Back     alignment and structure
>pdb|4EOJ|A Chain A, Thr 160 Phosphorylated Cdk2 H84s, Q85m, K89d - Human Cyclin A3 Complex With Atp Length = 302 Back     alignment and structure
>pdb|4EOQ|A Chain A, Thr 160 Phosphorylated Cdk2 Wt - Human Cyclin A3 Complex With Atp Length = 301 Back     alignment and structure
>pdb|4BCQ|A Chain A, Structure Of Cdk2 In Complex With Cyclin A And A 2-amino-4- Heteroaryl-pyrimidine Inhibitor Length = 301 Back     alignment and structure
>pdb|3D7Z|A Chain A, Crystal Structure Of P38 Kinase In Complex With A Biphenyl Amide Inhibitor Length = 360 Back     alignment and structure
>pdb|4EOS|A Chain A, Thr 160 Phosphorylated Cdk2 Wt - Human Cyclin A3 Complex With The Inhibitor Ro3306 Length = 300 Back     alignment and structure
>pdb|1E9H|A Chain A, Thr 160 Phosphorylated Cdk2-Human Cyclin A3 Complex With The Inhibitor Indirubin-5-Sulphonate Bound Length = 297 Back     alignment and structure
>pdb|4ERW|A Chain A, Cdk2 In Complex With Staurosporine Length = 306 Back     alignment and structure
>pdb|3EZR|A Chain A, Cdk-2 With Indazole Inhibitor 17 Bound At Its Active Site Length = 300 Back     alignment and structure
>pdb|1H1P|A Chain A, Structure Of Human Thr160-Phospho Cdk2CYCLIN A COMPLEXED With The Inhibitor Nu2058 Length = 303 Back     alignment and structure
>pdb|1TKI|A Chain A, Autoinhibited Serine Kinase Domain Of The Giant Muscle Protein Titin Length = 321 Back     alignment and structure
>pdb|1QMZ|A Chain A, Phosphorylated Cdk2-Cyclyin A-Substrate Peptide Complex Length = 299 Back     alignment and structure
>pdb|2JGZ|A Chain A, Crystal Structure Of Phospho-Cdk2 In Complex With Cyclin B Length = 289 Back     alignment and structure
>pdb|2IW6|A Chain A, Structure Of Human Thr160-Phospho Cdk2-Cyclin A Complexed With A Bisanilinopyrimidine Inhibitor Length = 302 Back     alignment and structure
>pdb|4EOK|A Chain A, Thr 160 Phosphorylated Cdk2 H84s, Q85m, K89d - Human Cyclin A3 Complex With The Inhibitor Nu6102 Length = 300 Back     alignment and structure
>pdb|4I3Z|A Chain A, Structure Of Pcdk2CYCLINA BOUND TO ADP AND 2 MAGNESIUM IONS Length = 296 Back     alignment and structure
>pdb|2W17|A Chain A, Cdk2 In Complex With The Imidazole Pyrimidine Amide, Compound (S)-8b Length = 299 Back     alignment and structure
>pdb|1W98|A Chain A, The Structural Basis Of Cdk2 Activation By Cyclin E Length = 298 Back     alignment and structure
>pdb|1FIN|A Chain A, Cyclin A-Cyclin-Dependent Kinase 2 Complex Length = 298 Back     alignment and structure
>pdb|4EOM|A Chain A, Thr 160 Phosphorylated Cdk2 H84s, Q85m, Q131e - Human Cyclin A3 Complex With Atp Length = 301 Back     alignment and structure
>pdb|2IW8|A Chain A, Structure Of Human Thr160-Phospho Cdk2-Cyclin A F82h-L83v- H84d Mutant With An O6-Cyclohexylmethylguanine Inhibitor Length = 302 Back     alignment and structure
>pdb|1PF8|A Chain A, Crystal Structure Of Human Cyclin-dependent Kinase 2 Complexed With A Nucleoside Inhibitor Length = 298 Back     alignment and structure
>pdb|1OGU|A Chain A, Structure Of Human Thr160-phospho Cdk2/cyclin A Complexed With A 2-arylamino-4-cyclohexylmethyl-5-nitroso-6- aminopyrimidine Inhibitor Length = 302 Back     alignment and structure
>pdb|1GII|A Chain A, Human Cyclin Dependent Kinase 2 Complexed With The Cdk4 Inhibitor Length = 298 Back     alignment and structure
>pdb|3BHT|A Chain A, Structure Of Phosphorylated Thr160 Cdk2CYCLIN A IN COMPLEX WITH THE Inhibitor Meriolin 3 Length = 300 Back     alignment and structure
>pdb|3PJ8|A Chain A, Structure Of Cdk2 In Complex With A Pyrazolo[4,3-D]pyrimidine Bioisostere Of Roscovitine Length = 299 Back     alignment and structure
>pdb|1VYW|A Chain A, Structure Of Cdk2CYCLIN A WITH PNU-292137 Length = 309 Back     alignment and structure
>pdb|1JST|A Chain A, Phosphorylated Cyclin-Dependent Kinase-2 Bound To Cyclin A Length = 298 Back     alignment and structure
>pdb|1OIR|A Chain A, Imidazopyridines: A Potent And Selective Class Of Cyclin-Dependent Kinase Inhibitors Identified Through Structure-Based Hybridisation Length = 299 Back     alignment and structure
>pdb|1H01|A Chain A, Cdk2 In Complex With A Disubstituted 2, 4-Bis Anilino Pyrimidine Cdk4 Inhibitor Length = 298 Back     alignment and structure
>pdb|1GZ8|A Chain A, Human Cyclin Dependent Kinase 2 Complexed With The Inhibitor 2-Amino-6-(3'-Methyl-2'-Oxo)butoxypurine Length = 299 Back     alignment and structure
>pdb|4EON|A Chain A, Thr 160 Phosphorylated Cdk2 H84s, Q85m, Q131e - Human Cyclin A3 Complex With The Inhibitor Ro3306 Length = 300 Back     alignment and structure
>pdb|3QHR|A Chain A, Structure Of A Pcdk2CYCLINA TRANSITION-State Mimic Length = 298 Back     alignment and structure
>pdb|4EOP|A Chain A, Thr 160 Phosphorylated Cdk2 Q131e - Human Cyclin A3 Complex With The Inhibitor Ro3306 Length = 300 Back     alignment and structure
>pdb|4EOO|A Chain A, Thr 160 Phosphorylated Cdk2 Q131e - Human Cyclin A3 Complex With Atp Length = 299 Back     alignment and structure
>pdb|4EOI|A Chain A, Thr 160 Phosphorylated Cdk2 K89d, Q131e - Human Cyclin A3 Complex With The Inhibitor Ro3306 Length = 299 Back     alignment and structure
>pdb|4G3G|A Chain A, Crystal Structure Of Murine Nf-kappab Inducing Kinase (nik) V408l Bound To A 2-(aminothiazolyl)phenol (cmp3) Length = 350 Back     alignment and structure
>pdb|4G3C|A Chain A, Crystal Structure Of Apo Murine Nf-kappab Inducing Kinase (nik) Length = 352 Back     alignment and structure
>pdb|4G3F|A Chain A, Crystal Structure Of Murine Nf-kappab Inducing Kinase (nik) Bound To A 2-(aminothiazoly)phenol (cmp2) Length = 336 Back     alignment and structure
>pdb|3GC8|A Chain A, The Structure Of P38beta C162s In Complex With A Dihydroquinazolinone Length = 370 Back     alignment and structure
>pdb|3GC8|A Chain A, The Structure Of P38beta C162s In Complex With A Dihydroquinazolinone Length = 370 Back     alignment and structure
>pdb|2BAL|A Chain A, P38alpha Map Kinase Bound To Pyrazoloamine Length = 365 Back     alignment and structure
>pdb|2BAQ|A Chain A, P38alpha Bound To Ro3201195 Length = 365 Back     alignment and structure
>pdb|3E92|A Chain A, Crystal Structure Of P38 Kinase In Complex With A Biaryl Amide Inhibitor Length = 371 Back     alignment and structure
>pdb|3OHT|A Chain A, Crystal Structure Of Salmo Salar P38alpha Length = 389 Back     alignment and structure
>pdb|1KOB|A Chain A, Twitchin Kinase Fragment (Aplysia), Autoregulated Protein Kinase Domain Length = 387 Back     alignment and structure
>pdb|1KOB|A Chain A, Twitchin Kinase Fragment (Aplysia), Autoregulated Protein Kinase Domain Length = 387 Back     alignment and structure
>pdb|2FSL|X Chain X, Mitogen Activated Protein Kinase P38alpha (D176a+f327s) Activating Mutant Form-A Length = 367 Back     alignment and structure
>pdb|4E5A|X Chain X, The W197a Mutant Of P38a Map Kinase Length = 360 Back     alignment and structure
>pdb|2FST|X Chain X, Mitogen Activated Protein Kinase P38alpha (d176a+f327l) Activating Mutant Length = 367 Back     alignment and structure
>pdb|3GC9|A Chain A, The Structure Of P38beta C119s, C162s In Complex With A Dihydroquinazolinone Inhibitor Length = 370 Back     alignment and structure
>pdb|3GC9|A Chain A, The Structure Of P38beta C119s, C162s In Complex With A Dihydroquinazolinone Inhibitor Length = 370 Back     alignment and structure
>pdb|3GP0|A Chain A, Crystal Structure Of Human Mitogen Activated Protein Kinase 11 (p38 Beta) In Complex With Nilotinib Length = 348 Back     alignment and structure
>pdb|3GP0|A Chain A, Crystal Structure Of Human Mitogen Activated Protein Kinase 11 (p38 Beta) In Complex With Nilotinib Length = 348 Back     alignment and structure
>pdb|1YW2|A Chain A, Mutated Mus Musculus P38 Kinase (Mp38) Length = 360 Back     alignment and structure
>pdb|3OD6|X Chain X, Crystal Structure Of P38alpha Y323t Active Mutant Length = 360 Back     alignment and structure
>pdb|3NNU|A Chain A, Crystal Structure Of P38 Alpha In Complex With Dp1376 Length = 354 Back     alignment and structure
>pdb|2FSO|X Chain X, Mitogen Activated Protein Kinase P38alpha (D176a) Activating Mutant Length = 367 Back     alignment and structure
>pdb|3ODZ|X Chain X, Crystal Structure Of P38alpha Y323r Active Mutant Length = 360 Back     alignment and structure
>pdb|3ODY|X Chain X, Crystal Structure Of P38alpha Y323q Active Mutant Length = 360 Back     alignment and structure
>pdb|3K3J|A Chain A, P38alpha Bound To Novel Dfg-Out Compound Pf-00416121 Length = 362 Back     alignment and structure
>pdb|2LGC|A Chain A, Joint Nmr And X-Ray Refinement Reveals The Structure Of A Novel Dibenzo[a,D]cycloheptenone InhibitorP38 MAP KINASE COMPLEX IN Solution Length = 359 Back     alignment and structure
>pdb|3OEF|X Chain X, Crystal Structure Of Y323f Inactive Mutant Of P38alpha Map Kinase Length = 360 Back     alignment and structure
>pdb|1M7Q|A Chain A, Crystal Structure Of P38 Map Kinase In Complex With A Dihydroquinazolinone Inhibitor Length = 366 Back     alignment and structure
>pdb|3NNX|A Chain A, Crystal Structure Of Phosphorylated P38 Alpha In Complex With Dp802 Length = 354 Back     alignment and structure
>pdb|2NPQ|A Chain A, A Novel Lipid Binding Site In The P38 Alpha Map Kinase Length = 367 Back     alignment and structure
>pdb|2BAJ|A Chain A, P38alpha Bound To Pyrazolourea Length = 365 Back     alignment and structure
>pdb|3P4K|A Chain A, The Third Conformation Of P38a Map Kinase Observed In Phosphorylated P38a And In Solution Length = 370 Back     alignment and structure
>pdb|3HRB|A Chain A, P38 Kinase Crystal Structure In Complex With Small Molecule Inhibitor Length = 359 Back     alignment and structure
>pdb|3HVC|A Chain A, Crystal Structure Of Human P38alpha Map Kinase Length = 362 Back     alignment and structure
>pdb|1DI9|A Chain A, The Structure Of P38 Mitogen-Activated Protein Kinase In Complex With 4-[3-Methylsulfanylanilino]-6,7- Dimethoxyquinazoline Length = 360 Back     alignment and structure
>pdb|1OZ1|A Chain A, P38 Mitogen-Activated Kinase In Complex With 4-Azaindole Inhibitor Length = 372 Back     alignment and structure
>pdb|3S3I|A Chain A, P38 Kinase Crystal Structure In Complex With Small Molecule Inhibitor Length = 349 Back     alignment and structure
>pdb|2Y8O|A Chain A, Crystal Structure Of Human P38alpha Complexed With A Mapk Docking Peptide Length = 362 Back     alignment and structure
>pdb|3HEC|A Chain A, P38 In Complex With Imatinib Length = 348 Back     alignment and structure
>pdb|2GFS|A Chain A, P38 Kinase Crystal Structure In Complex With Ro3201195 Length = 372 Back     alignment and structure
>pdb|1LEW|A Chain A, Crystal Structure Of Map Kinase P38 Complexed To The Docking Site On Its Nuclear Substrate Mef2a Length = 360 Back     alignment and structure
>pdb|2AC3|A Chain A, Structure Of Human Mnk2 Kinase Domain Length = 316 Back     alignment and structure
>pdb|1ZZL|A Chain A, Crystal Structure Of P38 With Triazolopyridine Length = 351 Back     alignment and structure
>pdb|1YWR|A Chain A, Crystal Structure Analysis Of Inactive P38 Kinase Domain In Complex With A Monocyclic Pyrazolone Inhibitor Length = 360 Back     alignment and structure
>pdb|4EWQ|A Chain A, Human P38 Alpha Mapk In Complex With A Pyridazine Based Inhibitor Length = 383 Back     alignment and structure
>pdb|3TG1|A Chain A, Crystal Structure Of P38alpha In Complex With A Mapk Docking Partner Length = 380 Back     alignment and structure
>pdb|3FI4|A Chain A, P38 Kinase Crystal Structure In Complex With Ro4499 Length = 372 Back     alignment and structure
>pdb|3GCU|A Chain A, Human P38 Map Kinase In Complex With Rl48 Length = 360 Back     alignment and structure
>pdb|3ZSG|A Chain A, X-Ray Structure Of P38alpha Bound To Tak-715 Length = 362 Back     alignment and structure
>pdb|3KQ7|A Chain A, Structure Of Human P38alpha With N-[4-Methyl-3-(6-{[2-(1- Methylpyrrolidin-2-Yl)ethyl]amino}pyridine-3- Amido)phenyl]- 2-(Morpholin-4-Yl)pyridine-4-Carboxamide Length = 380 Back     alignment and structure
>pdb|3MPT|A Chain A, Crystal Structure Of P38 Kinase In Complex With A Pyrrole-2- Carboxamide Inhibitor Length = 371 Back     alignment and structure
>pdb|3DT1|A Chain A, P38 Complexed With A Quinazoline Inhibitor Length = 383 Back     alignment and structure
>pdb|2GTM|A Chain A, Mutated Mouse P38 Map Kinase Domain In Complex With Inhibitor Pg-892579 Length = 348 Back     alignment and structure
>pdb|1OVE|A Chain A, The Structure Of P38 Alpha In Complex With A Dihydroquinolinone Length = 366 Back     alignment and structure
>pdb|3PY3|A Chain A, Crystal Structure Of Phosphorylated P38alpha Map Kinase Length = 380 Back     alignment and structure
>pdb|2GHL|A Chain A, Mutant Mus Musculus P38 Kinase Domain In Complex With Inhibitor Pg-874743 Length = 348 Back     alignment and structure
>pdb|1BMK|A Chain A, The Complex Structure Of The Map Kinase P38SB218655 Length = 379 Back     alignment and structure
>pdb|3K3I|A Chain A, P38alpha Bound To Novel Dgf-Out Compound Pf-00215955 Length = 350 Back     alignment and structure
>pdb|1BL6|A Chain A, The Complex Structure Of The Map Kinase P38SB216995 Length = 379 Back     alignment and structure
>pdb|1IAN|A Chain A, Human P38 Map Kinase Inhibitor Complex Length = 366 Back     alignment and structure
>pdb|2OZA|B Chain B, Structure Of P38alpha Complex Length = 366 Back     alignment and structure
>pdb|1CM8|A Chain A, Phosphorylated Map Kinase P38-Gamma Length = 367 Back     alignment and structure
>pdb|2PUU|A Chain A, Crystal Structure Of P38 Complex With 1-(5-Tert-Butyl-2-P- Tolyl-2h-Pyrazol-3-Yl)-3-[4-(6-Morpholin-4-Ylmethyl- Pyridin-3-Yl)naphthalen-1-Yl]urea Length = 348 Back     alignment and structure
>pdb|4EXU|A Chain A, Mapk13, Inactive Form Length = 371 Back     alignment and structure
>pdb|1F3M|C Chain C, Crystal Structure Of Human SerineTHREONINE KINASE PAK1 Length = 297 Back     alignment and structure
>pdb|1F3M|C Chain C, Crystal Structure Of Human SerineTHREONINE KINASE PAK1 Length = 297 Back     alignment and structure
>pdb|3UIM|A Chain A, Structural Basis For The Impact Of Phosphorylation On Plant Receptor- Like Kinase Bak1 Activation Length = 326 Back     alignment and structure
>pdb|2PK9|A Chain A, Structure Of The Pho85-pho80 Cdk-cyclin Complex Of The Phosphate-responsive Signal Transduction Pathway Length = 317 Back     alignment and structure
>pdb|4E1Z|A Chain A, Structure Of Mouse Tyk-2 Complexed To A 3-Aminoindazole Inhibitor Length = 291 Back     alignment and structure
>pdb|3COI|A Chain A, Crystal Structure Of P38delta Kinase Length = 353 Back     alignment and structure
>pdb|4E20|A Chain A, Structure Of Mouse Tyk-2 Complexed To A 3-Aminoindazole Inhibitor Length = 290 Back     alignment and structure
>pdb|3TL8|A Chain A, The Avrptob-Bak1 Complex Reveals Two Structurally Similar Kinaseinteracting Domains In A Single Type Iii Effector Length = 349 Back     alignment and structure
>pdb|3GCP|A Chain A, Human P38 Map Kinase In Complex With Sb203580 Length = 360 Back     alignment and structure
>pdb|4EC8|A Chain A, Structure Of Full Length Cdk9 In Complex With Cyclint And Drb Length = 373 Back     alignment and structure
>pdb|4BCF|A Chain A, Structure Of Cdk9 In Complex With Cyclin T And A 2-amino-4- Heteroaryl-pyrimidine Inhibitor Length = 331 Back     alignment and structure
>pdb|3MI9|A Chain A, Crystal Structure Of Hiv-1 Tat Complexed With Human P-Tefb Length = 351 Back     alignment and structure
>pdb|3BLH|A Chain A, Crystal Structure Of Human Cdk9CYCLINT1 Length = 331 Back     alignment and structure
>pdb|3MH2|A Chain A, Mutagenesis Of P38 Map Kinase Establishes Key Roles Of Phe169 In Function And Structural Dynamics And Reveals A Novel Dfg-Out State Length = 360 Back     alignment and structure
>pdb|1H4L|A Chain A, Structure And Regulation Of The Cdk5-P25(Nck5a) Complex Length = 292 Back     alignment and structure
>pdb|1H4L|A Chain A, Structure And Regulation Of The Cdk5-P25(Nck5a) Complex Length = 292 Back     alignment and structure
>pdb|2BUJ|A Chain A, Crystal Structure Of The Human Serine-Threonine Kinase 16 In Complex With Staurosporine Length = 317 Back     alignment and structure
>pdb|2ZM1|A Chain A, Crystal Structure Of Imidazo Pyrazin 1 Bound To The Kinase Domain Of Human Lck, (Auto-Phosphorylated On Tyr394) Length = 285 Back     alignment and structure
>pdb|3KXZ|A Chain A, The Complex Crystal Structure Of Lck With A Probe Molecule W259 Length = 287 Back     alignment and structure
>pdb|1QPD|A Chain A, Structural Analysis Of The Lymphocyte-specific Kinase Lck In Complex With Non-selective And Src Family Selective Kinase Inhibitors Length = 279 Back     alignment and structure
>pdb|2OFU|A Chain A, X-Ray Crystal Structure Of 2-Aminopyrimidine Carbamate 43 Bound To Lck Length = 273 Back     alignment and structure
>pdb|2OFV|A Chain A, Crystal Structure Of Aminoquinazoline 1 Bound To Lck Length = 277 Back     alignment and structure
>pdb|3KMM|A Chain A, Structure Of Human Lck Kinase With A Small Molecule Inhibitor Length = 288 Back     alignment and structure
>pdb|2PL0|A Chain A, Lck Bound To Imatinib Length = 289 Back     alignment and structure
>pdb|3BYS|A Chain A, Co-Crystal Structure Of Lck And Aminopyrimidine Amide 10b Length = 277 Back     alignment and structure
>pdb|1QPE|A Chain A, Structural Analysis Of The Lymphocyte-Specific Kinase Lck In Complex With Non-Selective And Src Family Selective Kinase Inhibitors Length = 279 Back     alignment and structure
>pdb|3BYM|A Chain A, X-Ray Co-Crystal Structure Aminobenzimidazole Triazine 1 Bound To Lck Length = 272 Back     alignment and structure
>pdb|4AAA|A Chain A, Crystal Structure Of The Human Cdkl2 Kinase Domain Length = 331 Back     alignment and structure
>pdb|3LCK|A Chain A, The Kinase Domain Of Human Lymphocyte Kinase (Lck), Activated Form (Auto-Phosphorylated On Tyr394) Length = 271 Back     alignment and structure
>pdb|1K3A|A Chain A, Structure Of The Insulin-Like Growth Factor 1 Receptor Kinase Length = 299 Back     alignment and structure
>pdb|2OF2|A Chain A, Crystal Structure Of Furanopyrimidine 8 Bound To Lck Length = 271 Back     alignment and structure
>pdb|1BI8|A Chain A, Mechanism Of G1 Cyclin Dependent Kinase Inhibition From The Structures Cdk6-P19ink4d Inhibitor Complex Length = 326 Back     alignment and structure
>pdb|2ZM3|A Chain A, Complex Structure Of Insulin-Like Growth Factor Receptor And Isoquinolinedione Inhibitor Length = 308 Back     alignment and structure
>pdb|1JOW|B Chain B, Crystal Structure Of A Complex Of Human Cdk6 And A Viral Cyclin Length = 308 Back     alignment and structure
>pdb|3UIB|A Chain A, Map Kinase Lmampk10 From Leishmania Major In Complex With Sb203580 Length = 362 Back     alignment and structure
>pdb|3NUP|A Chain A, Cdk6 (Monomeric) In Complex With Inhibitor Length = 307 Back     alignment and structure
>pdb|2OG8|A Chain A, Crystal Structure Of Aminoquinazoline 36 Bound To Lck Length = 265 Back     alignment and structure
>pdb|3PG1|A Chain A, Map Kinase Lmampk10 From Leishmania Major (1.95 Angs Resolution) Length = 362 Back     alignment and structure
>pdb|1LUF|A Chain A, Crystal Structure Of The Musk Tyrosine Kinase: Insights Into Receptor Autoregulation Length = 343 Back     alignment and structure
>pdb|3HMN|A Chain A, Crystal Structure Of Human Mps1 Catalytic Domain In Complex With Atp Length = 342 Back     alignment and structure
>pdb|3HMN|A Chain A, Crystal Structure Of Human Mps1 Catalytic Domain In Complex With Atp Length = 342 Back     alignment and structure
>pdb|2AC5|A Chain A, Structure Of Human Mnk2 Kinase Domain Mutant D228g Length = 316 Back     alignment and structure
>pdb|3DLS|A Chain A, Crystal Structure Of Human Pas Kinase Bound To Adp Length = 335 Back     alignment and structure
>pdb|2X9E|A Chain A, Human Mps1 In Complex With Nms-P715 Length = 317 Back     alignment and structure
>pdb|3FXZ|A Chain A, Crystal Structure Of Pak1 Kinase Domain With Ruthenium Complex Lambda-Fl172 Length = 297 Back     alignment and structure
>pdb|3FXZ|A Chain A, Crystal Structure Of Pak1 Kinase Domain With Ruthenium Complex Lambda-Fl172 Length = 297 Back     alignment and structure
>pdb|3CEK|A Chain A, Crystal Structure Of Human Dual Specificity Protein Kinase (ttk) Length = 313 Back     alignment and structure
>pdb|3DBQ|A Chain A, Crystal Structure Of Ttk Kinase Domain Length = 343 Back     alignment and structure
>pdb|3VQU|A Chain A, Crystal Structure Of Human Mps1 Catalytic Domain In Complex With 4- [(4-Amino-5-Cyano-6-Ethoxypyridin-2- Yl)amino]benzamide Length = 320 Back     alignment and structure
>pdb|3H9F|A Chain A, Crystal Structure Of Human Dual Specificity Protein Kinase (Ttk) In Complex With A Pyrimido-Diazepin Ligand Length = 313 Back     alignment and structure
>pdb|2ZMC|A Chain A, Crystal Structure Of Human Mitotic Checkpoint Kinase Mps1 Catalytic Domain Apo Form Length = 390 Back     alignment and structure
>pdb|2ZMC|A Chain A, Crystal Structure Of Human Mitotic Checkpoint Kinase Mps1 Catalytic Domain Apo Form Length = 390 Back     alignment and structure
>pdb|2HK5|A Chain A, Hck Kinase In Complex With Lck Targetted Inhibitor Pg- 1009247 Length = 270 Back     alignment and structure
>pdb|2ZMD|A Chain A, Crystal Structure Of Human Mps1 Catalytic Domain T686a Mutant In Complex With Sp600125 Inhibitor Length = 390 Back     alignment and structure
>pdb|3HNG|A Chain A, Crystal Structure Of Vegfr1 In Complex With N-(4-chlorophenyl)-2- ((pyridin-4-ylmethyl)amino)benzamide Length = 360 Back     alignment and structure
>pdb|3A4O|X Chain X, Lyn Kinase Domain Length = 286 Back     alignment and structure
>pdb|2ZV7|A Chain A, Lyn Tyrosine Kinase Domain, Apo Form Length = 279 Back     alignment and structure
>pdb|1P4O|A Chain A, Structure Of Apo Unactivated Igf-1r Kinase Domain At 1.5a Resolution. Length = 322 Back     alignment and structure
>pdb|1V0O|A Chain A, Structure Of P. Falciparum Pfpk5-Indirubin-5-Sulphonate Ligand Complex Length = 288 Back     alignment and structure
>pdb|3Q4Z|A Chain A, Structure Of Unphosphorylated Pak1 Kinase Domain Length = 306 Back     alignment and structure
>pdb|3Q4Z|A Chain A, Structure Of Unphosphorylated Pak1 Kinase Domain Length = 306 Back     alignment and structure
>pdb|1M7N|A Chain A, Crystal Structure Of Unactivated Apo Insulin-Like Growth Factor-1 Receptor Kinase Domain Length = 322 Back     alignment and structure
>pdb|1YHV|A Chain A, Crystal Structure Of Pak1 Kinase Domain With Two Point Mutations (K299r, T423e) Length = 297 Back     alignment and structure
>pdb|1YHV|A Chain A, Crystal Structure Of Pak1 Kinase Domain With Two Point Mutations (K299r, T423e) Length = 297 Back     alignment and structure
>pdb|1V0B|A Chain A, Crystal Structure Of The T198a Mutant Of Pfpk5 Length = 288 Back     alignment and structure
>pdb|1OB3|A Chain A, Structure Of P. Falciparum Pfpk5 Length = 288 Back     alignment and structure
>pdb|1QCF|A Chain A, Crystal Structure Of Hck In Complex With A Src Family- Selective Tyrosine Kinase Inhibitor Length = 454 Back     alignment and structure
>pdb|3O8P|A Chain A, Conformational Plasticity Of P38 Map Kinase Dfg Motif Mutants In Response To Inhibitor Binding Length = 360 Back     alignment and structure
>pdb|3I81|A Chain A, Crystal Structure Of Insulin-Like Growth Factor 1 Receptor (Igf-1r-Wt) Complex With Bms-754807 [1-(4-((5-Cyclopropyl- 1h-Pyrazol-3-Yl)amino)pyrrolo[2,1-F][1,2, 4]triazin-2-Yl)-N- (6-Fluoro-3-Pyridinyl)-2-Methyl-L-Prolinamide] Length = 315 Back     alignment and structure
>pdb|3O23|A Chain A, Human Unphosphorylated Igf1-R Kinase Domain In Complex With An Hydantoin Inhibitor Length = 305 Back     alignment and structure
>pdb|3LW0|A Chain A, Igf-1rk In Complex With Ligand Msc1609119a-1 Length = 304 Back     alignment and structure
>pdb|2OJ9|A Chain A, Structure Of Igf-1r Kinase Domain Complexed With A Benzimidazole Inhibitor Length = 307 Back     alignment and structure
>pdb|1JQH|A Chain A, Igf-1 Receptor Kinase Domain Length = 308 Back     alignment and structure
>pdb|3TEI|A Chain A, Crystal Structure Of Human Erk2 Complexed With A Mapk Docking Peptide Length = 362 Back     alignment and structure
>pdb|3QQU|A Chain A, Cocrystal Structure Of Unphosphorylated Igf With Pyrimidine 8 Length = 301 Back     alignment and structure
>pdb|3MH0|A Chain A, Mutagenesis Of P38 Map Kinase Eshtablishes Key Roles Of Phe169 In Function And Structural Dynamics And Reveals A Novel Dfg-Out State Length = 360 Back     alignment and structure
>pdb|3LVP|A Chain A, Crystal Structure Of Bisphosphorylated Igf1-R Kinase Domain (2p) In Complex With A Bis-Azaindole Inhibitor Length = 336 Back     alignment and structure
>pdb|3SA0|A Chain A, Complex Of Erk2 With Norathyriol Length = 360 Back     alignment and structure
>pdb|4FUX|A Chain A, Crystal Structure Of The Erk2 Complexed With E75 Length = 360 Back     alignment and structure
>pdb|4H3Q|A Chain A, Crystal Structure Of Human Erk2 Complexed With A Mapk Docking Peptide Length = 362 Back     alignment and structure
>pdb|4FV7|A Chain A, Crystal Structure Of The Erk2 Complexed With E94 Length = 360 Back     alignment and structure
>pdb|3Q52|A Chain A, Structure Of Phosphorylated Pak1 Kinase Domain Length = 306 Back     alignment and structure
>pdb|3Q52|A Chain A, Structure Of Phosphorylated Pak1 Kinase Domain Length = 306 Back     alignment and structure
>pdb|4HZS|A Chain A, Crystal Structure Of Ack1 Kinase Domain With C-terminal Sh3 Domain Length = 341 Back     alignment and structure
>pdb|4EQM|A Chain A, Structural Analysis Of Staphylococcus Aureus SerineTHREONINE KINASE Pknb Length = 294 Back     alignment and structure
>pdb|3QYW|A Chain A, Crystal Structure Of Erk2 In Complex With An Inhibitor Length = 364 Back     alignment and structure
>pdb|1U54|A Chain A, Crystal Structures Of The Phosphorylated And Unphosphorylated Kinase Domains Of The Cdc42-Associated Tyrosine Kinase Ack1 Bound To Amp-Pcp Length = 291 Back     alignment and structure
>pdb|4GSB|A Chain A, Monoclinic Crystal Form Of The Apo-Erk2 Length = 364 Back     alignment and structure
>pdb|3G33|A Chain A, Crystal Structure Of Cdk4CYCLIN D3 Length = 308 Back     alignment and structure
>pdb|3MH1|A Chain A, Mutagenesis Of P38 Map Kinase Establishes Key Roles Of Phe169 In Function And Structural Dynamics And Reveals A Novel Dfg-Out State Length = 360 Back     alignment and structure
>pdb|1YOJ|A Chain A, Crystal Structure Of Src Kinase Domain Length = 283 Back     alignment and structure
>pdb|1YOL|A Chain A, Crystal Structure Of Src Kinase Domain In Complex With Cgp77675 Length = 283 Back     alignment and structure
>pdb|2W99|B Chain B, Crystal Structure Of Cdk4 In Complex With A D-Type Cyclin Length = 306 Back     alignment and structure
>pdb|4FV6|A Chain A, Crystal Structure Of The Erk2 Complexed With E57 Length = 360 Back     alignment and structure
>pdb|3U4W|A Chain A, Src In Complex With Dna-Templated Macrocyclic Inhibitor Mc4b Length = 275 Back     alignment and structure
>pdb|2BDF|A Chain A, Src Kinase In Complex With Inhibitor Ap23451 Length = 279 Back     alignment and structure
>pdb|1YI6|A Chain A, C-Term Tail Segment Of Human Tyrosine Kinase (258-533) Length = 276 Back     alignment and structure
>pdb|1PME|A Chain A, Structure Of Penta Mutant Human Erk2 Map Kinase Complexed With A Specific Inhibitor Of Human P38 Map Kinase Length = 380 Back     alignment and structure
>pdb|1U46|A Chain A, Crystal Structure Of The Unphosphorylated Kinase Domain Of The Tyrosine Kinase Ack1 Length = 291 Back     alignment and structure
>pdb|2W9F|B Chain B, Crystal Structure Of Cdk4 In Complex With A D-Type Cyclin Length = 306 Back     alignment and structure
>pdb|3D94|A Chain A, Crystal Structure Of The Insulin-Like Growth Factor-1 Receptor Kinase In Complex With Pqip Length = 301 Back     alignment and structure
>pdb|1GOL|A Chain A, Coordinates Of Rat Map Kinase Erk2 With An Arginine Mutation At Position 52 Length = 364 Back     alignment and structure
>pdb|2W96|B Chain B, Crystal Structure Of Cdk4 In Complex With A D-Type Cyclin Length = 306 Back     alignment and structure
>pdb|2Y9Q|A Chain A, Crystal Structure Of Human Erk2 Complexed With A Mapk Docking Peptide Length = 362 Back     alignment and structure
>pdb|3D7U|B Chain B, Structural Basis For The Recognition Of C-Src By Its Inactivator Csk Length = 277 Back     alignment and structure
>pdb|3MH3|A Chain A, Mutagenesis Of P38 Map Kinase Establishes Key Roles Of Phe169 In Function And Structural Dynamics And Reveals A Novel Dfg-Out State Length = 360 Back     alignment and structure
>pdb|1FMK|A Chain A, Crystal Structure Of Human Tyrosine-Protein Kinase C-Src Length = 452 Back     alignment and structure
>pdb|3ZU7|A Chain A, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Map Kinase Erk2 Length = 365 Back     alignment and structure
>pdb|2Z7L|A Chain A, Unphosphorylated Mitogen Activated Protein Kinase Erk2 In Complex With (4-{[5-Carbamoyl-4-(3-Methylanilino)pyrimidin 2-Yl]amino}phenyl)acetic Acid Length = 366 Back     alignment and structure
>pdb|3C9W|A Chain A, Crystal Structure Of Erk-2 With Hypothemycin Covalently Bound Length = 357 Back     alignment and structure
>pdb|2GPH|A Chain A, Docking Motif Interactions In The Map Kinase Erk2 Length = 364 Back     alignment and structure
>pdb|2FYS|B Chain B, Crystal Structure Of Erk2 Complex With Kim Peptide Derived From Mkp3 Length = 364 Back     alignment and structure
>pdb|3O71|A Chain A, Crystal Structure Of Erk2DCC PEPTIDE COMPLEX Length = 358 Back     alignment and structure
>pdb|1Y57|A Chain A, Structure Of Unphosphorylated C-Src In Complex With An Inhibitor Length = 452 Back     alignment and structure
>pdb|4EWH|B Chain B, Co-Crystal Structure Of Ack1 With Inhibitor Length = 275 Back     alignment and structure
>pdb|3R63|A Chain A, Structure Of Erk2 (Spe) Mutant (S246e) Length = 358 Back     alignment and structure
>pdb|3MPM|A Chain A, Lck Complexed With A Pyrazolopyrimidine Length = 267 Back     alignment and structure
>pdb|1KSW|A Chain A, Structure Of Human C-Src Tyrosine Kinase (Thr338gly Mutant) In Complex With N6-Benzyl Adp Length = 452 Back     alignment and structure
>pdb|2HWO|A Chain A, Crystal Structure Of Src Kinase Domain In Complex With Covalent Inhibitor Length = 286 Back     alignment and structure
>pdb|2OJG|A Chain A, Crystal Structure Of Erk2 In Complex With N,n-dimethyl-4-(4- Phenyl-1h-pyrazol-3-yl)-1h-pyrrole-2-carboxamide Length = 380 Back     alignment and structure
>pdb|3ZUV|A Chain A, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Phosphorylated Map Kinase Erk2 Length = 364 Back     alignment and structure
>pdb|3SVV|A Chain A, Crystal Structure Of T338c C-Src Covalently Bound To Vinylsulfonamide- Pyrazolopyrimidine 9 Length = 286 Back     alignment and structure
>pdb|3EQP|B Chain B, Crystal Structure Of Ack1 With Compound T95 Length = 276 Back     alignment and structure
>pdb|2QQ7|A Chain A, Crystal Structure Of Drug Resistant Src Kinase Domain With Irreversible Inhibitor Length = 286 Back     alignment and structure
>pdb|2ERK|A Chain A, Phosphorylated Map Kinase Erk2 Length = 365 Back     alignment and structure
>pdb|1WZY|A Chain A, Crystal Structure Of Human Erk2 Complexed With A Pyrazolopyridazine Derivative Length = 368 Back     alignment and structure
>pdb|1TVO|A Chain A, The Structure Of Erk2 In Complex With A Small Molecule Inhibitor Length = 368 Back     alignment and structure
>pdb|2OIQ|A Chain A, Crystal Structure Of Chicken C-Src Kinase Domain In Complex With The Cancer Drug Imatinib. Length = 286 Back     alignment and structure
>pdb|2H8H|A Chain A, Src Kinase In Complex With A Quinazoline Inhibitor Length = 535 Back     alignment and structure
>pdb|4HZR|A Chain A, Crystal Structure Of Ack1 Kinase Domain Length = 277 Back     alignment and structure
>pdb|3OEZ|A Chain A, Crystal Structure Of The L317i Mutant Of The Chicken C-Src Tyrosine Kinase Domain Complexed With Imatinib Length = 286 Back     alignment and structure
>pdb|4ID7|A Chain A, Ack1 Kinase In Complex With The Inhibitor Cis-3-[8-amino-1-(4- Phenoxyphenyl)imidazo[1,5-a]pyrazin-3-yl]cyclobutanol Length = 273 Back     alignment and structure
>pdb|3GI3|A Chain A, Crystal Structure Of A N-Phenyl-N'-Naphthylurea Analog In Complex With P38 Map Kinase Length = 360 Back     alignment and structure
>pdb|3G6H|A Chain A, Src Thr338ile Inhibited In The Dfg-Asp-Out Conformation Length = 286 Back     alignment and structure
>pdb|3DQW|A Chain A, C-Src Kinase Domain Thr338ile Mutant In Complex With Atpgs Length = 286 Back     alignment and structure
>pdb|2ZOQ|A Chain A, Structural Dissection Of Human Mitogen-Activated Kinase Erk1 Length = 382 Back     alignment and structure
>pdb|1RQQ|A Chain A, Crystal Structure Of The Insulin Receptor Kinase In Complex With The Sh2 Domain Of Aps Length = 306 Back     alignment and structure
>pdb|2Z8C|A Chain A, Phosphorylated Insulin Receptor Tyrosine Kinase In Complex With (4-{[5-Carbamoyl-4-(3-Methylanilino)pyrimidin-2- Yl]amino}phenyl)acetic Acid Length = 303 Back     alignment and structure
>pdb|1IR3|A Chain A, Phosphorylated Insulin Receptor Tyrosine Kinase In Complex With Peptide Substrate And Atp Analog Length = 306 Back     alignment and structure
>pdb|3P23|A Chain A, Crystal Structure Of The Human Kinase And Rnase Domains In Complex With Adp Length = 432 Back     alignment and structure
>pdb|2PVF|A Chain A, Crystal Structure Of Tyrosine Phosphorylated Activated Fgf Receptor 2 (Fgfr2) Kinase Domain In Complex With Atp Analog And Substrate Peptide Length = 334 Back     alignment and structure
>pdb|3MTL|A Chain A, Crystal Structure Of The Pctaire1 Kinase In Complex With Ind E804 Length = 324 Back     alignment and structure
>pdb|4E4L|A Chain A, Jak1 Kinase (Jh1 Domain) In Complex With Compound 30 Length = 302 Back     alignment and structure
>pdb|3EYG|A Chain A, Crystal Structures Of Jak1 And Jak2 Inhibitor Complexes Length = 290 Back     alignment and structure
>pdb|3NR9|A Chain A, Structure Of Human Cdc2-Like Kinase 2 (Clk2) Length = 368 Back     alignment and structure
>pdb|2B9F|A Chain A, Crystal Structure Of Non-Phosphorylated Fus3 Length = 353 Back     alignment and structure
>pdb|2F9G|A Chain A, Crystal Structure Of Fus3 Phosphorylated On Tyr182 Length = 353 Back     alignment and structure
>pdb|3DTC|A Chain A, Crystal Structure Of Mixed-Lineage Kinase Mlk1 Complexed With Compound 16 Length = 271 Back     alignment and structure
>pdb|1GJO|A Chain A, The Fgfr2 Tyrosine Kinase Domain Length = 316 Back     alignment and structure
>pdb|2B9H|A Chain A, Crystal Structure Of Fus3 With A Docking Motif From Ste7 Length = 353 Back     alignment and structure
>pdb|3CIK|A Chain A, Human Grk2 In Complex With Gbetagamma Subunits Length = 689 Back     alignment and structure
>pdb|3CLY|A Chain A, Crystal Structure Of Fgf Receptor 2 (Fgfr2) Kinase Domains Trapped In Trans-Phosphorylation Reaction Length = 334 Back     alignment and structure
>pdb|3RI1|A Chain A, Crystal Structure Of The Catalytic Domain Of Fgfr2 Kinase In Complex With Arq 069 Length = 313 Back     alignment and structure
>pdb|3NIE|A Chain A, Crystal Structure Of Pf11_0147 Length = 429 Back     alignment and structure
>pdb|3KRW|A Chain A, Human Grk2 In Complex With Gbetgamma Subunits And Balanol (Soak) Length = 688 Back     alignment and structure
>pdb|2PSQ|A Chain A, Crystal Structure Of Unphosphorylated Unactivated Wild Type Fgf Receptor 2 (Fgfr2) Kinase Domain Length = 370 Back     alignment and structure
>pdb|1OMW|A Chain A, Crystal Structure Of The Complex Between G Protein-Coupled Receptor Kinase 2 And Heterotrimeric G Protein Beta 1 And Gamma 2 Subunits Length = 689 Back     alignment and structure
>pdb|3PSC|A Chain A, Bovine Grk2 In Complex With Gbetagamma Subunits Length = 695 Back     alignment and structure
>pdb|3GEQ|A Chain A, Structural Basis For The Chemical Rescue Of Src Kinase Activity Length = 286 Back     alignment and structure
>pdb|3B2T|A Chain A, Structure Of Phosphotransferase Length = 311 Back     alignment and structure
>pdb|2PZP|A Chain A, Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase Domain Harboring The Pathogenic K526e Mutation Responsible For Crouzon Syndrome Length = 324 Back     alignment and structure
>pdb|2PZ5|A Chain A, Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase Domain Harboring The Pathogenic N549t Mutation Responsible For Pfeiffer Syndrome Length = 324 Back     alignment and structure
>pdb|2PVY|A Chain A, Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase Domain Harboring The Pathogenic K659n Mutation Responsible For An Unclassified Craniosynostosis Syndrome. Length = 324 Back     alignment and structure
>pdb|1AD5|A Chain A, Src Family Kinase Hck-Amp-Pnp Complex Length = 438 Back     alignment and structure
>pdb|2Q0B|A Chain A, Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase Domain Harboring The Pathogenic E565a Mutation Responsible For Pfeiffer Syndrome Length = 324 Back     alignment and structure
>pdb|2PY3|A Chain A, Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase Domain Harboring The Pathogenic E565g Mutation Responsible For Pfeiffer Syndrome Length = 324 Back     alignment and structure
>pdb|2VD5|A Chain A, Structure Of Human Myotonic Dystrophy Protein Kinase In Complex With The Bisindoylmaleide Inhibitor Bim Viii Length = 412 Back     alignment and structure
>pdb|3RP9|A Chain A, Crystal Structure Of The Apo Mapk From Toxoplasma Gondii, 25.M01780 Or Tgme49_007820 Length = 458 Back     alignment and structure
>pdb|2PWL|A Chain A, Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase Domain Harboring The Pathogenic N549h Mutation Responsible For Crouzon Syndrome. Length = 324 Back     alignment and structure
>pdb|3HKO|A Chain A, Crystal Structure Of A Cdpk Kinase Domain From Cryptosporidium Parvum, Cgd7_40 Length = 345 Back     alignment and structure
>pdb|3HKO|A Chain A, Crystal Structure Of A Cdpk Kinase Domain From Cryptosporidium Parvum, Cgd7_40 Length = 345 Back     alignment and structure
>pdb|2P2H|A Chain A, Crystal Structure Of The Vegfr2 Kinase Domain In Complex With A Pyridinyl-Triazine Inhibitor Length = 314 Back     alignment and structure
>pdb|2OGV|A Chain A, Crystal Structure Of The Autoinhibited Human C-Fms Kinase Domain Length = 317 Back     alignment and structure
>pdb|4AGU|A Chain A, Crystal Structure Of The Human Cdkl1 Kinase Domain Length = 311 Back     alignment and structure
>pdb|4AGU|A Chain A, Crystal Structure Of The Human Cdkl1 Kinase Domain Length = 311 Back     alignment and structure
>pdb|2P2I|A Chain A, Crystal Structure Of The Vegfr2 Kinase Domain In Complex With A Nicotinamide Inhibitor Length = 314 Back     alignment and structure
>pdb|1YWN|A Chain A, Vegfr2 In Complex With A Novel 4-amino-furo[2,3-d]pyrimidine Length = 316 Back     alignment and structure
>pdb|2PTK|A Chain A, Chicken Src Tyrosine Kinase Length = 453 Back     alignment and structure
>pdb|1IRK|A Chain A, Crystal Structure Of The Tyrosine Kinase Domain Of The Human Insulin Receptor Length = 306 Back     alignment and structure
>pdb|2OH4|A Chain A, Crystal Structure Of Vegfr2 With A Benzimidazole-Urea Inhibitor Length = 316 Back     alignment and structure
>pdb|3FPQ|A Chain A, Crystal Structure Of The Kinase Domain Of Wnk1 Length = 290 Back     alignment and structure
>pdb|3PLS|A Chain A, Ron In Complex With Ligand Amp-Pnp Length = 298 Back     alignment and structure
>pdb|3ETA|A Chain A, Kinase Domain Of Insulin Receptor Complexed With A Pyrrolo Pyridine Inhibitor Length = 317 Back     alignment and structure
>pdb|3LCD|A Chain A, Inhibitor Bound To A Dfg-In Structure Of The Kinase Domain Of Csf-1r Length = 329 Back     alignment and structure
>pdb|3PPZ|A Chain A, Crystal Structure Of Ctr1 Kinase Domain In Complex With Staurosporine Length = 309 Back     alignment and structure
>pdb|3PPZ|A Chain A, Crystal Structure Of Ctr1 Kinase Domain In Complex With Staurosporine Length = 309 Back     alignment and structure
>pdb|3HGK|A Chain A, Crystal Structure Of Effect Protein Avrptob Complexed With Kinase Pto Length = 327 Back     alignment and structure
>pdb|3C7Q|A Chain A, Structure Of Vegfr2 Kinase Domain In Complex With Bibf1120 Length = 316 Back     alignment and structure
>pdb|3U6J|A Chain A, Crystal Structure Of The Vegfr2 Kinase Domain In Complex With A Pyrazolone Inhibitor Length = 314 Back     alignment and structure
>pdb|2PZR|A Chain A, Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase Domain Harboring The Pathogenic K641r Mutation Responsible For Pfeiffer Syndrome Length = 324 Back     alignment and structure
>pdb|1I44|A Chain A, Crystallographic Studies Of An Activation Loop Mutant Of The Insulin Receptor Tyrosine Kinase Length = 306 Back     alignment and structure
>pdb|3EWH|A Chain A, Crystal Structure Of The Vegfr2 Kinase Domain In Complex With A Pyridyl-Pyrimidine Benzimidazole Inhibitor Length = 314 Back     alignment and structure
>pdb|2QOK|A Chain A, Human Epha3 Kinase And Juxtamembrane Region, Y596f:y602f:s768a Triple Mutant Length = 373 Back     alignment and structure
>pdb|2I1M|A Chain A, Cfms Tyrosine Kinase (Tie2 Kid) In Complex With An Arylamide Inhibitor Length = 333 Back     alignment and structure
>pdb|1VR2|A Chain A, Human Vascular Endothelial Growth Factor Receptor 2 (Kdr) Kinase Domain Length = 316 Back     alignment and structure
>pdb|2XIR|A Chain A, Crystal Structure Of The Vegfr2 Kinase Domain In Complex With Pf-00337210 (N,2-Dimethyl-6-(7-(2-Morpholinoethoxy) Quinolin-4-Yloxy)benzofuran-3-Carboxamide) Length = 316 Back     alignment and structure
>pdb|3O17|A Chain A, Crystal Structure Of Jnk1-Alpha1 Isoform Length = 370 Back     alignment and structure
>pdb|3O17|A Chain A, Crystal Structure Of Jnk1-Alpha1 Isoform Length = 370 Back     alignment and structure
>pdb|4AGC|A Chain A, Crystal Structure Of Vegfr2 (Juxtamembrane And Kinase Domains) In Complex With Axitinib (Ag-013736) (N-Methyl-2-( 3-((E)-2-Pyridin-2-Yl-Vinyl)-1h-Indazol-6-Ylsulfanyl)- Benzamide) Length = 353 Back     alignment and structure
>pdb|3VHE|A Chain A, Crystal Structure Of Human Vegfr2 Kinase Domain With A Novel Pyrrolopyrimidine Inhibitor Length = 359 Back     alignment and structure
>pdb|3VNT|A Chain A, Crystal Structure Of The Kinase Domain Of Human Vegfr2 With A [1, 3]thiazolo[5,4-B]pyridine Derivative Length = 318 Back     alignment and structure
>pdb|3VHK|A Chain A, Crystal Structure Of The Vegfr2 Kinase Domain In Complex With A Back Pocket Binder Length = 368 Back     alignment and structure
>pdb|1Y6A|A Chain A, Crystal Structure Of Vegfr2 In Complex With A 2-Anilino-5-Aryl-Oxazole Inhibitor Length = 366 Back     alignment and structure
>pdb|3VID|A Chain A, Crystal Structure Of Human Vegfr2 Kinase Domain With Compound A Length = 356 Back     alignment and structure
>pdb|2QKW|B Chain B, Structural Basis For Activation Of Plant Immunity By Bacterial Effector Protein Avrpto Length = 321 Back     alignment and structure
>pdb|3VUK|A Chain A, Crystal Structure Of A Cysteine-deficient Mutant M5 In Map Kinase Jnk1 Length = 370 Back     alignment and structure
>pdb|3VUK|A Chain A, Crystal Structure Of A Cysteine-deficient Mutant M5 In Map Kinase Jnk1 Length = 370 Back     alignment and structure
>pdb|3KVX|A Chain A, Jnk3 Bound To Aminopyrimidine Inhibitor, Sr-3562 Length = 364 Back     alignment and structure
>pdb|3FI3|A Chain A, Crystal Structure Of Jnk3 With Indazole Inhibitor, Sr-3737 Length = 364 Back     alignment and structure
>pdb|2NRY|A Chain A, Crystal Structure Of Irak-4 Length = 307 Back     alignment and structure
>pdb|4E7W|A Chain A, Structure Of Gsk3 From Ustilago Maydis Length = 394 Back     alignment and structure
>pdb|2R9S|A Chain A, C-Jun N-Terminal Kinase 3 With 3,5-Disubstituted Quinoline Inhibitor Length = 356 Back     alignment and structure
>pdb|3SDJ|A Chain A, Structure Of Rnase-Inactive Point Mutant Of Oligomeric KinaseRNASE Ire1 Length = 448 Back     alignment and structure
>pdb|3SDJ|A Chain A, Structure Of Rnase-Inactive Point Mutant Of Oligomeric KinaseRNASE Ire1 Length = 448 Back     alignment and structure
>pdb|2NRU|A Chain A, Crystal Structure Of Irak-4 Length = 307 Back     alignment and structure
>pdb|3P86|A Chain A, Crystal Structure Of Ctr1 Kinase Domain Mutant D676n In Complex With Staurosporine Length = 309 Back     alignment and structure
>pdb|3FBV|A Chain A, Crystal Structure Of The Oligomer Formed By The Kinase-Ribonuclease Domain Of Ire1 Length = 448 Back     alignment and structure
>pdb|3FBV|A Chain A, Crystal Structure Of The Oligomer Formed By The Kinase-Ribonuclease Domain Of Ire1 Length = 448 Back     alignment and structure
>pdb|3LL6|A Chain A, Crystal Structure Of The Human Cyclin G Associated Kinase (gak) Length = 337 Back     alignment and structure
>pdb|3LL6|A Chain A, Crystal Structure Of The Human Cyclin G Associated Kinase (gak) Length = 337 Back     alignment and structure
>pdb|3CJF|A Chain A, Crystal Structure Of Vegfr2 In Complex With A 3,4,5-Trimethoxy Aniline Containing Pyrimidine Length = 309 Back     alignment and structure
>pdb|3PP0|A Chain A, Crystal Structure Of The Kinase Domain Of Human Her2 (Erbb2). Length = 338 Back     alignment and structure
>pdb|4ASZ|A Chain A, Crystal Structure Of Apo Trkb Kinase Domain Length = 299 Back     alignment and structure
>pdb|3N9X|A Chain A, Crystal Structure Of Map Kinase From Plasmodium Berghei, Pb000659.00.0 Length = 432 Back     alignment and structure
>pdb|3CJG|A Chain A, Crystal Structure Of Vegfr2 In Complex With A 3,4,5-Trimethoxy Aniline Containing Pyrimidine Length = 309 Back     alignment and structure
>pdb|2OIB|A Chain A, Crystal Structure Of Irak4 Kinase Domain Apo Form Length = 301 Back     alignment and structure
>pdb|3GBZ|A Chain A, Structure Of The Cmgc Cdk Kinase From Giardia Lamblia Length = 329 Back     alignment and structure
>pdb|2O8Y|A Chain A, Apo Irak4 Kinase Domain Length = 298 Back     alignment and structure
>pdb|3BEA|A Chain A, Cfms Tyrosine Kinase (Tie2 Kid) In Complex With A Pyrimidinopyridone Inhibitor Length = 333 Back     alignment and structure
>pdb|2I0V|A Chain A, C-Fms Tyrosine Kinase In Complex With A Quinolone Inhibitor Length = 335 Back     alignment and structure
>pdb|4H1J|A Chain A, Crystal Structure Of Pyk2 With The Pyrazole 13a Length = 293 Back     alignment and structure
>pdb|3FZO|A Chain A, Crystal Structure Of Pyk2-Apo, Proline-Rich Tyrosine Kinase Length = 277 Back     alignment and structure
>pdb|2QOC|A Chain A, Human Epha3 Kinase Domain, Phosphorylated, Amp-Pnp Bound Structure Length = 344 Back     alignment and structure
>pdb|3LCO|A Chain A, Inhibitor Bound To A Dfg-Out Structure Of The Kinase Domain Of Csf-1r Length = 324 Back     alignment and structure
>pdb|3V3V|A Chain A, Structural And Functional Analysis Of Quercetagetin, A Natural Jnk1 Inhibitor Length = 379 Back     alignment and structure
>pdb|3V3V|A Chain A, Structural And Functional Analysis Of Quercetagetin, A Natural Jnk1 Inhibitor Length = 379 Back     alignment and structure
>pdb|2QOO|A Chain A, Human Epha3 Kinase And Juxtamembrane Region, Y596f:y602f:y742f Triple Mutant Length = 373 Back     alignment and structure
>pdb|3CC6|A Chain A, Crystal Structure Of Kinase Domain Of Protein Tyrosine Kinase 2 Beta (ptk2b) Length = 281 Back     alignment and structure
>pdb|2QOB|A Chain A, Human Epha3 Kinase Domain, Base Structure Length = 344 Back     alignment and structure
>pdb|1Z57|A Chain A, Crystal Structure Of Human Clk1 In Complex With 10z-Hymenialdisine Length = 339 Back     alignment and structure
>pdb|3DZQ|A Chain A, Human Epha3 Kinase Domain In Complex With Inhibitor Awl-Ii- 38.3 Length = 361 Back     alignment and structure
>pdb|2XS0|A Chain A, Linear Binding Motifs For Jnk And For Calcineurin Antagonistically Control The Nuclear Shuttling Of Nfat4 Length = 386 Back     alignment and structure
>pdb|2XS0|A Chain A, Linear Binding Motifs For Jnk And For Calcineurin Antagonistically Control The Nuclear Shuttling Of Nfat4 Length = 386 Back     alignment and structure
>pdb|2QON|A Chain A, Human Epha3 Kinase And Juxtamembrane Region, Y596f:y602f:y742a Triple Mutant Length = 373 Back     alignment and structure
>pdb|2RIO|A Chain A, Structure Of The Dual Enzyme Ire1 Reveals The Basis For Catalysis And Regulation Of Non-conventional Splicing Length = 434 Back     alignment and structure
>pdb|2RIO|A Chain A, Structure Of The Dual Enzyme Ire1 Reveals The Basis For Catalysis And Regulation Of Non-conventional Splicing Length = 434 Back     alignment and structure
>pdb|1YVJ|A Chain A, Crystal Structure Of The Jak3 Kinase Domain In Complex With A Staurosporine Analogue Length = 290 Back     alignment and structure
>pdb|3LJ0|A Chain A, Ire1 Complexed With Adp And Quercetin Length = 434 Back     alignment and structure
>pdb|3LJ0|A Chain A, Ire1 Complexed With Adp And Quercetin Length = 434 Back     alignment and structure
>pdb|1UKH|A Chain A, Structural Basis For The Selective Inhibition Of Jnk1 By The Scaffolding Protein Jip1 And Sp600125 Length = 369 Back     alignment and structure
>pdb|1UKH|A Chain A, Structural Basis For The Selective Inhibition Of Jnk1 By The Scaffolding Protein Jip1 And Sp600125 Length = 369 Back     alignment and structure
>pdb|2XRW|A Chain A, Linear Binding Motifs For Jnk And For Calcineurin Antagonistically Control The Nuclear Shuttling Of Nfat4 Length = 371 Back     alignment and structure
>pdb|2XRW|A Chain A, Linear Binding Motifs For Jnk And For Calcineurin Antagonistically Control The Nuclear Shuttling Of Nfat4 Length = 371 Back     alignment and structure
>pdb|3LXK|A Chain A, Structural And Thermodynamic Characterization Of The Tyk2 And Jak3 Kinase Domains In Complex With Cp-690550 And Cmp-6 Length = 327 Back     alignment and structure
>pdb|2QO7|A Chain A, Human Epha3 Kinase And Juxtamembrane Region, Dephosphorylated, Amp-Pnp Bound Length = 373 Back     alignment and structure
>pdb|3FXX|A Chain A, Human Epha3 Kinase And Juxtamembrane Region Bound To Substrate Kqwdnye[ptyr]iw Length = 371 Back     alignment and structure
>pdb|2QOF|A Chain A, Human Epha3 Kinase And Juxtamembrane Region, Y596f Mutant Length = 373 Back     alignment and structure
>pdb|2QOD|A Chain A, Human Epha3 Kinase And Juxtamembrane Region, Y602f Mutant Length = 373 Back     alignment and structure
>pdb|2GSF|A Chain A, The Human Epha3 Receptor Tyrosine Kinase And Juxtamembrane Region Length = 373 Back     alignment and structure
>pdb|3VUL|A Chain A, Crystal Structure Of A Cysteine-deficient Mutant M1 In Map Kinase Jnk1 Length = 370 Back     alignment and structure
>pdb|3VUM|A Chain A, Crystal Structure Of A Cysteine-deficient Mutant M7 In Map Kinase Jnk1 Length = 370 Back     alignment and structure
>pdb|4HVD|A Chain A, Jak3 Kinase Domain In Complex With 2-cyclopropyl-5h-pyrrolo[2,3- B]pyrazine-7-carboxylic Acid ((s)-1,2,2-trimethyl-propyl)-amide Length = 314 Back     alignment and structure
>pdb|3PJC|A Chain A, Crystal Structure Of Jak3 Complexed With A Potent Atp Site Inhibitor Showing High Selectivity Within The Janus Kinase Family Length = 315 Back     alignment and structure
>pdb|2QOI|A Chain A, Human Epha3 Kinase And Juxtamembrane Region, Y596f:y602f Double Mutant Length = 373 Back     alignment and structure
>pdb|2DQ7|X Chain X, Crystal Structure Of Fyn Kinase Domain Complexed With Staurosporine Length = 283 Back     alignment and structure
>pdb|1P14|A Chain A, Crystal Structure Of A Catalytic-Loop Mutant Of The Insulin Receptor Tyrosine Kinase Length = 306 Back     alignment and structure
>pdb|3TTJ|A Chain A, Crystal Structure Of Jnk3 Complexed With Cc-359, A Jnk Inhibitor For The Prevention Of Ischemia-Reperfusion Injury Length = 464 Back     alignment and structure
>pdb|3NPC|A Chain A, Crystal Structure Of Jnk2 Complexed With Birb796 Length = 364 Back     alignment and structure
>pdb|3EKK|A Chain A, Insulin Receptor Kinase Complexed With An Inhibitor Length = 307 Back     alignment and structure
>pdb|3F61|A Chain A, Crystal Structure Of M. Tuberculosis Pknb Leu33aspVAL222ASP DOUBLE MUTANT IN COMPLEX WITH ADP Length = 311 Back     alignment and structure
>pdb|3KGA|A Chain A, Crystal Structure Of Mapkap Kinase 2 (Mk2) Complexed With A Potent 3-Aminopyrazole Atp Site Inhibitor Length = 299 Back     alignment and structure
>pdb|2QOL|A Chain A, Human Epha3 Kinase And Juxtamembrane Region, Y596:y602:s768g Triple Mutant Length = 373 Back     alignment and structure
>pdb|3ORI|A Chain A, Mycobacterium Tuberculosis Pknb Kinase Domain L33d Mutant (Crystal Form 1) Length = 311 Back     alignment and structure
>pdb|3F69|A Chain A, Crystal Structure Of The Mycobacterium Tuberculosis Pknb Mutant Kinase Domain In Complex With Kt5720 Length = 311 Back     alignment and structure
>pdb|3C4F|A Chain A, Fgfr Tyrosine Kinase Domain In Complex With 3-(3- Methoxybenzyl)-7-Azaindole Length = 302 Back     alignment and structure
>pdb|2REI|A Chain A, Kinase Domain Of Human Ephrin Type-a Receptor 7 (epha7) Length = 318 Back     alignment and structure
>pdb|1MRU|A Chain A, Intracellular SerTHR PROTEIN KINASE DOMAIN OF Mycobacterium Tuberculosis Pknb. Length = 311 Back     alignment and structure
>pdb|1O6Y|A Chain A, Catalytic Domain Of Pknb Kinase From Mycobacterium Tuberculosis Length = 299 Back     alignment and structure
>pdb|3ORM|A Chain A, Mycobacterium Tuberculosis Pknb Kinase Domain D76a Mutant Length = 311 Back     alignment and structure
>pdb|2G01|A Chain A, Pyrazoloquinolones As Novel, Selective Jnk1 Inhibitors Length = 370 Back     alignment and structure
>pdb|1FGK|A Chain A, Crystal Structure Of The Tyrosine Kinase Domain Of Fibroblast Growth Factor Receptor 1 Length = 310 Back     alignment and structure
>pdb|1PMN|A Chain A, Crystal Structure Of Jnk3 In Complex With An Imidazole- Pyrimidine Inhibitor Length = 364 Back     alignment and structure
>pdb|4F63|A Chain A, Crystal Structure Of Human Fibroblast Growth Factor Receptor 1 Kinase Domain In Complex With Compound 1 Length = 309 Back     alignment and structure
>pdb|3RHX|B Chain B, Crystal Structure Of The Catalytic Domain Of Fgfr1 Kinase In Complex With Arq 069 Length = 306 Back     alignment and structure
>pdb|3ELJ|A Chain A, Jnk1 Complexed With A Bis-Anilino-Pyrrolopyrimidine Inhibitor Length = 369 Back     alignment and structure
>pdb|2B1P|A Chain A, Inhibitor Complex Of Jnk3 Length = 355 Back     alignment and structure
>pdb|4H36|A Chain A, Crystal Structure Of Jnk3 In Complex With Atf2 Peptide Length = 356 Back     alignment and structure
>pdb|3PTG|A Chain A, Design And Synthesis Of A Novel, Orally Efficacious Tri-Substituted Thiophene Based Jnk Inhibitor Length = 363 Back     alignment and structure
>pdb|3KXX|A Chain A, Structure Of The Mutant Fibroblast Growth Factor Receptor 1 Length = 317 Back     alignment and structure
>pdb|3JS2|A Chain A, Crystal Structure Of Minimal Kinase Domain Of Fibroblast Growth Factor Receptor 1 In Complex With 5-(2-Thienyl) Nicotinic Acid Length = 317 Back     alignment and structure
>pdb|3GQL|A Chain A, Crystal Structure Of Activated Receptor Tyrosine Kinase In Complex With Substrates Length = 326 Back     alignment and structure
>pdb|3E7O|A Chain A, Crystal Structure Of Jnk2 Length = 360 Back     alignment and structure
>pdb|1JNK|A Chain A, The C-Jun N-Terminal Kinase (Jnk3s) Complexed With Mgamp-Pnp Length = 423 Back     alignment and structure
>pdb|2O0U|A Chain A, Crystal Structure Of Human Jnk3 Complexed With N-{3-Cyano-6-[3-(1- Piperidinyl)propanoyl]-4,5,6,7-Tetrahydrothieno[2, 3-C]pyridin-2-Yl}- 1-Naphthalenecarboxamide Length = 364 Back     alignment and structure
>pdb|3GQI|A Chain A, Crystal Structure Of Activated Receptor Tyrosine Kinase In Complex With Substrates Length = 326 Back     alignment and structure
>pdb|2EXC|X Chain X, Inhibitor Complex Of Jnk3 Length = 356 Back     alignment and structure
>pdb|3OXI|A Chain A, Design And Synthesis Of Disubstituted Thiophene And Thiazole Based Inhibitors Of Jnk For The Treatment Of Neurodegenerative Diseases Length = 362 Back     alignment and structure
>pdb|3PZE|A Chain A, Jnk1 In Complex With Inhibitor Length = 358 Back     alignment and structure
>pdb|3FI2|A Chain A, Crystal Structure Of Jnk3 With Amino-Pyrazole Inhibitor, Sr- 3451 Length = 353 Back     alignment and structure
>pdb|2OK1|A Chain A, Crystal Structure Of Jnk3 Bound To N-Benzyl-4-(4-(3- Chlorophenyl)-1h-Pyrazol-3-Yl)-1h-Pyrrole-2-Carboxamide Length = 365 Back     alignment and structure
>pdb|3VUD|A Chain A, Crystal Structure Of A Cysteine-deficient Mutant M1 In Map Kinase Jnk1 Length = 370 Back     alignment and structure
>pdb|3VUD|A Chain A, Crystal Structure Of A Cysteine-deficient Mutant M1 In Map Kinase Jnk1 Length = 370 Back     alignment and structure
>pdb|3TT0|A Chain A, Co-Structure Of Fibroblast Growth Factor Receptor 1 Kinase Domain With 3-(2,6-Dichloro-3, 5-Dimethoxy-Phenyl)-1-{6-[4-(4-Ethyl-Piperazin-1- Yl)-Phenylamino]-Pyrimidin-4-Yl}-1-Methyl-Urea (Bgj398) Length = 382 Back     alignment and structure
>pdb|3FV8|A Chain A, Jnk3 Bound To Piperazine Amide Inhibitor, Sr2774 Length = 355 Back     alignment and structure
>pdb|3VUH|A Chain A, Crystal Structure Of A Cysteine-deficient Mutant M3 In Map Kinase Jnk1 Length = 370 Back     alignment and structure
>pdb|2IWI|A Chain A, Crystal Structure Of The Human Pim2 In Complex With A Ruthenium Organometallic Ligand Ru1 Length = 312 Back     alignment and structure
>pdb|4EBW|A Chain A, Structure Of Focal Adhesion Kinase Catalytic Domain In Complex With Novel Allosteric Inhibitor Length = 304 Back     alignment and structure
>pdb|3VUI|A Chain A, Crystal Structure Of A Cysteine-deficient Mutant M2 In Map Kinase Jnk1 Length = 370 Back     alignment and structure
>pdb|3BZ3|A Chain A, Crystal Structure Analysis Of Focal Adhesion Kinase With A Methanesulfonamide Diaminopyrimidine Inhibitor Length = 276 Back     alignment and structure
>pdb|2R2P|A Chain A, Kinase Domain Of Human Ephrin Type-A Receptor 5 (Epha5) Length = 295 Back     alignment and structure
>pdb|3VUG|A Chain A, Crystal Structure Of A Cysteine-deficient Mutant M2 In Map Kinase Jnk1 Length = 370 Back     alignment and structure
>pdb|3PXK|A Chain A, Focal Adhesion Kinase Catalytic Domain In Complex With Pyrrolo[2,3- D]thiazole Length = 282 Back     alignment and structure
>pdb|2JKM|A Chain A, Focal Adhesion Kinase Catalytic Domain In Complex With Bis- Anilino Pyrimidine Inhibitor Length = 276 Back     alignment and structure
>pdb|2ETM|A Chain A, Crystal Structure Of Focal Adhesion Kinase Domain Complexed With 7h-Pyrrolo [2,3-D] Pyrimidine Derivative Length = 281 Back     alignment and structure
>pdb|2J0M|B Chain B, Crystal Structure A Two-Chain Complex Between The Ferm And Kinase Domains Of Focal Adhesion Kinase. Length = 276 Back     alignment and structure
>pdb|1MP8|A Chain A, Crystal Structure Of Focal Adhesion Kinase (Fak) Length = 281 Back     alignment and structure
>pdb|4GG5|A Chain A, Crystal Structure Of Cmet In Complex With Novel Inhibitor Length = 319 Back     alignment and structure
>pdb|3Q6W|A Chain A, Structure Of Dually-phosphorylated Met Receptor Kinase In Complex With An Mk-2461 Analog With Specificity For The Activated Receptor Length = 307 Back     alignment and structure
>pdb|2WD1|A Chain A, Human C-Met Kinase In Complex With Azaindole Inhibitor Length = 292 Back     alignment and structure
>pdb|2J0L|A Chain A, Crystal Structure Of A The Active Conformation Of The Kinase Domain Of Focal Adhesion Kinase With A Phosphorylated Activation Loop Length = 276 Back     alignment and structure
>pdb|3Q6U|A Chain A, Structure Of The Apo Met Receptor Kinase In The Dually-Phosphorylated, Activated State Length = 308 Back     alignment and structure
>pdb|2WGJ|A Chain A, X-Ray Structure Of Pf-02341066 Bound To The Kinase Domain Of C-Met Length = 306 Back     alignment and structure
>pdb|3I5N|A Chain A, Crystal Structure Of C-Met With Triazolopyridazine Inhibitor 13 Length = 309 Back     alignment and structure
>pdb|2RFN|A Chain A, X-ray Structure Of C-met With Inhibitor. Length = 310 Back     alignment and structure
>pdb|3F66|A Chain A, Human C-Met Kinase In Complex With Quinoxaline Inhibitor Length = 298 Back     alignment and structure
>pdb|2G15|A Chain A, Structural Characterization Of Autoinhibited C-Met Kinase Length = 318 Back     alignment and structure
>pdb|3MIY|A Chain A, X-Ray Crystal Structure Of Itk Complexed With Sunitinib Length = 266 Back     alignment and structure
>pdb|3LQ8|A Chain A, Structure Of The Kinase Domain Of C-Met Bound To Xl880 (Gsk1 Length = 302 Back     alignment and structure
>pdb|1Q5K|A Chain A, Crystal Structure Of Glycogen Synthase Kinase 3 In Complexed With Inhibitor Length = 414 Back     alignment and structure
>pdb|2RFD|A Chain A, Crystal Structure Of The Complex Between The Egfr Kinase Domain And A Mig6 Peptide Length = 324 Back     alignment and structure
>pdb|1PYX|A Chain A, Gsk-3 Beta Complexed With Amp-Pnp Length = 422 Back     alignment and structure
>pdb|1JPA|A Chain A, Crystal Structure Of Unphosphorylated Ephb2 Receptor Tyrosine Kinase And Juxtamembrane Region Length = 312 Back     alignment and structure
>pdb|1I09|A Chain A, Structure Of Glycogen Synthase Kinase-3 (Gsk3b) Length = 420 Back     alignment and structure
>pdb|3SAY|A Chain A, Crystal Structure Of Human Glycogen Synthase Kinase 3 Beta (Gsk3b) In Complex With Inhibitor 142 Length = 430 Back     alignment and structure
>pdb|1Q3D|A Chain A, Gsk-3 Beta Complexed With Staurosporine Length = 424 Back     alignment and structure
>pdb|4E6D|A Chain A, Jak2 Kinase (Jh1 Domain) Triple Mutant In Complex With Compound 7 Length = 298 Back     alignment and structure
>pdb|2J0J|A Chain A, Crystal Structure Of A Fragment Of Focal Adhesion Kinase Containing The Ferm And Kinase Domains Length = 656 Back     alignment and structure
>pdb|2HEL|A Chain A, Crystal Structure Of A Mutant Epha4 Kinase Domain (Y742a) Length = 306 Back     alignment and structure
>pdb|4ACC|A Chain A, Gsk3b In Complex With Inhibitor Length = 465 Back     alignment and structure
>pdb|2W1I|A Chain A, Structure Determination Of Aurora Kinase In Complex With Inhibitor Length = 326 Back     alignment and structure
>pdb|3E62|A Chain A, Fragment Based Discovery Of Jak-2 Inhibitors Length = 293 Back     alignment and structure
>pdb|3TJC|A Chain A, Co-Crystal Structure Of Jak2 With Thienopyridine 8 Length = 298 Back     alignment and structure
>pdb|2XA4|A Chain A, Inhibitors Of Jak2 Kinase Domain Length = 298 Back     alignment and structure
>pdb|2B7A|A Chain A, The Structural Basis Of Janus Kinase 2 Inhibition By A Potent And Specific Pan-Janus Kinase Inhibitor Length = 293 Back     alignment and structure
>pdb|3RVG|A Chain A, Crystals Structure Of Jak2 With A 1-Amino-5h-Pyrido[4,3-B]indol-4- Carboxamide Inhibitor Length = 303 Back     alignment and structure
>pdb|3Q32|A Chain A, Structure Of Janus Kinase 2 With A Pyrrolotriazine Inhibitor Length = 301 Back     alignment and structure
>pdb|3LPB|A Chain A, Crystal Structure Of Jak2 Complexed With A Potent 2,8-Diaryl Quinoxaline Inhibitor Length = 295 Back     alignment and structure
>pdb|1R0E|A Chain A, Glycogen Synthase Kinase-3 Beta In Complex With 3-Indolyl-4- Arylmaleimide Inhibitor Length = 391 Back     alignment and structure
>pdb|4HGE|A Chain A, Jak2 Kinase (Jh1 Domain) In Complex With Compound 8 Length = 300 Back     alignment and structure
>pdb|4E4M|A Chain A, Jak2 Kinase (Jh1 Domain) In Complex With Compound 30 Length = 302 Back     alignment and structure
>pdb|4AQC|A Chain A, Triazolopyridine-Based Inhibitor Of Janus Kinase 2 Length = 301 Back     alignment and structure
>pdb|2OO8|X Chain X, Synthesis, Structural Analysis, And Sar Studies Of Triazine Derivatives As Potent, Selective Tie-2 Inhibitors Length = 317 Back     alignment and structure
>pdb|4DIT|A Chain A, Crystal Structure Of Gsk3beta In Complex With A Imidazopyridine Inhibitor Length = 382 Back     alignment and structure
>pdb|2O5K|A Chain A, Crystal Structure Of Gsk3beta In Complex With A Benzoimidazol Inhibitor Length = 372 Back     alignment and structure
>pdb|1FVR|A Chain A, Tie2 Kinase Domain Length = 327 Back     alignment and structure
>pdb|1O9U|A Chain A, Glycogen Synthase Kinase 3 Beta Complexed With Axin Peptide Length = 350 Back     alignment and structure
>pdb|1GNG|A Chain A, Glycogen Synthase Kinase-3 Beta (Gsk3) Complex With Frattide Peptide Length = 378 Back     alignment and structure
>pdb|3F7Z|A Chain A, X-ray Co-crystal Structure Of Glycogen Synthase Kinase 3beta In Complex With An Inhibitor Length = 350 Back     alignment and structure
>pdb|3F88|A Chain A, Glycogen Synthase Kinase 3beta Inhibitor Complex Length = 349 Back     alignment and structure
>pdb|1H8F|A Chain A, Glycogen Synthase Kinase 3 Beta. Length = 352 Back     alignment and structure
>pdb|4AFJ|A Chain A, 5-Aryl-4-Carboxamide-1,3-Oxazoles: Potent And Selective Gsk-3 Inhibitors Length = 367 Back     alignment and structure
>pdb|3SD0|A Chain A, Identification Of A Glycogen Synthase Kinase-3b Inhibitor That Attenuates Hyperactivity In Clock Mutant Mice Length = 350 Back     alignment and structure
>pdb|4GT4|A Chain A, Structure Of Unliganded, Inactive Ror2 Kinase Domain Length = 308 Back     alignment and structure
>pdb|2OW3|A Chain A, Glycogen Synthase Kinase-3 Beta In Complex With Bis- (Indole)maleimide Pyridinophane Inhibitor Length = 352 Back     alignment and structure
>pdb|3ZDI|A Chain A, Glycogen Synthase Kinase 3 Beta Complexed With Axin Peptide And Inhibitor 7d Length = 350 Back     alignment and structure
>pdb|2Y6M|A Chain A, Crystal Structure Of Epha4 Kinase Domain Length = 291 Back     alignment and structure
>pdb|3ZRK|A Chain A, Identification Of 2-(4-Pyridyl)thienopyridinones As Gsk-3beta Inhibitors Length = 371 Back     alignment and structure
>pdb|1UV5|A Chain A, Glycogen Synthase Kinase 3 Beta Complexed With 6-Bromoindirubin-3'-Oxime Length = 350 Back     alignment and structure
>pdb|3GB2|A Chain A, Gsk3beta Inhibitor Complex Length = 353 Back     alignment and structure
>pdb|3JY9|A Chain A, Janus Kinase 2 Inhibitors Length = 311 Back     alignment and structure
>pdb|3UGC|A Chain A, Structural Basis Of Jak2 Inhibition By The Type Ii Inhibtor Nvp-Bbt594 Length = 295 Back     alignment and structure
>pdb|3IO7|A Chain A, 2-Aminopyrazolo[1,5-A]pyrimidines As Potent And Selective Inhibitors Of Jak2 Length = 313 Back     alignment and structure
>pdb|2XYU|A Chain A, Crystal Structure Of Epha4 Kinase Domain In Complex With Vuf 12058 Length = 285 Back     alignment and structure
>pdb|3ZZW|A Chain A, Crystal Structure Of The Kinase Domain Of Ror2 Length = 289 Back     alignment and structure
>pdb|3S95|A Chain A, Crystal Structure Of The Human Limk1 Kinase Domain In Complex With Staurosporine Length = 310 Back     alignment and structure
>pdb|3T9T|A Chain A, Crystal Structure Of Btk Mutant (F435t,K596r) Complexed With Imidazo[1,5-A]quinoxaline Length = 267 Back     alignment and structure
>pdb|3C1X|A Chain A, Crystal Structure Of The Tyrosine Kinase Domain Of The Hepatocyte Growth Factor Receptor C-Met In Complex With A Pyrrolotriazine Based Inhibitor Length = 373 Back     alignment and structure
>pdb|1SM2|A Chain A, Crystal Structure Of The Phosphorylated Interleukin-2 Tyrosine Kinase Catalytic Domain Length = 264 Back     alignment and structure
>pdb|4HCT|A Chain A, Crystal Structure Of Itk In Complex With Compound 52 Length = 269 Back     alignment and structure
>pdb|3V5J|A Chain A, Crystal Structure Of Interleukin-2 Inducible T-Cell Kinase Itk Catalytic Domain With Thienopyrazolylindole Inhibitor 090 Length = 266 Back     alignment and structure
>pdb|2IVT|A Chain A, Crystal Structure Of Phosphorylated Ret Tyrosine Kinase Domain Length = 314 Back     alignment and structure
>pdb|3DKC|A Chain A, Sgx Clone 5698a65kfg1h1 Length = 317 Back     alignment and structure
>pdb|3CTH|A Chain A, Crystal Structure Of The Tyrosine Kinase Domain Of The Hepatocyte Growth Factor Receptor C-Met In Complex With A Aminopyridine Based Inhibitor Length = 314 Back     alignment and structure
>pdb|1R0P|A Chain A, Crystal Structure Of The Tyrosine Kinase Domain Of The Hepatocyte Growth Factor Receptor C-Met In Complex With The Microbial Alkaloid K-252a Length = 312 Back     alignment and structure
>pdb|3A4P|A Chain A, Human C-Met Kinase Domain Complexed With 6-Benzyloxyquinoline Inhibitor Length = 319 Back     alignment and structure
>pdb|3GVU|A Chain A, The Crystal Structure Of Human Abl2 In Complex With Gleevec Length = 292 Back     alignment and structure
>pdb|3QTI|A Chain A, C-Met Kinase In Complex With Nvp-Bvu972 Length = 314 Back     alignment and structure
>pdb|3DKG|A Chain A, Sgx Clone 5698a109kfg1h1 Length = 317 Back     alignment and structure
>pdb|1MQB|A Chain A, Crystal Structure Of Ephrin A2 (Epha2) Receptor Protein Kinase Length = 333 Back     alignment and structure
>pdb|3QGW|A Chain A, Crystal Structure Of Itk Kinase Bound To An Inhibitor Length = 286 Back     alignment and structure
>pdb|2R4B|A Chain A, Erbb4 Kinase Domain Complexed With A Thienopyrimidine Inhibitor Length = 321 Back     alignment and structure
>pdb|1S9I|A Chain A, X-Ray Structure Of The Human Mitogen-Activated Protein Kinase Kinase 2 (Mek2)in A Complex With Ligand And Mgatp Length = 354 Back     alignment and structure
>pdb|3OZ6|A Chain A, Crystal Structure Of Mapk From Cryptosporidium Parvum, Cgd2_1960 Length = 388 Back     alignment and structure
>pdb|3GOP|A Chain A, Crystal Structure Of The Egf Receptor Juxtamembrane And Kinase Domains Length = 361 Back     alignment and structure
>pdb|2VAG|A Chain A, Crystal Structure Of Di-Phosphorylated Human Clk1 In Complex With A Novel Substituted Indole Inhibitor Length = 339 Back     alignment and structure
>pdb|2Y4I|B Chain B, Ksr2-Mek1 Heterodimer Length = 319 Back     alignment and structure
>pdb|3G0F|A Chain A, Kit Kinase Domain Mutant D816h In Complex With Sunitinib Length = 336 Back     alignment and structure
>pdb|2IVS|A Chain A, Crystal Structure Of Non-Phosphorylated Ret Tyrosine Kinase Domain Length = 314 Back     alignment and structure
>pdb|4HJO|A Chain A, Crystal Structure Of The Inactive Egfr Tyrosine Kinase Domain With Erlotinib Length = 337 Back     alignment and structure
>pdb|3P1A|A Chain A, Structure Of Human Membrane-Associated Tyrosine- And Threonine- Specific Cdc2-Inhibitory Kinase Myt1 (Pkmyt1) Length = 311 Back     alignment and structure
>pdb|3V5Q|A Chain A, Discovery Of A Selective Trk Inhibitor With Efficacy In Rodent Cancer Tumor Models Length = 297 Back     alignment and structure
>pdb|2ITN|A Chain A, Crystal Structure Of Egfr Kinase Domain G719s Mutation In Complex With Amp-Pnp Length = 327 Back     alignment and structure
>pdb|2J5F|A Chain A, Crystal Structure Of Egfr Kinase Domain In Complex With An Irreversible Inhibitor 34-Jab Length = 327 Back     alignment and structure
>pdb|2EB2|A Chain A, Crystal Structure Of Mutated Egfr Kinase Domain (G719s) Length = 334 Back     alignment and structure
>pdb|2JIU|A Chain A, Crystal Structure Of Egfr Kinase Domain T790m Mutation In Complex With Aee788 Length = 328 Back     alignment and structure
>pdb|3IKA|A Chain A, Crystal Structure Of Egfr 696-1022 T790m Mutant Covalently Binding To Wz4002 Length = 331 Back     alignment and structure
>pdb|2J5E|A Chain A, Crystal Structure Of Egfr Kinase Domain In Complex With An Irreversible Inhibitor 13-Jab Length = 327 Back     alignment and structure
>pdb|4I23|A Chain A, Crystal Structure Of The Wild-type Egfr Kinase Domain In Complex With Dacomitinib (soaked) Length = 329 Back     alignment and structure
>pdb|3UG1|A Chain A, Crystal Structure Of The Mutated Egfr Kinase Domain (G719sT790M) IN The Apo Form Length = 334 Back     alignment and structure
>pdb|2GS7|A Chain A, Crystal Structure Of The Inactive Egfr Kinase Domain In Complex With Amp-Pnp Length = 330 Back     alignment and structure
>pdb|3BBT|B Chain B, Crystal Structure Of The Erbb4 Kinase In Complex With Lapatinib Length = 328 Back     alignment and structure
>pdb|3LZB|A Chain A, Egfr Kinase Domain Complexed With An Imidazo[2,1-B]thiazole Inhibitor Length = 327 Back     alignment and structure
>pdb|2JIV|A Chain A, Crystal Structure Of Egfr Kinase Domain T790m Mutation In Compex With Hki-272 Length = 328 Back     alignment and structure
>pdb|2JIT|A Chain A, Crystal Structure Of Egfr Kinase Domain T790m Mutation Length = 327 Back     alignment and structure
>pdb|4G5J|A Chain A, Crystal Structure Of Egfr Kinase In Complex With Bibw2992 Length = 330 Back     alignment and structure
>pdb|4G5P|A Chain A, Crystal Structure Of Egfr Kinase T790m In Complex With Bibw2992 Length = 330 Back     alignment and structure
>pdb|4I24|A Chain A, Structure Of T790m Egfr Kinase Domain Co-crystallized With Dacomitinib Length = 329 Back     alignment and structure
>pdb|3VJO|A Chain A, Crystal Structure Of The Wild-Type Egfr Kinase Domain In Complex With Amppnp Length = 334 Back     alignment and structure
>pdb|2GS2|A Chain A, Crystal Structure Of The Active Egfr Kinase Domain Length = 330 Back     alignment and structure
>pdb|1XKK|A Chain A, Egfr Kinase Domain Complexed With A Quinazoline Inhibitor- Gw572016 Length = 352 Back     alignment and structure
>pdb|4DGL|C Chain C, Crystal Structure Of The Ck2 Tetrameric Holoenzyme Length = 335 Back     alignment and structure
>pdb|1M14|A Chain A, Tyrosine Kinase Domain From Epidermal Growth Factor Receptor Length = 333 Back     alignment and structure
>pdb|3BEL|A Chain A, X-Ray Structure Of Egfr In Complex With Oxime Inhibitor Length = 315 Back     alignment and structure
>pdb|3KUL|A Chain A, Kinase Domain Of Human Ephrin Type-A Receptor 8 (Epha8) Length = 325 Back     alignment and structure
>pdb|3KUL|B Chain B, Kinase Domain Of Human Ephrin Type-A Receptor 8 (Epha8) Length = 325 Back     alignment and structure
>pdb|3SLS|A Chain A, Crystal Structure Of Human Mek-1 Kinase In Complex With Ucb1353770 And Amppnp Length = 304 Back     alignment and structure
>pdb|1PKG|A Chain A, Structure Of A C-kit Kinase Product Complex Length = 329 Back     alignment and structure
>pdb|3G0E|A Chain A, Kit Kinase Domain In Complex With Sunitinib Length = 336 Back     alignment and structure
>pdb|4AW5|A Chain A, Complex Of The Ephb4 Kinase Domain With An Oxindole Inhibitor Length = 291 Back     alignment and structure
>pdb|1T46|A Chain A, Structural Basis For The Autoinhibition And Sti-571 Inhibition Of C-kit Tyrosine Kinase Length = 313 Back     alignment and structure
>pdb|1T45|A Chain A, Structural Basis For The Autoinhibition And Sti-571 Inhibition Of C- Kit Tyrosine Kinase Length = 331 Back     alignment and structure
>pdb|2WQB|A Chain A, Structure Of The Tie2 Kinase Domain In Complex With A Thiazolopyrimidine Inhibitor Length = 324 Back     alignment and structure
>pdb|4BBE|A Chain A, Aminoalkylpyrimidine Inhibitor Complexes With Jak2 Length = 298 Back     alignment and structure
>pdb|2VWU|A Chain A, Ephb4 Kinase Domain Inhibitor Complex Length = 302 Back     alignment and structure
>pdb|4AN2|A Chain A, Crystal Structures Of Human Mek1 With Carboxamide-Based Allosteric Inhibitor Xl518 (Gdc-0973), Or Related Analogs. Length = 301 Back     alignment and structure
>pdb|2H34|A Chain A, Apoenzyme Crystal Structure Of The Tuberculosis SerineTHREONINE Kinase, Pkne Length = 309 Back     alignment and structure
>pdb|2JKK|A Chain A, Focal Adhesion Kinase Catalytic Domain In Complex With Bis- Anilino Pyrimidine Inhibitor Length = 276 Back     alignment and structure
>pdb|3P08|A Chain A, Crystal Structure Of The Human Btk Kinase Domain Length = 267 Back     alignment and structure
>pdb|3K54|A Chain A, Structures Of Human Bruton's Tyrosine Kinase In Active And Inactive Conformations Suggests A Mechanism Of Activation For Tec Family Kinases Length = 283 Back     alignment and structure
>pdb|1K2P|A Chain A, Crystal Structure Of Bruton's Tyrosine Kinase Domain Length = 263 Back     alignment and structure
>pdb|3GEN|A Chain A, The 1.6 A Crystal Structure Of Human Bruton's Tyrosine Kinase Bound To A Pyrrolopyrimidine-Containing Compound Length = 283 Back     alignment and structure
>pdb|3OCS|A Chain A, Crystal Structure Of Bruton's Tyrosine Kinase In Complex With Inhibitor Cgi1746 Length = 271 Back     alignment and structure
>pdb|2EXE|A Chain A, Crystal Structure Of The Phosphorylated Clk3 Length = 357 Back     alignment and structure
>pdb|3OCT|A Chain A, Crystal Structure Of Bruton's Tyrosine Kinase Mutant V555r In Complex With Dasatinib Length = 265 Back     alignment and structure
>pdb|2EU9|A Chain A, Crystal Structure Of Clk3 Length = 355 Back     alignment and structure
>pdb|2WU6|A Chain A, Crystal Structure Of The Human Clk3 In Complex With Dki Length = 381 Back     alignment and structure
>pdb|2IVV|A Chain A, Crystal Structure Of Phosphorylated Ret Tyrosine Kinase Domain Complexed With The Inhibitor Pp1 Length = 314 Back     alignment and structure
>pdb|2HEN|A Chain A, Crystal Structure Of The Ephb2 Receptor Kinase Domain In Complex With Adp Length = 286 Back     alignment and structure
>pdb|3PIX|A Chain A, Crystal Structure Of Btk Kinase Domain Complexed With 2-Isopropyl-7- (4-Methyl-Piperazin-1-Yl)-4-(5-Methyl-2h-Pyrazol-3- Ylamino)-2h- Phthalazin-1-One Length = 274 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query305
3cok_A278 Serine/threonine-protein kinase PLK4; POLO-like ki 6e-64
3cok_A 278 Serine/threonine-protein kinase PLK4; POLO-like ki 1e-29
2owb_A335 Serine/threonine-protein kinase PLK1; catalytic do 3e-60
2owb_A 335 Serine/threonine-protein kinase PLK1; catalytic do 4e-31
2owb_A335 Serine/threonine-protein kinase PLK1; catalytic do 6e-14
2rku_A294 Serine/threonine-protein kinase PLK1; structure of 2e-56
2rku_A 294 Serine/threonine-protein kinase PLK1; structure of 2e-31
2rku_A294 Serine/threonine-protein kinase PLK1; structure of 6e-14
3fdn_A279 Serine/threonine-protein kinase 6; aurora kinase i 5e-48
3fdn_A 279 Serine/threonine-protein kinase 6; aurora kinase i 5e-18
2vgo_A284 Serine/threonine-protein kinase 12-A; nucleotide-b 6e-46
2vgo_A 284 Serine/threonine-protein kinase 12-A; nucleotide-b 9e-17
4g31_A299 Eukaryotic translation initiation factor 2-alpha; 8e-41
4g31_A 299 Eukaryotic translation initiation factor 2-alpha; 2e-23
2jam_A304 Calcium/calmodulin-dependent protein kinase type 1 1e-39
2jam_A 304 Calcium/calmodulin-dependent protein kinase type 1 3e-15
3kk8_A284 Calcium/calmodulin dependent protein kinase II; AT 1e-38
3kk8_A 284 Calcium/calmodulin dependent protein kinase II; AT 3e-16
3f3z_A277 Calcium/calmodulin-dependent protein kinase with d 4e-38
3f3z_A 277 Calcium/calmodulin-dependent protein kinase with d 1e-15
2qr7_A342 Ribosomal protein S6 kinase alpha-3; kinase domain 1e-37
2qr7_A 342 Ribosomal protein S6 kinase alpha-3; kinase domain 1e-15
2bdw_A362 Hypothetical protein K11E8.1D; kinase, calmodulin 3e-37
2bdw_A 362 Hypothetical protein K11E8.1D; kinase, calmodulin 5e-16
2wei_A287 Calmodulin-domain protein kinase 1, putative; nucl 4e-37
2wei_A 287 Calmodulin-domain protein kinase 1, putative; nucl 1e-15
3soa_A444 Calcium/calmodulin-dependent protein kinase type a 6e-37
3soa_A 444 Calcium/calmodulin-dependent protein kinase type a 2e-16
3is5_A285 Calcium-dependent protein kinase; CDPK, structural 2e-36
3is5_A 285 Calcium-dependent protein kinase; CDPK, structural 2e-15
4apc_A350 Serine/threonine-protein kinase NEK1; transferase; 2e-36
4apc_A 350 Serine/threonine-protein kinase NEK1; transferase; 1e-18
3kn6_A325 Ribosomal protein S6 kinase alpha-5; AMP-PNP, MSK1 2e-36
3kn6_A 325 Ribosomal protein S6 kinase alpha-5; AMP-PNP, MSK1 2e-15
2w4o_A349 Calcium/calmodulin-dependent protein kinase type I 2e-36
2w4o_A 349 Calcium/calmodulin-dependent protein kinase type I 4e-15
1phk_A298 Phosphorylase kinase; glycogen metabolism, transfe 3e-36
1phk_A 298 Phosphorylase kinase; glycogen metabolism, transfe 2e-18
3c0i_A351 Peripheral plasma membrane protein CASK; neurexin, 7e-36
3c0i_A 351 Peripheral plasma membrane protein CASK; neurexin, 2e-16
3bhy_A283 Death-associated protein kinase 3; death associate 2e-35
3bhy_A 283 Death-associated protein kinase 3; death associate 2e-17
3hko_A345 Calcium/calmodulin-dependent protein kinase with d 3e-35
3hko_A 345 Calcium/calmodulin-dependent protein kinase with d 1e-16
2yab_A361 Death-associated protein kinase 2; apoptosis, tran 6e-35
2yab_A 361 Death-associated protein kinase 2; apoptosis, tran 8e-17
2a2a_A321 Death-associated protein kinase 2; autoinhibition, 8e-35
2a2a_A 321 Death-associated protein kinase 2; autoinhibition, 2e-17
3nyv_A484 Calmodulin-domain protein kinase 1; serine/threoni 2e-34
3nyv_A 484 Calmodulin-domain protein kinase 1; serine/threoni 3e-14
2w5a_A279 Serine/threonine-protein kinase NEK2; Ser/Thr prot 2e-34
2w5a_A 279 Serine/threonine-protein kinase NEK2; Ser/Thr prot 7e-17
2ycf_A322 Serine/threonine-protein kinase CHK2; transferase, 2e-34
2ycf_A 322 Serine/threonine-protein kinase CHK2; transferase, 3e-17
2y0a_A326 Death-associated protein kinase 1; transferase, ca 3e-34
2y0a_A 326 Death-associated protein kinase 1; transferase, ca 2e-16
3q5i_A504 Protein kinase; CDPK, malaria, phosphotransferase, 4e-34
3q5i_A 504 Protein kinase; CDPK, malaria, phosphotransferase, 2e-14
3i6u_A419 CDS1, serine/threonine-protein kinase CHK2; Ser/Th 5e-34
3i6u_A 419 CDS1, serine/threonine-protein kinase CHK2; Ser/Th 1e-17
3lij_A494 Calcium/calmodulin dependent protein kinase with A 6e-34
3lij_A 494 Calcium/calmodulin dependent protein kinase with A 4e-14
3mwu_A486 Calmodulin-domain protein kinase 1; serine/threoni 9e-34
3mwu_A 486 Calmodulin-domain protein kinase 1; serine/threoni 1e-14
2pml_X348 PFPK7, Ser/Thr protein kinase; phosphorylati trans 1e-33
2pml_X 348 PFPK7, Ser/Thr protein kinase; phosphorylati trans 4e-18
2a19_B284 Interferon-induced, double-stranded RNA-activated 9e-33
2a19_B 284 Interferon-induced, double-stranded RNA-activated 6e-24
3cek_A313 Dual specificity protein kinase TTK; HMPS1, PYT, E 1e-32
3cek_A 313 Dual specificity protein kinase TTK; HMPS1, PYT, E 4e-22
2y7j_A365 Phosphorylase B kinase gamma catalytic chain, test 2e-32
2y7j_A 365 Phosphorylase B kinase gamma catalytic chain, test 8e-18
3dbq_A343 Dual specificity protein kinase TTK; MPS1 structur 3e-32
3dbq_A 343 Dual specificity protein kinase TTK; MPS1 structur 9e-22
1zy4_A303 Serine/threonine-protein kinase GCN2; translation 1e-31
1zy4_A 303 Serine/threonine-protein kinase GCN2; translation 4e-22
3qd2_B332 Eukaryotic translation initiation factor 2-alpha; 1e-31
3qd2_B 332 Eukaryotic translation initiation factor 2-alpha; 3e-23
3uto_A573 Twitchin; kinase, muscle sarcomere, transferase; H 2e-31
3uto_A 573 Twitchin; kinase, muscle sarcomere, transferase; H 7e-17
2zmd_A390 Dual specificity protein kinase TTK; MPS1, T686A, 3e-31
2zmd_A 390 Dual specificity protein kinase TTK; MPS1, T686A, 2e-21
3p23_A432 Serine/threonine-protein kinase/endoribonuclease; 4e-31
3p23_A 432 Serine/threonine-protein kinase/endoribonuclease; 7e-16
3fhr_A336 MAP kinase-activated protein kinase 3; kinase-inhi 1e-30
3fhr_A 336 MAP kinase-activated protein kinase 3; kinase-inhi 8e-15
3fe3_A328 MAP/microtubule affinity-regulating kinase 3; seri 2e-30
3fe3_A 328 MAP/microtubule affinity-regulating kinase 3; seri 6e-16
2h6d_A276 5'-AMP-activated protein kinase catalytic subunit 3e-30
2h6d_A 276 5'-AMP-activated protein kinase catalytic subunit 7e-16
1nxk_A400 MAP kinase-activated protein kinase 2; MK2, phosph 5e-30
1nxk_A 400 MAP kinase-activated protein kinase 2; MK2, phosph 5e-14
2ac3_A316 MAP kinase-interacting serine/threonine kinase 2; 6e-30
2ac3_A 316 MAP kinase-interacting serine/threonine kinase 2; 2e-14
2eue_A275 Carbon catabolite derepressing protein kinase; kin 1e-29
2eue_A 275 Carbon catabolite derepressing protein kinase; kin 1e-15
2rio_A434 Serine/threonine-protein kinase/endoribonuclease I 2e-29
2rio_A 434 Serine/threonine-protein kinase/endoribonuclease I 1e-14
3h4j_B336 AMPK kdaid, SNF1-like protein kinase SSP2; ATP-bin 3e-29
3h4j_B 336 AMPK kdaid, SNF1-like protein kinase SSP2; ATP-bin 1e-15
3tki_A323 Serine/threonine-protein kinase CHK1; cell checkpo 6e-29
3tki_A 323 Serine/threonine-protein kinase CHK1; cell checkpo 5e-16
3p1a_A311 MYT1 kinase, membrane-associated tyrosine- and thr 7e-29
3p1a_A311 MYT1 kinase, membrane-associated tyrosine- and thr 4e-20
2yex_A276 Serine/threonine-protein kinase CHK1; transferase, 1e-28
2yex_A 276 Serine/threonine-protein kinase CHK1; transferase, 3e-16
2y94_A476 5'-AMP-activated protein kinase catalytic subunit; 1e-28
2y94_A 476 5'-AMP-activated protein kinase catalytic subunit; 6e-15
3uc3_A361 Serine/threonine-protein kinase SRK2I; SNRK2, ABA 3e-28
3uc3_A 361 Serine/threonine-protein kinase SRK2I; SNRK2, ABA 7e-15
3dls_A335 PAS domain-containing serine/threonine-protein KI; 5e-28
3dls_A 335 PAS domain-containing serine/threonine-protein KI; 1e-17
1x8b_A289 WEE1HU, WEE1-like protein kinase; cell cycle, tran 3e-27
1x8b_A289 WEE1HU, WEE1-like protein kinase; cell cycle, tran 2e-16
4euu_A319 Serine/threonine-protein kinase TBK1; ATP binding, 3e-27
4euu_A 319 Serine/threonine-protein kinase TBK1; ATP binding, 8e-19
2wtk_C305 Serine/threonine-protein kinase 11; transferase-me 5e-27
2wtk_C 305 Serine/threonine-protein kinase 11; transferase-me 5e-17
4eut_A396 Serine/threonine-protein kinase TBK1; ATP binding, 1e-26
4eut_A 396 Serine/threonine-protein kinase TBK1; ATP binding, 2e-18
2buj_A317 Serine/threonine-protein kinase 16; transferase, A 2e-26
2buj_A 317 Serine/threonine-protein kinase 16; transferase, A 8e-21
1uu3_A310 HPDK1, 3-phosphoinositide dependent protein kinase 3e-26
1uu3_A 310 HPDK1, 3-phosphoinositide dependent protein kinase 3e-14
3lm5_A327 Serine/threonine-protein kinase 17B; STK17B, serin 1e-25
3lm5_A 327 Serine/threonine-protein kinase 17B; STK17B, serin 8e-17
3lm5_A327 Serine/threonine-protein kinase 17B; STK17B, serin 5e-06
1tki_A321 Titin; serine kinase, muscle, autoinhibition; 2.00 5e-25
1tki_A 321 Titin; serine kinase, muscle, autoinhibition; 2.00 6e-17
1tki_A321 Titin; serine kinase, muscle, autoinhibition; 2.00 1e-07
3qa8_A 676 MGC80376 protein; kinase ubiquitin-like domain, ph 5e-25
3qa8_A 676 MGC80376 protein; kinase ubiquitin-like domain, ph 6e-17
1kob_A387 Twitchin; kinase, intrasteric regulation; 2.30A {A 6e-25
1kob_A 387 Twitchin; kinase, intrasteric regulation; 2.30A {A 3e-17
1kob_A387 Twitchin; kinase, intrasteric regulation; 2.30A {A 2e-07
3e7e_A365 HBUB1, BUB1A, mitotic checkpoint serine/threonine- 2e-24
3e7e_A 365 HBUB1, BUB1A, mitotic checkpoint serine/threonine- 6e-12
3byv_A377 Rhoptry kinase; malaria, transferase, structural g 2e-24
3byv_A 377 Rhoptry kinase; malaria, transferase, structural g 3e-16
2x4f_A373 Myosin light chain kinase family member 4; LUNG, b 2e-24
2x4f_A 373 Myosin light chain kinase family member 4; LUNG, b 2e-17
2x4f_A373 Myosin light chain kinase family member 4; LUNG, b 2e-07
3a62_A327 Ribosomal protein S6 kinase beta-1; kinase domain, 2e-24
3a62_A 327 Ribosomal protein S6 kinase beta-1; kinase domain, 4e-12
3g51_A325 Ribosomal protein S6 kinase alpha-3; N-terminal ki 5e-24
3g51_A 325 Ribosomal protein S6 kinase alpha-3; N-terminal ki 4e-12
3txo_A353 PKC-L, NPKC-ETA, protein kinase C ETA type; phosph 1e-23
3txo_A 353 PKC-L, NPKC-ETA, protein kinase C ETA type; phosph 1e-11
2zv2_A298 Calcium/calmodulin-dependent protein kinase kinas; 1e-23
2zv2_A 298 Calcium/calmodulin-dependent protein kinase kinas; 3e-18
1o6l_A337 RAC-beta serine/threonine protein kinase; protein 2e-23
1o6l_A 337 RAC-beta serine/threonine protein kinase; protein 5e-12
3ll6_A337 Cyclin G-associated kinase; transferase, protein k 2e-23
3ll6_A 337 Cyclin G-associated kinase; transferase, protein k 2e-17
2i0e_A353 Protein kinase C-beta II; serine/threonine protein 2e-23
2i0e_A 353 Protein kinase C-beta II; serine/threonine protein 1e-11
1fot_A318 TPK1 delta, CAMP-dependent protein kinase type 1; 2e-23
1fot_A 318 TPK1 delta, CAMP-dependent protein kinase type 1; 1e-11
2iwi_A312 Serine/threonine-protein kinase PIM-2; nucleotide- 2e-23
2iwi_A 312 Serine/threonine-protein kinase PIM-2; nucleotide- 1e-16
1xjd_A345 Protein kinase C, theta type; PKC-theta, ATP, AMP, 4e-23
1xjd_A 345 Protein kinase C, theta type; PKC-theta, ATP, AMP, 2e-11
1rdq_E350 PKA C-alpha, CAMP-dependent protein kinase, alpha- 4e-23
1rdq_E 350 PKA C-alpha, CAMP-dependent protein kinase, alpha- 2e-12
2r5t_A373 Serine/threonine-protein kinase SGK1; AGC protein 5e-23
2r5t_A 373 Serine/threonine-protein kinase SGK1; AGC protein 1e-11
3a99_A320 Proto-oncogene serine/threonine-protein kinase PI; 1e-22
3a99_A 320 Proto-oncogene serine/threonine-protein kinase PI; 1e-15
3pfq_A674 PKC-B, PKC-beta, protein kinase C beta type; phosp 2e-22
3pfq_A 674 PKC-B, PKC-beta, protein kinase C beta type; phosp 1e-11
2clq_A295 Mitogen-activated protein kinase kinase kinase 5; 4e-22
2clq_A 295 Mitogen-activated protein kinase kinase kinase 5; 2e-17
4ejn_A446 RAC-alpha serine/threonine-protein kinase; AKT1, a 4e-22
4ejn_A 446 RAC-alpha serine/threonine-protein kinase; AKT1, a 2e-10
4fr4_A384 YANK1, serine/threonine-protein kinase 32A; struct 5e-22
4fr4_A 384 YANK1, serine/threonine-protein kinase 32A; struct 1e-12
3dzo_A413 Rhoptry kinase domain; parasitic disease, transfer 8e-22
3dzo_A 413 Rhoptry kinase domain; parasitic disease, transfer 7e-16
3c4z_A543 Rhodopsin kinase; Ser/Thr kinase, RGS homology dom 1e-21
3c4z_A 543 Rhodopsin kinase; Ser/Thr kinase, RGS homology dom 3e-13
3a8x_A345 Protein kinase C IOTA type; transferase; HET: TPO; 1e-21
3a8x_A 345 Protein kinase C IOTA type; transferase; HET: TPO; 9e-12
2acx_A576 G protein-coupled receptor kinase 6; GRK, G transf 2e-21
2acx_A 576 G protein-coupled receptor kinase 6; GRK, G transf 4e-12
1vzo_A355 Ribosomal protein S6 kinase alpha 5; protein kinas 3e-21
1vzo_A 355 Ribosomal protein S6 kinase alpha 5; protein kinas 1e-11
4dc2_A396 Protein kinase C IOTA type; kinase, substrate, cel 3e-21
4dc2_A 396 Protein kinase C IOTA type; kinase, substrate, cel 8e-12
3pvu_A 695 Beta-adrenergic receptor kinase 1; transferase, se 4e-21
3pvu_A 695 Beta-adrenergic receptor kinase 1; transferase, se 5e-12
2wqm_A310 Serine/threonine-protein kinase NEK7; ATP-binding, 6e-21
2wqm_A 310 Serine/threonine-protein kinase NEK7; ATP-binding, 4e-19
2wqm_A310 Serine/threonine-protein kinase NEK7; ATP-binding, 3e-06
3q60_A371 ROP5B; pseudokinase, transferase; HET: ATP; 1.72A 9e-21
3q60_A 371 ROP5B; pseudokinase, transferase; HET: ATP; 1.72A 1e-17
4g3f_A336 NF-kappa-beta-inducing kinase; non-RD kinase, prot 2e-20
4g3f_A 336 NF-kappa-beta-inducing kinase; non-RD kinase, prot 4e-18
1q4k_B259 Serine/threonine-protein kinase PLK; six-stranded 3e-20
4aw2_A437 Serine/threonine-protein kinase MRCK alpha; transf 5e-20
4aw2_A 437 Serine/threonine-protein kinase MRCK alpha; transf 3e-13
3p34_A232 Serine/threonine-protein kinase PLK1; phosphoprote 9e-20
3v8s_A410 RHO-associated protein kinase 1; dimerization, myo 2e-19
3v8s_A 410 RHO-associated protein kinase 1; dimerization, myo 6e-13
2vd5_A412 DMPK protein; serine/threonine-protein kinase, kin 4e-19
2vd5_A 412 DMPK protein; serine/threonine-protein kinase, kin 7e-13
1ua2_A 346 CAK, cell division protein kinase 7; cell cycle, p 3e-18
1ua2_A346 CAK, cell division protein kinase 7; cell cycle, p 1e-08
1t4h_A290 Serine/threonine-protein kinase WNK1; protein seri 4e-18
1t4h_A290 Serine/threonine-protein kinase WNK1; protein seri 5e-17
3g33_A 308 Cell division protein kinase 4; Ser/Thr protein ki 4e-18
3g33_A308 Cell division protein kinase 4; Ser/Thr protein ki 1e-09
3niz_A 311 Rhodanese family protein; structural genomics, str 6e-18
3niz_A311 Rhodanese family protein; structural genomics, str 1e-08
2r3i_A 299 Cell division protein kinase 2; serine/threonine-p 8e-18
2r3i_A299 Cell division protein kinase 2; serine/threonine-p 1e-08
1ob3_A 288 PFPK5, cell division control protein 2 homolog; tr 1e-17
1ob3_A288 PFPK5, cell division control protein 2 homolog; tr 1e-09
1blx_A 326 Cyclin-dependent kinase 6; inhibitor protein, cycl 1e-17
1blx_A326 Cyclin-dependent kinase 6; inhibitor protein, cycl 4e-09
3o0g_A 292 Cell division protein kinase 5; kinase activator c 1e-17
3o0g_A292 Cell division protein kinase 5; kinase activator c 1e-07
4agu_A 311 Cyclin-dependent kinase-like 1; transferase, phosp 1e-17
4agu_A311 Cyclin-dependent kinase-like 1; transferase, phosp 9e-10
3mi9_A 351 Cell division protein kinase 9; P-TEFB, HIV-1, pro 2e-17
3mi9_A351 Cell division protein kinase 9; P-TEFB, HIV-1, pro 2e-08
4aaa_A 331 Cyclin-dependent kinase-like 2; transferase, phosp 2e-17
4aaa_A331 Cyclin-dependent kinase-like 2; transferase, phosp 2e-09
2pmi_A 317 Negative RE, cyclin-dependent protein kinase PHO85 2e-17
2pmi_A317 Negative RE, cyclin-dependent protein kinase PHO85 2e-09
3mtl_A 324 Cell division protein kinase 16; pctaire1, indirub 4e-17
3mtl_A324 Cell division protein kinase 16; pctaire1, indirub 6e-10
3m2w_A299 MAP kinase-activated protein kinase 2; small molec 9e-17
3m2w_A 299 MAP kinase-activated protein kinase 2; small molec 9e-15
3m2w_A299 MAP kinase-activated protein kinase 2; small molec 4e-05
3lb7_A 307 RAF proto-oncogene serine/threonine-protein kinas; 5e-16
3lb7_A307 RAF proto-oncogene serine/threonine-protein kinas; 7e-08
2vwi_A303 Serine/threonine-protein kinase OSR1; STE kinase, 6e-16
2vwi_A 303 Serine/threonine-protein kinase OSR1; STE kinase, 1e-14
3og7_A 289 AKAP9-BRAF fusion protein; proto-oncogene, V600E, 6e-16
3og7_A289 AKAP9-BRAF fusion protein; proto-oncogene, V600E, 5e-08
3rgf_A 405 Cyclin-dependent kinase 8; protein kinase complex, 8e-16
3rgf_A405 Cyclin-dependent kinase 8; protein kinase complex, 4e-07
3gbz_A 329 Kinase, CMGC CDK; ssgcid, ATP-binding, nucleotide- 1e-15
3gbz_A329 Kinase, CMGC CDK; ssgcid, ATP-binding, nucleotide- 6e-10
2x7f_A 326 TRAF2 and NCK-interacting protein kinase; serine/t 4e-15
2x7f_A326 TRAF2 and NCK-interacting protein kinase; serine/t 6e-08
2y4i_B 319 KSR2, HKSR2, kinase suppressor of RAS 2; transfera 5e-15
2y4i_B319 KSR2, HKSR2, kinase suppressor of RAS 2; transfera 2e-06
3gni_B 389 Strad alpha; kinase fold, pseudokinase, alpha heli 1e-14
3gni_B389 Strad alpha; kinase fold, pseudokinase, alpha heli 1e-09
3a7i_A 303 MST3 kinase, serine/threonine kinase 24 (STE20 hom 2e-14
3a7i_A303 MST3 kinase, serine/threonine kinase 24 (STE20 hom 3e-10
2j7t_A 302 Serine/threonine-protein kinase 10; transferase, A 2e-14
2j7t_A302 Serine/threonine-protein kinase 10; transferase, A 6e-09
4e7w_A 394 Glycogen synthase kinase 3; GSK3, PTyr195, transfe 2e-14
4e7w_A394 Glycogen synthase kinase 3; GSK3, PTyr195, transfe 5e-12
3p86_A 309 Serine/threonine-protein kinase CTR1; ETR1, ERS1, 2e-14
3p86_A309 Serine/threonine-protein kinase CTR1; ETR1, ERS1, 5e-10
1j1b_A 420 Glycogen synthase kinase-3 beta; complex, TAU, AMP 3e-14
1j1b_A420 Glycogen synthase kinase-3 beta; complex, TAU, AMP 9e-12
1u5q_A 348 Serine/threonine protein kinase TAO2; transferase; 4e-14
1u5q_A348 Serine/threonine protein kinase TAO2; transferase; 6e-09
3com_A 314 Serine/threonine-protein kinase 4; MST1, STE20-lik 4e-14
3com_A314 Serine/threonine-protein kinase 4; MST1, STE20-lik 5e-11
3fxz_A297 Serine/threonine-protein kinase PAK 1; transferase 7e-14
3fxz_A 297 Serine/threonine-protein kinase PAK 1; transferase 8e-14
2c30_A 321 Serine/threonine-protein kinase PAK 6; CRIB domain 9e-14
2c30_A321 Serine/threonine-protein kinase PAK 6; CRIB domain 1e-13
3eb0_A 383 Putative uncharacterized protein; kinase cryptospo 1e-13
3eb0_A383 Putative uncharacterized protein; kinase cryptospo 5e-09
4eqm_A 294 Protein kinase; transferase; HET: ANP; 3.00A {Stap 2e-13
4eqm_A294 Protein kinase; transferase; HET: ANP; 3.00A {Stap 4e-06
3ork_A 311 Serine/threonine protein kinase; structural genomi 4e-13
3ork_A311 Serine/threonine protein kinase; structural genomi 4e-06
3s95_A 310 LIMK-1, LIM domain kinase 1; structural genomics, 5e-13
3s95_A310 LIMK-1, LIM domain kinase 1; structural genomics, 1e-07
2pzi_A 681 Probable serine/threonine-protein kinase PKNG; ATP 6e-13
2pzi_A 681 Probable serine/threonine-protein kinase PKNG; ATP 6e-10
3coi_A 353 Mitogen-activated protein kinase 13; P38D, P38delt 7e-13
3coi_A353 Mitogen-activated protein kinase 13; P38D, P38delt 4e-10
3nsz_A 330 CK II alpha, casein kinase II subunit alpha; inhib 1e-12
3nsz_A330 CK II alpha, casein kinase II subunit alpha; inhib 2e-06
3rp9_A 458 Mitogen-activated protein kinase; structural genom 1e-12
3rp9_A458 Mitogen-activated protein kinase; structural genom 7e-05
3pg1_A 362 Mitogen-activated protein kinase, putative (MAP K 1e-12
3pg1_A362 Mitogen-activated protein kinase, putative (MAP K 3e-11
2xrw_A 371 Mitogen-activated protein kinase 8; transcription, 2e-12
2xrw_A371 Mitogen-activated protein kinase 8; transcription, 1e-09
1cm8_A 367 Phosphorylated MAP kinase P38-gamma; phosphorylati 2e-12
1cm8_A367 Phosphorylated MAP kinase P38-gamma; phosphorylati 1e-10
4e5w_A 302 Tyrosine-protein kinase JAK1; kinase domain, trans 5e-12
3qyz_A 364 Mitogen-activated protein kinase 1; transferase, s 5e-12
3qyz_A364 Mitogen-activated protein kinase 1; transferase, s 4e-10
3fme_A 290 Dual specificity mitogen-activated protein kinase; 6e-12
3fme_A290 Dual specificity mitogen-activated protein kinase; 6e-10
3ttj_A 464 Mitogen-activated protein kinase 10; JNK3, protein 6e-12
3ttj_A464 Mitogen-activated protein kinase 10; JNK3, protein 4e-10
2eva_A 307 TAK1 kinase - TAB1 chimera fusion protein; transfe 7e-12
2eva_A307 TAK1 kinase - TAB1 chimera fusion protein; transfe 4e-11
3ugc_A 295 Tyrosine-protein kinase JAK2; small molecule inhib 7e-12
3eqc_A 360 Dual specificity mitogen-activated protein kinase; 1e-11
3eqc_A360 Dual specificity mitogen-activated protein kinase; 4e-10
2fst_X 367 Mitogen-activated protein kinase 14; active mutant 1e-11
2fst_X367 Mitogen-activated protein kinase 14; active mutant 3e-11
3n9x_A 432 Phosphotransferase; malaria kinase, structural gen 1e-11
3n9x_A432 Phosphotransferase; malaria kinase, structural gen 4e-05
3e3p_A 360 Protein kinase, putative glycogen synthase kinase; 1e-11
3e3p_A360 Protein kinase, putative glycogen synthase kinase; 1e-08
3lxp_A 318 Non-receptor tyrosine-protein kinase TYK2; JAK3, i 1e-11
2w1i_A 326 JAK2; chromosomal rearrangement, nucleotide-bindin 1e-11
2dyl_A 318 Dual specificity mitogen-activated protein kinase 1e-11
2dyl_A318 Dual specificity mitogen-activated protein kinase 5e-10
3an0_A 340 Dual specificity mitogen-activated protein kinase; 1e-11
3an0_A340 Dual specificity mitogen-activated protein kinase; 2e-09
2b9h_A 353 MAP kinase FUS3, mitogen-activated protein kinase 2e-11
2b9h_A353 MAP kinase FUS3, mitogen-activated protein kinase 3e-10
3lxl_A 327 Tyrosine-protein kinase JAK3; TYK2, inflammation, 2e-11
2i6l_A 320 Mitogen-activated protein kinase 6; MAPK6, ERK3, e 2e-11
2i6l_A320 Mitogen-activated protein kinase 6; MAPK6, ERK3, e 2e-10
3cbl_A 377 C-FES, proto-oncogene tyrosine-protein kinase FES/ 2e-11
1opk_A 495 P150, C-ABL, proto-oncogene tyrosine-protein kinas 2e-11
3oz6_A 388 Mitogen-activated protein kinase 1, serine/threon 2e-11
3oz6_A388 Mitogen-activated protein kinase 1, serine/threon 2e-08
3kmu_A271 ILK, integrin-linked kinase; cell adhesion, ANK re 3e-11
3kmu_A271 ILK, integrin-linked kinase; cell adhesion, ANK re 1e-07
3aln_A 327 Dual specificity mitogen-activated protein kinase; 3e-11
3aln_A327 Dual specificity mitogen-activated protein kinase; 1e-08
3pls_A 298 Macrophage-stimulating protein receptor; protein k 3e-11
3kfa_A 288 Tyrosine-protein kinase ABL1; CML, drug resistance 3e-11
3lzb_A 327 Epidermal growth factor receptor; epidermal growth 4e-11
3gxj_A 303 TGF-beta receptor type-1; ALK5, kinase, inhibitor, 6e-11
3gxj_A303 TGF-beta receptor type-1; ALK5, kinase, inhibitor, 1e-04
2h34_A 309 Serine/threonine-protein kinase PKNE; apoenzyme, t 6e-11
2h34_A309 Serine/threonine-protein kinase PKNE; apoenzyme, t 2e-06
4f0f_A287 Serine/threonine-protein kinase ROCO4; LRRK2, ATP- 7e-11
4f0f_A287 Serine/threonine-protein kinase ROCO4; LRRK2, ATP- 3e-08
3kex_A 325 Receptor tyrosine-protein kinase ERBB-3; kinase do 7e-11
3f66_A 298 Hepatocyte growth factor receptor; C-Met, protein 7e-11
3qup_A 323 Tyrosine-protein kinase receptor TYRO3; protein ki 8e-11
4aoj_A 329 High affinity nerve growth factor receptor; transf 9e-11
1k9a_A 450 Carboxyl-terminal SRC kinase; COOH-terminal SRC ki 1e-10
3mdy_A 337 Bone morphogenetic protein receptor type-1B; compl 1e-10
3mdy_A337 Bone morphogenetic protein receptor type-1B; compl 3e-04
2nru_A 307 Interleukin-1 receptor-associated kinase 4; inhibi 1e-10
1mp8_A 281 Focal adhesion kinase 1; tyrosine protein kinase, 1e-10
3poz_A 327 Epidermal growth factor receptor; kinase domain, a 1e-10
1xbb_A 291 Tyrosine-protein kinase SYK; gleevec, STI-571, ima 1e-10
2i1m_A 333 Macrophage colony-stimulating factor 1 receptor; k 1e-10
1fmk_A 452 C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyros 1e-10
1fmk_A452 C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyros 1e-04
3q4u_A 301 Activin receptor type-1; structural genomics conso 1e-10
3q4u_A301 Activin receptor type-1; structural genomics conso 3e-06
2h8h_A 535 Proto-oncogene tyrosine-protein kinase SRC; SRC ki 1e-10
2h8h_A535 Proto-oncogene tyrosine-protein kinase SRC; SRC ki 2e-04
3dtc_A271 Mitogen-activated protein kinase kinase kinase 9; 2e-10
3dtc_A271 Mitogen-activated protein kinase kinase kinase 9; 2e-10
1qcf_A 454 Haematopoetic cell kinase (HCK); tyrosine kinase-i 2e-10
3c1x_A 373 Hepatocyte growth factor receptor; receptor tyrosi 2e-10
3uim_A 326 Brassinosteroid insensitive 1-associated receptor; 2e-10
1byg_A 278 CSK, protein (C-terminal SRC kinase); protein kina 2e-10
3brb_A 313 Proto-oncogene tyrosine-protein kinase MER; ATP-bi 2e-10
1qpc_A 279 LCK kinase; alpha beta fold, transferase; HET: PTR 2e-10
2ivs_A 314 Proto-oncogene tyrosine-protein kinase receptor RE 2e-10
1u46_A 291 ACK-1, activated CDC42 kinase 1; tyrosine kinase, 2e-10
1u46_A291 ACK-1, activated CDC42 kinase 1; tyrosine kinase, 5e-04
2j0j_A 656 Focal adhesion kinase 1; cell migration, FERM, tra 3e-10
1u59_A 287 Tyrosine-protein kinase ZAP-70; transferase; HET: 3e-10
3vhe_A 359 Vascular endothelial growth factor receptor 2; kin 3e-10
3sxs_A 268 Cytoplasmic tyrosine-protein kinase BMX; transfera 3e-10
3soc_A 322 Activin receptor type-2A; structural genomics cons 4e-10
3cc6_A 281 Protein tyrosine kinase 2 beta; focal adhesion kin 6e-10
2xir_A 316 Vascular endothelial growth factor receptor 2; ang 6e-10
2ozo_A 613 Tyrosine-protein kinase ZAP-70; inactive ZAP-70, t 6e-10
1b6c_B 342 TGF-B superfamily receptor type I; complex (isomer 7e-10
1b6c_B342 TGF-B superfamily receptor type I; complex (isomer 5e-05
1p4o_A 322 Insulin-like growth factor I receptor protein; IGF 7e-10
1luf_A 343 Muscle-specific tyrosine kinase receptor MUSK; pho 7e-10
1t46_A 313 HOMO sapiens V-KIT hardy-zuckerman 4 feline sarcom 7e-10
3gen_A 283 Tyrosine-protein kinase BTK; bruton'S tyrosine kin 8e-10
2pvf_A 334 Fibroblast growth factor receptor 2; kinase domain 8e-10
3kul_A 325 Ephrin type-A receptor 8; ATP-binding, kinase, nuc 8e-10
3v5q_A 297 NT-3 growth factor receptor; kinase domain, kinase 1e-09
2qkw_B 321 Protein kinase; three-helix bundle motif, AVRPTO-P 1e-09
3t9t_A 267 Tyrosine-protein kinase ITK/TSK; kinase domain, al 1e-09
2qol_A 373 Ephrin receptor; receptor tyrosine kinase, juxtame 1e-09
2psq_A 370 Fibroblast growth factor receptor 2; kinase domain 1e-09
3tt0_A 382 Basic fibroblast growth factor receptor 1; kinase 1e-09
3zzw_A 289 Tyrosine-protein kinase transmembrane receptor RO; 2e-09
1fvr_A 327 Tyrosine-protein kinase TIE-2; tyrosine kinase, tr 2e-09
3g2f_A 336 Bone morphogenetic protein receptor type-2; kinase 3e-09
1mqb_A 333 Ephrin type-A receptor 2; tyrosine protein kinase, 6e-09
1wak_A397 Serine/threonine-protein kinase SPRK1; SRPK, trans 6e-09
1wak_A 397 Serine/threonine-protein kinase SPRK1; SRPK, trans 5e-06
1rjb_A 344 FL cytokine receptor; kinase, structure, autoinhib 7e-09
3uqc_A286 Probable conserved transmembrane protein; structur 2e-08
3uqc_A286 Probable conserved transmembrane protein; structur 1e-06
4fvq_A 289 Tyrosine-protein kinase JAK2; janus protein kinase 9e-08
2yfx_A 327 Tyrosine-protein kinase receptor; nucleotide-bindi 1e-07
3l9p_A 367 Anaplastic lymphoma kinase; kinase domain, ATP-bin 2e-07
3kvw_A 429 DYRK2, dual specificity tyrosine-phosphorylation-r 2e-07
3kvw_A429 DYRK2, dual specificity tyrosine-phosphorylation-r 1e-06
2eu9_A355 Dual specificity protein kinase CLK3; kinase domai 4e-07
2eu9_A 355 Dual specificity protein kinase CLK3; kinase domai 4e-05
1q8y_A373 SR protein kinase; transferase; HET: ADP ADE; 2.05 4e-07
1q8y_A 373 SR protein kinase; transferase; HET: ADP ADE; 2.05 8e-07
2vx3_A382 Dual specificity tyrosine-phosphorylation- regula 6e-07
2vx3_A 382 Dual specificity tyrosine-phosphorylation- regula 6e-05
3llt_A360 Serine/threonine kinase-1, pflammer; lammer kinase 1e-06
3llt_A 360 Serine/threonine kinase-1, pflammer; lammer kinase 1e-05
1z57_A339 Dual specificity protein kinase CLK1; protein tyro 2e-06
1z57_A 339 Dual specificity protein kinase CLK1; protein tyro 3e-05
2jii_A 352 Serine/threonine-protein kinase VRK3 molecule: VA 6e-05
2v62_A 345 Serine/threonine-protein kinase VRK2; transferase, 9e-05
3op5_A 364 Serine/threonine-protein kinase VRK1; adenosine tr 1e-04
2izr_A 330 Casein kinase I isoform gamma-3; serine/threonine- 2e-04
2vuw_A 336 Serine/threonine-protein kinase haspin; cell cycle 3e-04
3uzp_A 296 CKI-delta, CKID, casein kinase I isoform delta; CK 3e-04
1csn_A 298 Casein kinase-1; phosphotransferase; HET: ATP; 2.0 4e-04
1mby_A88 SAK, serine/threonine kinase; POLO domain, strand 8e-04
>3cok_A Serine/threonine-protein kinase PLK4; POLO-like kinase 4, SAK, STK18, PSI, structural genomics, protein structure initiative; HET: ANP; 2.25A {Homo sapiens} Length = 278 Back     alignment and structure
 Score =  201 bits (515), Expect = 6e-64
 Identities = 65/235 (27%), Positives = 112/235 (47%), Gaps = 44/235 (18%)

Query: 1   MSQEIAIHRSLKHRNVVGFHSFFEDSKFVYIILELCRKRSMMELYNSACDLEEMSDPAAQ 60
           +  E+ IH  LKH +++  +++FEDS +VY++LE+C    M     +    +  S+  A+
Sbjct: 58  VQNEVKIHCQLKHPSILELYNYFEDSNYVYLVLEMCHNGEMNRYLKNRV--KPFSENEAR 115

Query: 61  PVIW-VSKWVDY--------------------------SDKYGFGYQLNDDSSGVMFNDL 93
             +  +   + Y                          +D   FG      ++ +     
Sbjct: 116 HFMHQIITGMLYLHSHGILHRDLTLSNLLLTRNMNIKIAD---FGL-----ATQLKMPHE 167

Query: 94  TRMIMLANKNTLCGTPNYIAPEILNKNGHSFEVDVWSIGCIMYTLLVGKPPFETSTLKET 153
                     TLCGTPNYI+PEI  ++ H  E DVWS+GC+ YTLL+G+PPF+T T+K T
Sbjct: 168 KHY-------TLCGTPNYISPEIATRSAHGLESDVWSLGCMFYTLLIGRPPFDTDTVKNT 220

Query: 154 YSRIKKVEYKLPATLKKPAATMIKKMLLLDPVQRPPVAQLLHFEFFNDYCPTSLP 208
            +++   +Y++P+ L   A  +I ++L  +P  R  ++ +L   F +    T   
Sbjct: 221 LNKVVLADYEMPSFLSIEAKDLIHQLLRRNPADRLSLSSVLDHPFMSRNSSTKSK 275


>3cok_A Serine/threonine-protein kinase PLK4; POLO-like kinase 4, SAK, STK18, PSI, structural genomics, protein structure initiative; HET: ANP; 2.25A {Homo sapiens} Length = 278 Back     alignment and structure
>2owb_A Serine/threonine-protein kinase PLK1; catalytic domain, POLO-like kinase1, transfera; HET: 626; 2.10A {Homo sapiens} PDB: 2ou7_A* 3fc2_A* 3thb_A* Length = 335 Back     alignment and structure
>2owb_A Serine/threonine-protein kinase PLK1; catalytic domain, POLO-like kinase1, transfera; HET: 626; 2.10A {Homo sapiens} PDB: 2ou7_A* 3fc2_A* 3thb_A* Length = 335 Back     alignment and structure
>2owb_A Serine/threonine-protein kinase PLK1; catalytic domain, POLO-like kinase1, transfera; HET: 626; 2.10A {Homo sapiens} PDB: 2ou7_A* 3fc2_A* 3thb_A* Length = 335 Back     alignment and structure
>2rku_A Serine/threonine-protein kinase PLK1; structure of PLK1, selectivity residues, POLO-like K structure based drug design, ATP-binding; HET: R78 TLA SRT TAR; 1.95A {Homo sapiens} PDB: 2v5q_A 2yac_A* 4a4l_A* 4a4o_A* 3kb7_A* 3d5w_A* 3d5u_A* 3d5v_A 3db8_A* 3dbc_A* 3dbd_A* 3d5x_A* 3db6_A* 3dbe_A* 3dbf_A* Length = 294 Back     alignment and structure
>2rku_A Serine/threonine-protein kinase PLK1; structure of PLK1, selectivity residues, POLO-like K structure based drug design, ATP-binding; HET: R78 TLA SRT TAR; 1.95A {Homo sapiens} PDB: 2v5q_A 2yac_A* 4a4l_A* 4a4o_A* 3kb7_A* 3d5w_A* 3d5u_A* 3d5v_A 3db8_A* 3dbc_A* 3dbd_A* 3d5x_A* 3db6_A* 3dbe_A* 3dbf_A* Length = 294 Back     alignment and structure
>2rku_A Serine/threonine-protein kinase PLK1; structure of PLK1, selectivity residues, POLO-like K structure based drug design, ATP-binding; HET: R78 TLA SRT TAR; 1.95A {Homo sapiens} PDB: 2v5q_A 2yac_A* 4a4l_A* 4a4o_A* 3kb7_A* 3d5w_A* 3d5u_A* 3d5v_A 3db8_A* 3dbc_A* 3dbd_A* 3d5x_A* 3db6_A* 3dbe_A* 3dbf_A* Length = 294 Back     alignment and structure
>3fdn_A Serine/threonine-protein kinase 6; aurora kinase inhibitors, virtual screening, X-RAY CO- crystal analysis, structure-based drug design (SBDD); HET: MMH; 1.90A {Homo sapiens} PDB: 3k5u_A* 3m11_A* 2c6e_A* 1muo_A* 2bmc_A* 2j4z_A* 1ol6_A* 3up2_A* 3unz_A* 3uo5_A* 3uo6_A* 3uod_A* 3uoh_A* 3uoj_A* 3uok_A* 3uo4_A* 3uol_A* 3up7_A* 3lau_A* 2wtv_A* ... Length = 279 Back     alignment and structure
>3fdn_A Serine/threonine-protein kinase 6; aurora kinase inhibitors, virtual screening, X-RAY CO- crystal analysis, structure-based drug design (SBDD); HET: MMH; 1.90A {Homo sapiens} PDB: 3k5u_A* 3m11_A* 2c6e_A* 1muo_A* 2bmc_A* 2j4z_A* 1ol6_A* 3up2_A* 3unz_A* 3uo5_A* 3uo6_A* 3uod_A* 3uoh_A* 3uoj_A* 3uok_A* 3uo4_A* 3uol_A* 3up7_A* 3lau_A* 2wtv_A* ... Length = 279 Back     alignment and structure
>2vgo_A Serine/threonine-protein kinase 12-A; nucleotide-binding, serine/threonine-protein kinase, ATP-binding, transferase, coiled coil, cell division, kinase; HET: TPO AD5; 1.7A {Xenopus laevis} PDB: 2bfx_A* 2vgp_A* 3ztx_A* 2vrx_A* 2bfy_A* 4af3_A* 3dj6_A* 3d15_A* 3d2i_A* 3d2k_A* 3d14_A* 3dj5_A* 3dj7_A* 3daj_A* 1ol5_A* 1ol7_A* 2x6d_A* 2x6e_A* 2xng_A* 2dwb_A* ... Length = 284 Back     alignment and structure
>2vgo_A Serine/threonine-protein kinase 12-A; nucleotide-binding, serine/threonine-protein kinase, ATP-binding, transferase, coiled coil, cell division, kinase; HET: TPO AD5; 1.7A {Xenopus laevis} PDB: 2bfx_A* 2vgp_A* 3ztx_A* 2vrx_A* 2bfy_A* 4af3_A* 3dj6_A* 3d15_A* 3d2i_A* 3d2k_A* 3d14_A* 3dj5_A* 3dj7_A* 3daj_A* 1ol5_A* 1ol7_A* 2x6d_A* 2x6e_A* 2xng_A* 2dwb_A* ... Length = 284 Back     alignment and structure
>4g31_A Eukaryotic translation initiation factor 2-alpha; deletion mutant, catalytic domain, synthetic inhibitor, TRAN transferase inhibitor complex; HET: 0WH; 2.28A {Homo sapiens} PDB: 4g34_A* Length = 299 Back     alignment and structure
>4g31_A Eukaryotic translation initiation factor 2-alpha; deletion mutant, catalytic domain, synthetic inhibitor, TRAN transferase inhibitor complex; HET: 0WH; 2.28A {Homo sapiens} PDB: 4g34_A* Length = 299 Back     alignment and structure
>2jam_A Calcium/calmodulin-dependent protein kinase type 1G; transferase, kinase, membrane, ATP-binding, prenylation, serine/threonine-protein kinase, alternative splicing; HET: J60; 1.7A {Homo sapiens} PDB: 2jc6_A* 1a06_A Length = 304 Back     alignment and structure
>2jam_A Calcium/calmodulin-dependent protein kinase type 1G; transferase, kinase, membrane, ATP-binding, prenylation, serine/threonine-protein kinase, alternative splicing; HET: J60; 1.7A {Homo sapiens} PDB: 2jc6_A* 1a06_A Length = 304 Back     alignment and structure
>3kk8_A Calcium/calmodulin dependent protein kinase II; ATP-binding, nucleotide-binding, serine/threonine-protein kinase, transferase; HET: TPO; 1.72A {Caenorhabditis elegans} PDB: 3kk9_A* 3kl8_A 2vn9_A* 3bhh_A* Length = 284 Back     alignment and structure
>3kk8_A Calcium/calmodulin dependent protein kinase II; ATP-binding, nucleotide-binding, serine/threonine-protein kinase, transferase; HET: TPO; 1.72A {Caenorhabditis elegans} PDB: 3kk9_A* 3kl8_A 2vn9_A* 3bhh_A* Length = 284 Back     alignment and structure
>3f3z_A Calcium/calmodulin-dependent protein kinase with domain and 4 calmodulin like EF...; calcium dependent protein kinase; HET: SEP DRK; 1.84A {Cryptosporidium parvum iowa II} PDB: 2qg5_A* Length = 277 Back     alignment and structure
>3f3z_A Calcium/calmodulin-dependent protein kinase with domain and 4 calmodulin like EF...; calcium dependent protein kinase; HET: SEP DRK; 1.84A {Cryptosporidium parvum iowa II} PDB: 2qg5_A* Length = 277 Back     alignment and structure
>2qr7_A Ribosomal protein S6 kinase alpha-3; kinase domain, RSK2, autoinhibitory, ATP-binding, nucleotide phosphorylation, serine/threonine-protein kinase; 2.00A {Mus musculus} PDB: 2qr8_A 4d9t_A* 4d9u_A* 3rny_A 2wnt_A Length = 342 Back     alignment and structure
>2qr7_A Ribosomal protein S6 kinase alpha-3; kinase domain, RSK2, autoinhibitory, ATP-binding, nucleotide phosphorylation, serine/threonine-protein kinase; 2.00A {Mus musculus} PDB: 2qr8_A 4d9t_A* 4d9u_A* 3rny_A 2wnt_A Length = 342 Back     alignment and structure
>2bdw_A Hypothetical protein K11E8.1D; kinase, calmodulin activated, transferase; 1.80A {Caenorhabditis elegans} PDB: 2wel_A* 2v7o_A* 2vz6_A* 1cdm_B 1cm1_B 1cm4_B Length = 362 Back     alignment and structure
>2bdw_A Hypothetical protein K11E8.1D; kinase, calmodulin activated, transferase; 1.80A {Caenorhabditis elegans} PDB: 2wel_A* 2v7o_A* 2vz6_A* 1cdm_B 1cm1_B 1cm4_B Length = 362 Back     alignment and structure
>2wei_A Calmodulin-domain protein kinase 1, putative; nucleotide-binding, serine/threonine-protein kinase, CGD3_920, transferase; HET: VGG; 1.65A {Cryptosporidium parvum iowa II} PDB: 3dfa_A 3ma6_A* Length = 287 Back     alignment and structure
>2wei_A Calmodulin-domain protein kinase 1, putative; nucleotide-binding, serine/threonine-protein kinase, CGD3_920, transferase; HET: VGG; 1.65A {Cryptosporidium parvum iowa II} PDB: 3dfa_A 3ma6_A* Length = 287 Back     alignment and structure
>3soa_A Calcium/calmodulin-dependent protein kinase type alpha with A beta 7 linker; phosphorylation, cytosolic, transferase-transferase inhibitor complex; HET: DB8; 3.55A {Homo sapiens} Length = 444 Back     alignment and structure
>3soa_A Calcium/calmodulin-dependent protein kinase type alpha with A beta 7 linker; phosphorylation, cytosolic, transferase-transferase inhibitor complex; HET: DB8; 3.55A {Homo sapiens} Length = 444 Back     alignment and structure
>3is5_A Calcium-dependent protein kinase; CDPK, structural genomics, parasitology, structural genomics consortium, SGC, ATP-binding, nucleotide-binding; HET: ANP; 2.55A {Toxoplasma gondii} Length = 285 Back     alignment and structure
>3is5_A Calcium-dependent protein kinase; CDPK, structural genomics, parasitology, structural genomics consortium, SGC, ATP-binding, nucleotide-binding; HET: ANP; 2.55A {Toxoplasma gondii} Length = 285 Back     alignment and structure
>4apc_A Serine/threonine-protein kinase NEK1; transferase; 2.10A {Homo sapiens} Length = 350 Back     alignment and structure
>4apc_A Serine/threonine-protein kinase NEK1; transferase; 2.10A {Homo sapiens} Length = 350 Back     alignment and structure
>3kn6_A Ribosomal protein S6 kinase alpha-5; AMP-PNP, MSK1, MSK, ATP-binding, metal-binding, NUCL binding, serine/threonine-protein kinase, transferase; 2.00A {Homo sapiens} PDB: 3kn5_A Length = 325 Back     alignment and structure
>3kn6_A Ribosomal protein S6 kinase alpha-5; AMP-PNP, MSK1, MSK, ATP-binding, metal-binding, NUCL binding, serine/threonine-protein kinase, transferase; 2.00A {Homo sapiens} PDB: 3kn5_A Length = 325 Back     alignment and structure
>2w4o_A Calcium/calmodulin-dependent protein kinase type IV; calmodulin-binding, nucleotide-binding, serine/threonine-protein kinase, ATP-binding; HET: DKI; 2.17A {Homo sapiens} Length = 349 Back     alignment and structure
>2w4o_A Calcium/calmodulin-dependent protein kinase type IV; calmodulin-binding, nucleotide-binding, serine/threonine-protein kinase, ATP-binding; HET: DKI; 2.17A {Homo sapiens} Length = 349 Back     alignment and structure
>1phk_A Phosphorylase kinase; glycogen metabolism, transferase, serine/threonine-protein, ATP-binding, calmodulin-binding; HET: ATP; 2.20A {Oryctolagus cuniculus} SCOP: d.144.1.7 PDB: 1ql6_A* 2phk_A* Length = 298 Back     alignment and structure
>1phk_A Phosphorylase kinase; glycogen metabolism, transferase, serine/threonine-protein, ATP-binding, calmodulin-binding; HET: ATP; 2.20A {Oryctolagus cuniculus} SCOP: d.144.1.7 PDB: 1ql6_A* 2phk_A* Length = 298 Back     alignment and structure
>3c0i_A Peripheral plasma membrane protein CASK; neurexin, Ca2+/calmodulin dependent protein kinase, Mg synaptic plasticity, pseudokinase, maguk; HET: 3AM; 1.85A {Homo sapiens} PDB: 3c0h_A* 3c0g_A* 3mfr_A* 3mfs_A* 3mft_A 3mfu_A* 3tac_A Length = 351 Back     alignment and structure
>3c0i_A Peripheral plasma membrane protein CASK; neurexin, Ca2+/calmodulin dependent protein kinase, Mg synaptic plasticity, pseudokinase, maguk; HET: 3AM; 1.85A {Homo sapiens} PDB: 3c0h_A* 3c0g_A* 3mfr_A* 3mfs_A* 3mft_A 3mfu_A* 3tac_A Length = 351 Back     alignment and structure
>3bhy_A Death-associated protein kinase 3; death associated kinase, DAPK3, ZIP kinase, ZIPK, DAP kinase like kinase, DLK, structural genomics consortium; HET: 7CP; 1.24A {Homo sapiens} PDB: 3bqr_A* 2j90_A* 1yrp_A* 2yak_A* 2y4p_A* 3f5u_A* 1jks_A 1jkk_A* 1ig1_A* 1jkl_A 1jkt_A 3eh9_A* 3eha_A* 3f5g_A* 1p4f_A* 1wvw_A 1wvx_A* 1wvy_A* 2w4j_A* 3dgk_A ... Length = 283 Back     alignment and structure
>3bhy_A Death-associated protein kinase 3; death associated kinase, DAPK3, ZIP kinase, ZIPK, DAP kinase like kinase, DLK, structural genomics consortium; HET: 7CP; 1.24A {Homo sapiens} PDB: 3bqr_A* 2j90_A* 1yrp_A* 2yak_A* 2y4p_A* 3f5u_A* 1jks_A 1jkk_A* 1ig1_A* 1jkl_A 1jkt_A 3eh9_A* 3eha_A* 3f5g_A* 1p4f_A* 1wvw_A 1wvx_A* 1wvy_A* 2w4j_A* 3dgk_A ... Length = 283 Back     alignment and structure
>3hko_A Calcium/calmodulin-dependent protein kinase with domain and 2 calmodulin-like EF...; structural genomics, protist parasite; HET: ANP; 1.80A {Cryptosporidium parvum iowa II} Length = 345 Back     alignment and structure
>3hko_A Calcium/calmodulin-dependent protein kinase with domain and 2 calmodulin-like EF...; structural genomics, protist parasite; HET: ANP; 1.80A {Cryptosporidium parvum iowa II} Length = 345 Back     alignment and structure
>2yab_A Death-associated protein kinase 2; apoptosis, transferase; HET: AMP; 1.90A {Mus musculus} PDB: 2yaa_A* 2ya9_A* Length = 361 Back     alignment and structure
>2yab_A Death-associated protein kinase 2; apoptosis, transferase; HET: AMP; 1.90A {Mus musculus} PDB: 2yaa_A* 2ya9_A* Length = 361 Back     alignment and structure
>2a2a_A Death-associated protein kinase 2; autoinhibition, transferase; 1.47A {Homo sapiens} PDB: 2cke_A* 1wmk_A 1z9x_A 2a27_A 2x0g_A 2xuu_A* 2w4k_A* 2xzs_A Length = 321 Back     alignment and structure
>2a2a_A Death-associated protein kinase 2; autoinhibition, transferase; 1.47A {Homo sapiens} PDB: 2cke_A* 1wmk_A 1z9x_A 2a27_A 2x0g_A 2xuu_A* 2w4k_A* 2xzs_A Length = 321 Back     alignment and structure
>3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* Length = 484 Back     alignment and structure
>3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* Length = 484 Back     alignment and structure
>2w5a_A Serine/threonine-protein kinase NEK2; Ser/Thr protein kinase, nucleus, meiosis, mitosis, cytoplasm, metal-binding, phosphoprotein; HET: ADP; 1.55A {Homo sapiens} PDB: 2wqo_A* 2xk3_A* 2xk4_A* 2xk6_A* 2xk7_A* 2xk8_A* 2xkc_A* 2xkd_A* 2xke_A* 2xkf_A* 2xnm_A* 2xnn_A* 2xno_A* 2xnp_A* 4afe_A* 2jav_A* 2w5b_A* 2w5h_A 4a4x_A* Length = 279 Back     alignment and structure
>2w5a_A Serine/threonine-protein kinase NEK2; Ser/Thr protein kinase, nucleus, meiosis, mitosis, cytoplasm, metal-binding, phosphoprotein; HET: ADP; 1.55A {Homo sapiens} PDB: 2wqo_A* 2xk3_A* 2xk4_A* 2xk6_A* 2xk7_A* 2xk8_A* 2xkc_A* 2xkd_A* 2xke_A* 2xkf_A* 2xnm_A* 2xnn_A* 2xno_A* 2xnp_A* 4afe_A* 2jav_A* 2w5b_A* 2w5h_A 4a4x_A* Length = 279 Back     alignment and structure
>2ycf_A Serine/threonine-protein kinase CHK2; transferase, anticancer, anticancer drug design; HET: YCF; 1.77A {Homo sapiens} PDB: 2yiq_A* 2w7x_A* 2ycq_A* 2ycs_A* 2w0j_A* 2yir_A* 2yit_A* 2wtj_A* 2cn8_A* 2wtc_A* 2wtd_A* 2wti_A* 2cn5_A* 2xbj_A* 2xm8_A* 2xm9_A* 2xk9_A* 2ycr_A* Length = 322 Back     alignment and structure
>2ycf_A Serine/threonine-protein kinase CHK2; transferase, anticancer, anticancer drug design; HET: YCF; 1.77A {Homo sapiens} PDB: 2yiq_A* 2w7x_A* 2ycq_A* 2ycs_A* 2w0j_A* 2yir_A* 2yit_A* 2wtj_A* 2cn8_A* 2wtc_A* 2wtd_A* 2wti_A* 2cn5_A* 2xbj_A* 2xm8_A* 2xm9_A* 2xk9_A* 2ycr_A* Length = 322 Back     alignment and structure
>2y0a_A Death-associated protein kinase 1; transferase, calmodulin, esprit; HET: MES; 2.60A {Homo sapiens} Length = 326 Back     alignment and structure
>2y0a_A Death-associated protein kinase 1; transferase, calmodulin, esprit; HET: MES; 2.60A {Homo sapiens} Length = 326 Back     alignment and structure
>3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} Length = 504 Back     alignment and structure
>3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} Length = 504 Back     alignment and structure
>3i6u_A CDS1, serine/threonine-protein kinase CHK2; Ser/Thr protein kinase, FHA domain, ATP-binding, cell cycle, mutation, LI-fraumeni syndrome, magnesium; 3.00A {Homo sapiens} PDB: 3i6w_A Length = 419 Back     alignment and structure
>3i6u_A CDS1, serine/threonine-protein kinase CHK2; Ser/Thr protein kinase, FHA domain, ATP-binding, cell cycle, mutation, LI-fraumeni syndrome, magnesium; 3.00A {Homo sapiens} PDB: 3i6w_A Length = 419 Back     alignment and structure
>3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* Length = 494 Back     alignment and structure
>3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* Length = 494 Back     alignment and structure
>3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* Length = 486 Back     alignment and structure
>3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* Length = 486 Back     alignment and structure
>2pml_X PFPK7, Ser/Thr protein kinase; phosphorylati transferase, transferase; HET: ANP; 2.60A {Plasmodium falciparum} PDB: 2pmn_X* 2pmo_X* Length = 348 Back     alignment and structure
>2pml_X PFPK7, Ser/Thr protein kinase; phosphorylati transferase, transferase; HET: ANP; 2.60A {Plasmodium falciparum} PDB: 2pmn_X* 2pmo_X* Length = 348 Back     alignment and structure
>2a19_B Interferon-induced, double-stranded RNA-activated kinase; transferase, protein biosynthesis, protein synthesis transferase complex; HET: TPO ANP; 2.50A {Homo sapiens} PDB: 2a1a_B* Length = 284 Back     alignment and structure
>2a19_B Interferon-induced, double-stranded RNA-activated kinase; transferase, protein biosynthesis, protein synthesis transferase complex; HET: TPO ANP; 2.50A {Homo sapiens} PDB: 2a1a_B* Length = 284 Back     alignment and structure
>3cek_A Dual specificity protein kinase TTK; HMPS1, PYT, ESK, phosphotyros picked threonine kinase, SGC, structural genomics consortiu binding; HET: 7PE; 2.30A {Homo sapiens} PDB: 3gfw_A* 3h9f_A* 2x9e_A* 3hmp_A* 3hmn_A* 3hmo_A* Length = 313 Back     alignment and structure
>3cek_A Dual specificity protein kinase TTK; HMPS1, PYT, ESK, phosphotyros picked threonine kinase, SGC, structural genomics consortiu binding; HET: 7PE; 2.30A {Homo sapiens} PDB: 3gfw_A* 3h9f_A* 2x9e_A* 3hmp_A* 3hmn_A* 3hmo_A* Length = 313 Back     alignment and structure
>2y7j_A Phosphorylase B kinase gamma catalytic chain, testis/liver isoform; transferase; HET: B49; 2.50A {Homo sapiens} PDB: 1h0t_A 1lp1_B 1q2n_A 2spz_A 3mzw_B* 1ss1_A 2jwd_A 1bdc_A 1bdd_A 1fc2_C* 2b87_A 2b88_A 1h0t_B 1lp1_A 2b87_B 2b89_A 3s1k_A Length = 365 Back     alignment and structure
>2y7j_A Phosphorylase B kinase gamma catalytic chain, testis/liver isoform; transferase; HET: B49; 2.50A {Homo sapiens} PDB: 1h0t_A 1lp1_B 1q2n_A 2spz_A 3mzw_B* 1ss1_A 2jwd_A 1bdc_A 1bdd_A 1fc2_C* 2b87_A 2b88_A 1h0t_B 1lp1_A 2b87_B 2b89_A 3s1k_A Length = 365 Back     alignment and structure
>3dbq_A Dual specificity protein kinase TTK; MPS1 structure, kinase activation, phosphorylation, ATP- binding, nucleotide-binding, phosphoprotein; 2.70A {Homo sapiens} Length = 343 Back     alignment and structure
>3dbq_A Dual specificity protein kinase TTK; MPS1 structure, kinase activation, phosphorylation, ATP- binding, nucleotide-binding, phosphoprotein; 2.70A {Homo sapiens} Length = 343 Back     alignment and structure
>1zy4_A Serine/threonine-protein kinase GCN2; translation regulator, signal transduction, acid starvation, starvation stress response; 1.95A {Saccharomyces cerevisiae} PDB: 1zy5_A* 1zyd_A* 1zyc_A* 1zxe_A Length = 303 Back     alignment and structure
>1zy4_A Serine/threonine-protein kinase GCN2; translation regulator, signal transduction, acid starvation, starvation stress response; 1.95A {Saccharomyces cerevisiae} PDB: 1zy5_A* 1zyd_A* 1zyc_A* 1zxe_A Length = 303 Back     alignment and structure
>3qd2_B Eukaryotic translation initiation factor 2-alpha; EIF2A kinase, phosphoryalation, gene regulation; HET: TPO; 2.81A {Mus musculus} Length = 332 Back     alignment and structure
>3qd2_B Eukaryotic translation initiation factor 2-alpha; EIF2A kinase, phosphoryalation, gene regulation; HET: TPO; 2.81A {Mus musculus} Length = 332 Back     alignment and structure
>3uto_A Twitchin; kinase, muscle sarcomere, transferase; HET: FLC P33; 2.40A {Caenorhabditis elegans} PDB: 1koa_A Length = 573 Back     alignment and structure
>3uto_A Twitchin; kinase, muscle sarcomere, transferase; HET: FLC P33; 2.40A {Caenorhabditis elegans} PDB: 1koa_A Length = 573 Back     alignment and structure
>2zmd_A Dual specificity protein kinase TTK; MPS1, T686A, ATP-binding, nucleotide-bindi phosphoprotein, serine/threonine-protein kinase; HET: 537 7PE; 2.88A {Homo sapiens} PDB: 2zmc_A* Length = 390 Back     alignment and structure
>2zmd_A Dual specificity protein kinase TTK; MPS1, T686A, ATP-binding, nucleotide-bindi phosphoprotein, serine/threonine-protein kinase; HET: 537 7PE; 2.88A {Homo sapiens} PDB: 2zmc_A* Length = 390 Back     alignment and structure
>3p23_A Serine/threonine-protein kinase/endoribonuclease; kinase domain, kinase and RNAse function, ATP binding ssRNA dephosphorylated, hydrolase; HET: ADP; 2.70A {Homo sapiens} Length = 432 Back     alignment and structure
>3p23_A Serine/threonine-protein kinase/endoribonuclease; kinase domain, kinase and RNAse function, ATP binding ssRNA dephosphorylated, hydrolase; HET: ADP; 2.70A {Homo sapiens} Length = 432 Back     alignment and structure
>3fhr_A MAP kinase-activated protein kinase 3; kinase-inhibitor complex, ATP-binding, cytoplasm, nucleotide-binding, nucleus, phosphoprotein, polymorphism; HET: P4O; 1.90A {Homo sapiens} PDB: 3fxw_A* 3r1n_A* 3she_A* 2oza_A 3fyk_X* 3fyj_X* 2p3g_X* 3ka0_A* 3fpm_A* 2pzy_A* 3a2c_A* 3kc3_A* 3gok_A* 2jbo_A* 2jbp_A* 3r2y_A* 3r30_A* 3r2b_A* Length = 336 Back     alignment and structure
>3fhr_A MAP kinase-activated protein kinase 3; kinase-inhibitor complex, ATP-binding, cytoplasm, nucleotide-binding, nucleus, phosphoprotein, polymorphism; HET: P4O; 1.90A {Homo sapiens} PDB: 3fxw_A* 3r1n_A* 3she_A* 2oza_A 3fyk_X* 3fyj_X* 2p3g_X* 3ka0_A* 3fpm_A* 2pzy_A* 3a2c_A* 3kc3_A* 3gok_A* 2jbo_A* 2jbp_A* 3r2y_A* 3r30_A* 3r2b_A* Length = 336 Back     alignment and structure
>3fe3_A MAP/microtubule affinity-regulating kinase 3; serine/threonine protein kinase, MARK;PAR-1, UBA domai TAK1;P78;MARK3, ATP-binding; 1.90A {Homo sapiens} PDB: 2qnj_A 1y8g_A* 1zmw_A 1zmu_A 1zmv_A 2wzj_A 2r0i_A 2hak_A 3iec_A Length = 328 Back     alignment and structure
>3fe3_A MAP/microtubule affinity-regulating kinase 3; serine/threonine protein kinase, MARK;PAR-1, UBA domai TAK1;P78;MARK3, ATP-binding; 1.90A {Homo sapiens} PDB: 2qnj_A 1y8g_A* 1zmw_A 1zmu_A 1zmv_A 2wzj_A 2r0i_A 2hak_A 3iec_A Length = 328 Back     alignment and structure
>2h6d_A 5'-AMP-activated protein kinase catalytic subunit alpha-2; ATP-binding, cholesterol biosynthesis, fatty acid biosynthesis;kinase, lipid synthesis; 1.85A {Homo sapiens} PDB: 3aqv_A* 2yza_A* Length = 276 Back     alignment and structure
>2h6d_A 5'-AMP-activated protein kinase catalytic subunit alpha-2; ATP-binding, cholesterol biosynthesis, fatty acid biosynthesis;kinase, lipid synthesis; 1.85A {Homo sapiens} PDB: 3aqv_A* 2yza_A* Length = 276 Back     alignment and structure
>1nxk_A MAP kinase-activated protein kinase 2; MK2, phosphorylation, staurosporine, transfe; HET: STU; 2.70A {Homo sapiens} SCOP: d.144.1.7 PDB: 1kwp_A* 1ny3_A* 2onl_C Length = 400 Back     alignment and structure
>1nxk_A MAP kinase-activated protein kinase 2; MK2, phosphorylation, staurosporine, transfe; HET: STU; 2.70A {Homo sapiens} SCOP: d.144.1.7 PDB: 1kwp_A* 1ny3_A* 2onl_C Length = 400 Back     alignment and structure
>2ac3_A MAP kinase-interacting serine/threonine kinase 2; DFD motif, transferase; 2.10A {Homo sapiens} PDB: 2hw7_A* 2ac5_A* 2hw6_A Length = 316 Back     alignment and structure
>2ac3_A MAP kinase-interacting serine/threonine kinase 2; DFD motif, transferase; 2.10A {Homo sapiens} PDB: 2hw7_A* 2ac5_A* 2hw6_A Length = 316 Back     alignment and structure
>2rio_A Serine/threonine-protein kinase/endoribonuclease IRE1; protein-nucleotide complex, ATP-binding, endoplasmic reticulum, glycoprotein; HET: ADP; 2.40A {Saccharomyces cerevisiae} PDB: 3lj0_A* 3lj1_A* 3lj2_A* 3fbv_A* 3sdm_A* 3sdj_A* Length = 434 Back     alignment and structure
>2rio_A Serine/threonine-protein kinase/endoribonuclease IRE1; protein-nucleotide complex, ATP-binding, endoplasmic reticulum, glycoprotein; HET: ADP; 2.40A {Saccharomyces cerevisiae} PDB: 3lj0_A* 3lj1_A* 3lj2_A* 3fbv_A* 3sdm_A* 3sdj_A* Length = 434 Back     alignment and structure
>3h4j_B AMPK kdaid, SNF1-like protein kinase SSP2; ATP-binding, nucleotide-binding, phosphoprotei serine/threonine-protein kinase, transferase; 2.80A {Schizosaccharomyces pombe} Length = 336 Back     alignment and structure
>3h4j_B AMPK kdaid, SNF1-like protein kinase SSP2; ATP-binding, nucleotide-binding, phosphoprotei serine/threonine-protein kinase, transferase; 2.80A {Schizosaccharomyces pombe} Length = 336 Back     alignment and structure
>3tki_A Serine/threonine-protein kinase CHK1; cell checkpoint, transferase-transferase inhib complex; HET: S25; 1.60A {Homo sapiens} PDB: 2qhm_A* 2r0u_A* 3tkh_A* 2qhn_A* 2hy0_A* 2hog_A* 2hxq_A* 2hxl_A* 3f9n_A* Length = 323 Back     alignment and structure
>3tki_A Serine/threonine-protein kinase CHK1; cell checkpoint, transferase-transferase inhib complex; HET: S25; 1.60A {Homo sapiens} PDB: 2qhm_A* 2r0u_A* 3tkh_A* 2qhn_A* 2hy0_A* 2hog_A* 2hxq_A* 2hxl_A* 3f9n_A* Length = 323 Back     alignment and structure
>3p1a_A MYT1 kinase, membrane-associated tyrosine- and threonine-speci inhibitory kinase; structural genomics, structural genomics consortium, SGC; 1.70A {Homo sapiens} Length = 311 Back     alignment and structure
>3p1a_A MYT1 kinase, membrane-associated tyrosine- and threonine-speci inhibitory kinase; structural genomics, structural genomics consortium, SGC; 1.70A {Homo sapiens} Length = 311 Back     alignment and structure
>2yex_A Serine/threonine-protein kinase CHK1; transferase, cell cycle; HET: YEX; 1.30A {Homo sapiens} PDB: 2x8e_A* 2ydk_A* 2ydj_A* 2yer_A* 2ydi_A* 1nvq_A* 1nvr_A* 1nvs_A* 2wmq_A* 2wmr_A* 2wms_A* 2wmt_A* 2wmu_A* 2wmv_A* 2wmw_A* 2wmx_A* 2x8d_A* 2x8i_A* 2xey_A* 2xez_A* ... Length = 276 Back     alignment and structure
>2yex_A Serine/threonine-protein kinase CHK1; transferase, cell cycle; HET: YEX; 1.30A {Homo sapiens} PDB: 2x8e_A* 2ydk_A* 2ydj_A* 2yer_A* 2ydi_A* 1nvq_A* 1nvr_A* 1nvs_A* 2wmq_A* 2wmr_A* 2wms_A* 2wmt_A* 2wmu_A* 2wmv_A* 2wmw_A* 2wmx_A* 2x8d_A* 2x8i_A* 2xey_A* 2xez_A* ... Length = 276 Back     alignment and structure
>2y94_A 5'-AMP-activated protein kinase catalytic subunit; transferase, nucleotide-binding, staurosporine-binding, serine/threonine-protein kinase; HET: TPO STU AMP; 3.24A {Rattus norvegicus} Length = 476 Back     alignment and structure
>2y94_A 5'-AMP-activated protein kinase catalytic subunit; transferase, nucleotide-binding, staurosporine-binding, serine/threonine-protein kinase; HET: TPO STU AMP; 3.24A {Rattus norvegicus} Length = 476 Back     alignment and structure
>3uc3_A Serine/threonine-protein kinase SRK2I; SNRK2, ABA signaling, transferase; 1.90A {Arabidopsis thaliana} PDB: 3zut_A 3zuu_A 3uc4_A 3ujg_A 3udb_A Length = 361 Back     alignment and structure
>3uc3_A Serine/threonine-protein kinase SRK2I; SNRK2, ABA signaling, transferase; 1.90A {Arabidopsis thaliana} PDB: 3zut_A 3zuu_A 3uc4_A 3ujg_A 3udb_A Length = 361 Back     alignment and structure
>3dls_A PAS domain-containing serine/threonine-protein KI; PAS kinase, PASK, protein kinase, drug discovery, ATP-bindin kinase, nucleotide-binding; HET: ADP; 2.30A {Homo sapiens} Length = 335 Back     alignment and structure
>3dls_A PAS domain-containing serine/threonine-protein KI; PAS kinase, PASK, protein kinase, drug discovery, ATP-bindin kinase, nucleotide-binding; HET: ADP; 2.30A {Homo sapiens} Length = 335 Back     alignment and structure
>1x8b_A WEE1HU, WEE1-like protein kinase; cell cycle, transferase; HET: 824; 1.81A {Homo sapiens} PDB: 3bi6_A* 3biz_A* 3cqe_A* 3cr0_A* 2in6_A* 2io6_A* 2z2w_A* Length = 289 Back     alignment and structure
>1x8b_A WEE1HU, WEE1-like protein kinase; cell cycle, transferase; HET: 824; 1.81A {Homo sapiens} PDB: 3bi6_A* 3biz_A* 3cqe_A* 3cr0_A* 2in6_A* 2io6_A* 2z2w_A* Length = 289 Back     alignment and structure
>4euu_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: SEP BX7; 1.80A {Homo sapiens} Length = 319 Back     alignment and structure
>4euu_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: SEP BX7; 1.80A {Homo sapiens} Length = 319 Back     alignment and structure
>2wtk_C Serine/threonine-protein kinase 11; transferase-metal-binding protein complex, transferase metal protein complex, nucleus; HET: ANP; 2.65A {Homo sapiens} Length = 305 Back     alignment and structure
>2wtk_C Serine/threonine-protein kinase 11; transferase-metal-binding protein complex, transferase metal protein complex, nucleus; HET: ANP; 2.65A {Homo sapiens} Length = 305 Back     alignment and structure
>4eut_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: BX7; 2.60A {Homo sapiens} Length = 396 Back     alignment and structure
>4eut_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: BX7; 2.60A {Homo sapiens} Length = 396 Back     alignment and structure
>2buj_A Serine/threonine-protein kinase 16; transferase, ATP-binding, lipoprotein, myristate, PA phosphorylation; HET: STU; 2.6A {Homo sapiens} Length = 317 Back     alignment and structure
>2buj_A Serine/threonine-protein kinase 16; transferase, ATP-binding, lipoprotein, myristate, PA phosphorylation; HET: STU; 2.6A {Homo sapiens} Length = 317 Back     alignment and structure
>1uu3_A HPDK1, 3-phosphoinositide dependent protein kinase-1; PKB, inhibitor, LY333531, diabetes, cancer, transferase, serine/threonine-protein kinase; HET: SEP LY4; 1.7A {Homo sapiens} SCOP: d.144.1.7 PDB: 1okz_A* 1oky_A* 1uu7_A* 1uu8_A* 2biy_A* 3rwp_A* 2xch_A* 3rwq_A* 3sc1_A* 3qd0_A* 2r7b_A* 3ion_A* 3qcq_A* 3qcs_A* 3qcx_A* 3qcy_A* 3iop_A* 3qd3_A* 3qd4_A* 3h9o_A* ... Length = 310 Back     alignment and structure
>1uu3_A HPDK1, 3-phosphoinositide dependent protein kinase-1; PKB, inhibitor, LY333531, diabetes, cancer, transferase, serine/threonine-protein kinase; HET: SEP LY4; 1.7A {Homo sapiens} SCOP: d.144.1.7 PDB: 1okz_A* 1oky_A* 1uu7_A* 1uu8_A* 2biy_A* 3rwp_A* 2xch_A* 3rwq_A* 3sc1_A* 3qd0_A* 2r7b_A* 3ion_A* 3qcq_A* 3qcs_A* 3qcx_A* 3qcy_A* 3iop_A* 3qd3_A* 3qd4_A* 3h9o_A* ... Length = 310 Back     alignment and structure
>3lm5_A Serine/threonine-protein kinase 17B; STK17B, serine/threonine kinase 17B, DRAK2, DAP kinase relat apoptosis-inducing protein kinase 2; HET: QUE; 2.29A {Homo sapiens} PDB: 3lm0_A* Length = 327 Back     alignment and structure
>3lm5_A Serine/threonine-protein kinase 17B; STK17B, serine/threonine kinase 17B, DRAK2, DAP kinase relat apoptosis-inducing protein kinase 2; HET: QUE; 2.29A {Homo sapiens} PDB: 3lm0_A* Length = 327 Back     alignment and structure
>3lm5_A Serine/threonine-protein kinase 17B; STK17B, serine/threonine kinase 17B, DRAK2, DAP kinase relat apoptosis-inducing protein kinase 2; HET: QUE; 2.29A {Homo sapiens} PDB: 3lm0_A* Length = 327 Back     alignment and structure
>1tki_A Titin; serine kinase, muscle, autoinhibition; 2.00A {Homo sapiens} SCOP: d.144.1.7 Length = 321 Back     alignment and structure
>1tki_A Titin; serine kinase, muscle, autoinhibition; 2.00A {Homo sapiens} SCOP: d.144.1.7 Length = 321 Back     alignment and structure
>1tki_A Titin; serine kinase, muscle, autoinhibition; 2.00A {Homo sapiens} SCOP: d.144.1.7 Length = 321 Back     alignment and structure
>3qa8_A MGC80376 protein; kinase ubiquitin-like domain, phosphorylation, kinase domain ubiquitin-like domain, kinase, substrate binding; 3.60A {Xenopus laevis} PDB: 3qad_A* 3rzf_A* Length = 676 Back     alignment and structure
>3qa8_A MGC80376 protein; kinase ubiquitin-like domain, phosphorylation, kinase domain ubiquitin-like domain, kinase, substrate binding; 3.60A {Xenopus laevis} PDB: 3qad_A* 3rzf_A* Length = 676 Back     alignment and structure
>1kob_A Twitchin; kinase, intrasteric regulation; 2.30A {Aplysia californica} SCOP: d.144.1.7 Length = 387 Back     alignment and structure
>1kob_A Twitchin; kinase, intrasteric regulation; 2.30A {Aplysia californica} SCOP: d.144.1.7 Length = 387 Back     alignment and structure
>1kob_A Twitchin; kinase, intrasteric regulation; 2.30A {Aplysia californica} SCOP: d.144.1.7 Length = 387 Back     alignment and structure
>3e7e_A HBUB1, BUB1A, mitotic checkpoint serine/threonine-protein kinas; spindle assembly checkpoint, mitosis, kinase, activation, KE CDC20, ATP-binding; HET: ATP; 2.31A {Homo sapiens} Length = 365 Back     alignment and structure
>3e7e_A HBUB1, BUB1A, mitotic checkpoint serine/threonine-protein kinas; spindle assembly checkpoint, mitosis, kinase, activation, KE CDC20, ATP-binding; HET: ATP; 2.31A {Homo sapiens} Length = 365 Back     alignment and structure
>3byv_A Rhoptry kinase; malaria, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} PDB: 2w1z_A Length = 377 Back     alignment and structure
>3byv_A Rhoptry kinase; malaria, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} PDB: 2w1z_A Length = 377 Back     alignment and structure
>2x4f_A Myosin light chain kinase family member 4; LUNG, breast cancer, transferase, serine/threonine-protein kinase, nucleotide-binding; HET: 16X 1PE; 2.67A {Homo sapiens} Length = 373 Back     alignment and structure
>2x4f_A Myosin light chain kinase family member 4; LUNG, breast cancer, transferase, serine/threonine-protein kinase, nucleotide-binding; HET: 16X 1PE; 2.67A {Homo sapiens} Length = 373 Back     alignment and structure
>2x4f_A Myosin light chain kinase family member 4; LUNG, breast cancer, transferase, serine/threonine-protein kinase, nucleotide-binding; HET: 16X 1PE; 2.67A {Homo sapiens} Length = 373 Back     alignment and structure
>3a62_A Ribosomal protein S6 kinase beta-1; kinase domain, inactive, active, ribosomal S6 kinase, activation, alternative initiation, ATP-binding; HET: TPO STU; 2.35A {Homo sapiens} PDB: 3a61_A* 3a60_A* Length = 327 Back     alignment and structure
>3a62_A Ribosomal protein S6 kinase beta-1; kinase domain, inactive, active, ribosomal S6 kinase, activation, alternative initiation, ATP-binding; HET: TPO STU; 2.35A {Homo sapiens} PDB: 3a61_A* 3a60_A* Length = 327 Back     alignment and structure
>3g51_A Ribosomal protein S6 kinase alpha-3; N-terminal kinase domain of P90 ribosomal S6 kinase 2, ATP- binding, nucleotide-binding, phosphoprotein; HET: ANP; 1.80A {Mus musculus} PDB: 2z7q_A* 2z7r_A* 2z7s_A* Length = 325 Back     alignment and structure
>3g51_A Ribosomal protein S6 kinase alpha-3; N-terminal kinase domain of P90 ribosomal S6 kinase 2, ATP- binding, nucleotide-binding, phosphoprotein; HET: ANP; 1.80A {Mus musculus} PDB: 2z7q_A* 2z7r_A* 2z7s_A* Length = 325 Back     alignment and structure
>3txo_A PKC-L, NPKC-ETA, protein kinase C ETA type; phosphotransferase, transferase-transferase inhibito; HET: TPO 07U; 2.05A {Homo sapiens} Length = 353 Back     alignment and structure
>3txo_A PKC-L, NPKC-ETA, protein kinase C ETA type; phosphotransferase, transferase-transferase inhibito; HET: TPO 07U; 2.05A {Homo sapiens} Length = 353 Back     alignment and structure
>2zv2_A Calcium/calmodulin-dependent protein kinase kinas; beta, camkk2, E.C.2.7.11.17, phosphorylation, AMPKK, metabolism, binding, calmodulin-binding; HET: 609; 2.40A {Homo sapiens} Length = 298 Back     alignment and structure
>2zv2_A Calcium/calmodulin-dependent protein kinase kinas; beta, camkk2, E.C.2.7.11.17, phosphorylation, AMPKK, metabolism, binding, calmodulin-binding; HET: 609; 2.40A {Homo sapiens} Length = 298 Back     alignment and structure
>1o6l_A RAC-beta serine/threonine protein kinase; protein kinase, transferase, serine/threonine-protein kinase; HET: TPO ANP; 1.6A {Homo sapiens} SCOP: d.144.1.7 PDB: 2jdo_A* 2jdr_A* 2uw9_A* 2x37_A* 2x39_A* 2xh5_A* 3d0e_A* 3e87_A* 3e88_A* 3e8d_A* 1o6k_A* 1mrv_A 1mry_A 1gzn_A 1gzk_A 1gzo_A 3qkl_A* 3ocb_A* 3ow4_A* 3qkk_A* ... Length = 337 Back     alignment and structure
>1o6l_A RAC-beta serine/threonine protein kinase; protein kinase, transferase, serine/threonine-protein kinase; HET: TPO ANP; 1.6A {Homo sapiens} SCOP: d.144.1.7 PDB: 2jdo_A* 2jdr_A* 2uw9_A* 2x37_A* 2x39_A* 2xh5_A* 3d0e_A* 3e87_A* 3e88_A* 3e8d_A* 1o6k_A* 1mrv_A 1mry_A 1gzn_A 1gzk_A 1gzo_A 3qkl_A* 3ocb_A* 3ow4_A* 3qkk_A* ... Length = 337 Back     alignment and structure
>3ll6_A Cyclin G-associated kinase; transferase, protein kinase, serine/threonine kinase, cyclin clathrine, membrane trafficking, structural genomics; 2.10A {Homo sapiens} Length = 337 Back     alignment and structure
>3ll6_A Cyclin G-associated kinase; transferase, protein kinase, serine/threonine kinase, cyclin clathrine, membrane trafficking, structural genomics; 2.10A {Homo sapiens} Length = 337 Back     alignment and structure
>2i0e_A Protein kinase C-beta II; serine/threonine protein kinase, transferase; HET: TPO SEP PDS; 2.60A {Homo sapiens} PDB: 3iw4_A* Length = 353 Back     alignment and structure
>2i0e_A Protein kinase C-beta II; serine/threonine protein kinase, transferase; HET: TPO SEP PDS; 2.60A {Homo sapiens} PDB: 3iw4_A* Length = 353 Back     alignment and structure
>1fot_A TPK1 delta, CAMP-dependent protein kinase type 1; open conformation, transferase; HET: TPO; 2.80A {Saccharomyces cerevisiae} SCOP: d.144.1.7 Length = 318 Back     alignment and structure
>1fot_A TPK1 delta, CAMP-dependent protein kinase type 1; open conformation, transferase; HET: TPO; 2.80A {Saccharomyces cerevisiae} SCOP: d.144.1.7 Length = 318 Back     alignment and structure
>2iwi_A Serine/threonine-protein kinase PIM-2; nucleotide-binding, cancer, leukemia, transferase, ATP-binding, proto- oncogene, phosphorylation; HET: HB1; 2.80A {Homo sapiens} Length = 312 Back     alignment and structure
>2iwi_A Serine/threonine-protein kinase PIM-2; nucleotide-binding, cancer, leukemia, transferase, ATP-binding, proto- oncogene, phosphorylation; HET: HB1; 2.80A {Homo sapiens} Length = 312 Back     alignment and structure
>1xjd_A Protein kinase C, theta type; PKC-theta, ATP, AMP,, transferase; HET: TPO SEP STU; 2.00A {Homo sapiens} SCOP: d.144.1.7 PDB: 2jed_A* Length = 345 Back     alignment and structure
>1xjd_A Protein kinase C, theta type; PKC-theta, ATP, AMP,, transferase; HET: TPO SEP STU; 2.00A {Homo sapiens} SCOP: d.144.1.7 PDB: 2jed_A* Length = 345 Back     alignment and structure
>1rdq_E PKA C-alpha, CAMP-dependent protein kinase, alpha-catalytic SU; CAMP-dependent protein kinase,catalytic mechanism, ATP hydro two nucleotide states; HET: TPO SEP ADP ATP; 1.26A {Mus musculus} SCOP: d.144.1.7 PDB: 2erz_E* 3fjq_E* 1bkx_A* 1atp_E* 1fmo_E* 1j3h_A* 1jlu_E* 1bx6_A* 1re8_A* 1rej_A* 1rek_A* 2cpk_E* 2qcs_A* 2qvs_E* 1l3r_E* 3idb_A* 3idc_A* 3o7l_D* 3ow3_A* 3tnp_C* ... Length = 350 Back     alignment and structure
>1rdq_E PKA C-alpha, CAMP-dependent protein kinase, alpha-catalytic SU; CAMP-dependent protein kinase,catalytic mechanism, ATP hydro two nucleotide states; HET: TPO SEP ADP ATP; 1.26A {Mus musculus} SCOP: d.144.1.7 PDB: 2erz_E* 3fjq_E* 1bkx_A* 1atp_E* 1fmo_E* 1j3h_A* 1jlu_E* 1bx6_A* 1re8_A* 1rej_A* 1rek_A* 2cpk_E* 2qcs_A* 2qvs_E* 1l3r_E* 3idb_A* 3idc_A* 3o7l_D* 3ow3_A* 3tnp_C* ... Length = 350 Back     alignment and structure
>2r5t_A Serine/threonine-protein kinase SGK1; AGC protein kinase, apoptosis, ATP-binding, cytoplasm, endoplasmic reticulum, nucleotide-binding, nucleus; HET: ANP; 1.90A {Homo sapiens} PDB: 3hdm_A* 3hdn_A* Length = 373 Back     alignment and structure
>2r5t_A Serine/threonine-protein kinase SGK1; AGC protein kinase, apoptosis, ATP-binding, cytoplasm, endoplasmic reticulum, nucleotide-binding, nucleus; HET: ANP; 1.90A {Homo sapiens} PDB: 3hdm_A* 3hdn_A* Length = 373 Back     alignment and structure
>3a99_A Proto-oncogene serine/threonine-protein kinase PI; PIM-1, P27KIP1, peptide drug, prostate cancer, transferase; HET: ANP; 1.60A {Homo sapiens} PDB: 3bgq_A* 3bgp_A* 2obj_A* 3bgz_A* 3t9i_A* 3dcv_A* 1xws_A* 2xj1_A* 2xix_A* 2xiz_A* 2xj0_A* 2xiy_A* 2xj2_A* 3f2a_A* 1xr1_A* 1xqz_A* 3cy2_A* 3cxw_A* 3cy3_A* 2bik_B* ... Length = 320 Back     alignment and structure
>3a99_A Proto-oncogene serine/threonine-protein kinase PI; PIM-1, P27KIP1, peptide drug, prostate cancer, transferase; HET: ANP; 1.60A {Homo sapiens} PDB: 3bgq_A* 3bgp_A* 2obj_A* 3bgz_A* 3t9i_A* 3dcv_A* 1xws_A* 2xj1_A* 2xix_A* 2xiz_A* 2xj0_A* 2xiy_A* 2xj2_A* 3f2a_A* 1xr1_A* 1xqz_A* 3cy2_A* 3cxw_A* 3cy3_A* 2bik_B* ... Length = 320 Back     alignment and structure
>3pfq_A PKC-B, PKC-beta, protein kinase C beta type; phosphorylation, transferase; HET: TPO SEP ANP; 4.00A {Rattus norvegicus} PDB: 1tbn_A 1tbo_A 2e73_A Length = 674 Back     alignment and structure
>3pfq_A PKC-B, PKC-beta, protein kinase C beta type; phosphorylation, transferase; HET: TPO SEP ANP; 4.00A {Rattus norvegicus} PDB: 1tbn_A 1tbo_A 2e73_A Length = 674 Back     alignment and structure
>2clq_A Mitogen-activated protein kinase kinase kinase 5; transferase, metal-binding, apoptosis; HET: STU; 2.3A {Homo sapiens} Length = 295 Back     alignment and structure
>2clq_A Mitogen-activated protein kinase kinase kinase 5; transferase, metal-binding, apoptosis; HET: STU; 2.3A {Homo sapiens} Length = 295 Back     alignment and structure
>4ejn_A RAC-alpha serine/threonine-protein kinase; AKT1, autoinhibition, allosteric inhibitor, kinase inhibitor hydrophobic collapase, ATPase; HET: 0R4; 2.19A {Homo sapiens} PDB: 3o96_A* Length = 446 Back     alignment and structure
>4ejn_A RAC-alpha serine/threonine-protein kinase; AKT1, autoinhibition, allosteric inhibitor, kinase inhibitor hydrophobic collapase, ATPase; HET: 0R4; 2.19A {Homo sapiens} PDB: 3o96_A* Length = 446 Back     alignment and structure
>4fr4_A YANK1, serine/threonine-protein kinase 32A; structural genomics, structural genomics consortium, SGC, TR; HET: STU; 2.29A {Homo sapiens} Length = 384 Back     alignment and structure
>4fr4_A YANK1, serine/threonine-protein kinase 32A; structural genomics, structural genomics consortium, SGC, TR; HET: STU; 2.29A {Homo sapiens} Length = 384 Back     alignment and structure
>3dzo_A Rhoptry kinase domain; parasitic disease, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} Length = 413 Back     alignment and structure
>3dzo_A Rhoptry kinase domain; parasitic disease, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} Length = 413 Back     alignment and structure
>3c4z_A Rhodopsin kinase; Ser/Thr kinase, RGS homology domain, G protein coupled recep kinase, GRK, GRK1, P-loop, autophosphoryl ADP, ATP-binding; HET: ADP; 1.84A {Bos taurus} PDB: 3c4x_A* 3c4y_A 3c4w_A* 3c50_A* 3c51_A* 3qc9_A* 2i94_B Length = 543 Back     alignment and structure
>3c4z_A Rhodopsin kinase; Ser/Thr kinase, RGS homology domain, G protein coupled recep kinase, GRK, GRK1, P-loop, autophosphoryl ADP, ATP-binding; HET: ADP; 1.84A {Bos taurus} PDB: 3c4x_A* 3c4y_A 3c4w_A* 3c50_A* 3c51_A* 3qc9_A* 2i94_B Length = 543 Back     alignment and structure
>3a8x_A Protein kinase C IOTA type; transferase; HET: TPO; 2.00A {Homo sapiens} PDB: 3a8w_A* 1zrz_A* Length = 345 Back     alignment and structure
>3a8x_A Protein kinase C IOTA type; transferase; HET: TPO; 2.00A {Homo sapiens} PDB: 3a8w_A* 1zrz_A* Length = 345 Back     alignment and structure
>2acx_A G protein-coupled receptor kinase 6; GRK, G transferase; HET: ANP; 2.60A {Homo sapiens} PDB: 3nyn_A* 3nyo_A* Length = 576 Back     alignment and structure
>2acx_A G protein-coupled receptor kinase 6; GRK, G transferase; HET: ANP; 2.60A {Homo sapiens} PDB: 3nyn_A* 3nyo_A* Length = 576 Back     alignment and structure
>1vzo_A Ribosomal protein S6 kinase alpha 5; protein kinase, transferase, phosphorylation, serine/threonine protein kinase; 1.8A {Homo sapiens} SCOP: d.144.1.7 Length = 355 Back     alignment and structure
>1vzo_A Ribosomal protein S6 kinase alpha 5; protein kinase, transferase, phosphorylation, serine/threonine protein kinase; 1.8A {Homo sapiens} SCOP: d.144.1.7 Length = 355 Back     alignment and structure
>4dc2_A Protein kinase C IOTA type; kinase, substrate, cell polarity, atypical PKC, trans transferase substrate complex; HET: TPO ADE; 2.40A {Mus musculus} Length = 396 Back     alignment and structure
>4dc2_A Protein kinase C IOTA type; kinase, substrate, cell polarity, atypical PKC, trans transferase substrate complex; HET: TPO ADE; 2.40A {Mus musculus} Length = 396 Back     alignment and structure
>3pvu_A Beta-adrenergic receptor kinase 1; transferase, serine/threonine-protein kinase, ATP-binding, I membrane; HET: QRW; 2.48A {Bos taurus} PDB: 3psc_A* 3pvw_A* 1omw_A 1ym7_A 2bcj_A* 3cik_A 3krw_A* 3krx_A* 1bak_A Length = 695 Back     alignment and structure
>3pvu_A Beta-adrenergic receptor kinase 1; transferase, serine/threonine-protein kinase, ATP-binding, I membrane; HET: QRW; 2.48A {Bos taurus} PDB: 3psc_A* 3pvw_A* 1omw_A 1ym7_A 2bcj_A* 3cik_A 3krw_A* 3krx_A* 1bak_A Length = 695 Back     alignment and structure
>2wqm_A Serine/threonine-protein kinase NEK7; ATP-binding, polymorphism, metal-binding, cell cycle kinase, mitosis, cytoplasm, magnesium, transferase; 2.10A {Homo sapiens} PDB: 2wqn_A* Length = 310 Back     alignment and structure
>2wqm_A Serine/threonine-protein kinase NEK7; ATP-binding, polymorphism, metal-binding, cell cycle kinase, mitosis, cytoplasm, magnesium, transferase; 2.10A {Homo sapiens} PDB: 2wqn_A* Length = 310 Back     alignment and structure
>2wqm_A Serine/threonine-protein kinase NEK7; ATP-binding, polymorphism, metal-binding, cell cycle kinase, mitosis, cytoplasm, magnesium, transferase; 2.10A {Homo sapiens} PDB: 2wqn_A* Length = 310 Back     alignment and structure
>3q60_A ROP5B; pseudokinase, transferase; HET: ATP; 1.72A {Toxoplasma gondii} PDB: 3q5z_A* Length = 371 Back     alignment and structure
>3q60_A ROP5B; pseudokinase, transferase; HET: ATP; 1.72A {Toxoplasma gondii} PDB: 3q5z_A* Length = 371 Back     alignment and structure
>4g3f_A NF-kappa-beta-inducing kinase; non-RD kinase, protein serine/threonine kinase, S based drug design, MAP3K14, transferase; HET: 0WB; 1.64A {Mus musculus} PDB: 4g3g_A* 4g3c_A 4dn5_A* Length = 336 Back     alignment and structure
>4g3f_A NF-kappa-beta-inducing kinase; non-RD kinase, protein serine/threonine kinase, S based drug design, MAP3K14, transferase; HET: 0WB; 1.64A {Mus musculus} PDB: 4g3g_A* 4g3c_A 4dn5_A* Length = 336 Back     alignment and structure
>1q4k_B Serine/threonine-protein kinase PLK; six-stranded anti-parallel beta sheet with one alpha helix, transferase; HET: TPO; 2.30A {Homo sapiens} SCOP: d.223.1.2 d.223.1.2 Length = 259 Back     alignment and structure
>4aw2_A Serine/threonine-protein kinase MRCK alpha; transferase, CDC42BPA; HET: 22E; 1.70A {Rattus norvegicus} PDB: 3tku_A* 3qfv_A* Length = 437 Back     alignment and structure
>4aw2_A Serine/threonine-protein kinase MRCK alpha; transferase, CDC42BPA; HET: 22E; 1.70A {Rattus norvegicus} PDB: 3tku_A* 3qfv_A* Length = 437 Back     alignment and structure
>3p34_A Serine/threonine-protein kinase PLK1; phosphoprotein binding domain, PLK1, kinase, transferase; HET: TPO; 1.40A {Homo sapiens} PDB: 3p2z_A* 3p2w_A* 3p35_A* 3p36_A* 3p37_A* 3q1i_A* 2ogq_A 2ojs_A* 2ojx_A 3bzi_A* 3mhn_A* 3mhq_A 3mq8_B* 4dfw_A* 1q4o_A* 1umw_A* 3hik_A* 3rq7_A* 3fvh_A* 3hih_A ... Length = 232 Back     alignment and structure
>3v8s_A RHO-associated protein kinase 1; dimerization, myosin, transferase, inhibitor, transf transferase inhibitor complex; HET: 0HD; 2.29A {Homo sapiens} PDB: 3tv7_A* 2etr_A* 2esm_A* 2eto_A* 2etk_A* 3d9v_A* 3ncz_A* 3ndm_A* 2v55_A* 2f2u_A* 2h9v_A* Length = 410 Back     alignment and structure
>3v8s_A RHO-associated protein kinase 1; dimerization, myosin, transferase, inhibitor, transf transferase inhibitor complex; HET: 0HD; 2.29A {Homo sapiens} PDB: 3tv7_A* 2etr_A* 2esm_A* 2eto_A* 2etk_A* 3d9v_A* 3ncz_A* 3ndm_A* 2v55_A* 2f2u_A* 2h9v_A* Length = 410 Back     alignment and structure
>2vd5_A DMPK protein; serine/threonine-protein kinase, kinase, transferase, ATP-BI nucleotide-binding, cardiac contractility, muscle different; HET: BI8; 2.80A {Homo sapiens} Length = 412 Back     alignment and structure
>2vd5_A DMPK protein; serine/threonine-protein kinase, kinase, transferase, ATP-BI nucleotide-binding, cardiac contractility, muscle different; HET: BI8; 2.80A {Homo sapiens} Length = 412 Back     alignment and structure
>1ua2_A CAK, cell division protein kinase 7; cell cycle, phosphorylation, protein-protein interaction, PR kinase, cell cycle, transferase; HET: TPO ATP; 3.02A {Homo sapiens} SCOP: d.144.1.7 Length = 346 Back     alignment and structure
>1ua2_A CAK, cell division protein kinase 7; cell cycle, phosphorylation, protein-protein interaction, PR kinase, cell cycle, transferase; HET: TPO ATP; 3.02A {Homo sapiens} SCOP: d.144.1.7 Length = 346 Back     alignment and structure
>1t4h_A Serine/threonine-protein kinase WNK1; protein serine/threonine kinase, transferase; 1.80A {Rattus norvegicus} SCOP: d.144.1.7 PDB: 3fpq_A Length = 290 Back     alignment and structure
>1t4h_A Serine/threonine-protein kinase WNK1; protein serine/threonine kinase, transferase; 1.80A {Rattus norvegicus} SCOP: d.144.1.7 PDB: 3fpq_A Length = 290 Back     alignment and structure
>3g33_A Cell division protein kinase 4; Ser/Thr protein kinase, cell cycle, phosphorylation, ATP-BIN cell division, disease mutation, kinase; 3.00A {Homo sapiens} Length = 308 Back     alignment and structure
>3g33_A Cell division protein kinase 4; Ser/Thr protein kinase, cell cycle, phosphorylation, ATP-BIN cell division, disease mutation, kinase; 3.00A {Homo sapiens} Length = 308 Back     alignment and structure
>3niz_A Rhodanese family protein; structural genomics, structural genomics consortium, SGC, phosphotransferase, cyclin dependent kinase; HET: ADP; 2.40A {Cryptosporidium parvum} PDB: 2qkr_A* Length = 311 Back     alignment and structure
>3niz_A Rhodanese family protein; structural genomics, structural genomics consortium, SGC, phosphotransferase, cyclin dependent kinase; HET: ADP; 2.40A {Cryptosporidium parvum} PDB: 2qkr_A* Length = 311 Back     alignment and structure
>2r3i_A Cell division protein kinase 2; serine/threonine-protein kinase, cell cycle, inhibition, cyclin-dependent kinase, cancer, ATP-binding; HET: SCF; 1.28A {Homo sapiens} PDB: 2r3j_A* 2r3k_A* 2r3l_A* 2r3m_A* 2r3n_A* 2r3o_A* 2r3p_A* 2r3q_A* 1jvp_P* 1buh_A 1ckp_A* 1di8_A* 1dm2_A* 1f5q_A 1fin_A* 1fq1_B* 1fvt_A* 1fvv_A* 1g5s_A* 1gih_A* ... Length = 299 Back     alignment and structure
>1ob3_A PFPK5, cell division control protein 2 homolog; transferase, serine/threonine-protein kinase, ATP-binding, phosphorylation, CDK; 1.9A {Plasmodium falciparum} SCOP: d.144.1.7 PDB: 1v0p_A* 1v0o_A* 1v0b_A Length = 288 Back     alignment and structure
>1ob3_A PFPK5, cell division control protein 2 homolog; transferase, serine/threonine-protein kinase, ATP-binding, phosphorylation, CDK; 1.9A {Plasmodium falciparum} SCOP: d.144.1.7 PDB: 1v0p_A* 1v0o_A* 1v0b_A Length = 288 Back     alignment and structure
>1blx_A Cyclin-dependent kinase 6; inhibitor protein, cyclin-dependent kinase, cell cycle control, alpha/beta, complex (inhibitor protein/kinase); 1.90A {Homo sapiens} SCOP: d.144.1.7 PDB: 1bi7_A 1bi8_A 1g3n_A 2f2c_B* 1jow_B* 2euf_B* 1xo2_B* 3nup_A* 3nux_A* 2w9z_B 2w99_B 2w96_B 2w9f_B Length = 326 Back     alignment and structure
>1blx_A Cyclin-dependent kinase 6; inhibitor protein, cyclin-dependent kinase, cell cycle control, alpha/beta, complex (inhibitor protein/kinase); 1.90A {Homo sapiens} SCOP: d.144.1.7 PDB: 1bi7_A 1bi8_A 1g3n_A 2f2c_B* 1jow_B* 2euf_B* 1xo2_B* 3nup_A* 3nux_A* 2w9z_B 2w99_B 2w96_B 2w9f_B Length = 326 Back     alignment and structure
>3o0g_A Cell division protein kinase 5; kinase activator complex, kinase inhibitor complex, transferase-transferase activator complex; HET: 3O0; 1.95A {Homo sapiens} PDB: 1unh_A* 1ung_A* 1unl_A* 1h4l_A Length = 292 Back     alignment and structure
>3o0g_A Cell division protein kinase 5; kinase activator complex, kinase inhibitor complex, transferase-transferase activator complex; HET: 3O0; 1.95A {Homo sapiens} PDB: 1unh_A* 1ung_A* 1unl_A* 1h4l_A Length = 292 Back     alignment and structure
>4agu_A Cyclin-dependent kinase-like 1; transferase, phospho-mimetic; HET: D15; 2.40A {Homo sapiens} Length = 311 Back     alignment and structure
>4agu_A Cyclin-dependent kinase-like 1; transferase, phospho-mimetic; HET: D15; 2.40A {Homo sapiens} Length = 311 Back     alignment and structure
>3mi9_A Cell division protein kinase 9; P-TEFB, HIV-1, protein binding; HET: TPO; 2.10A {Homo sapiens} PDB: 3mia_A* 3blh_A* 3blq_A* 3blr_A* 3lq5_A* 3my1_A* 3tn8_A* 3tnh_A* 3tni_A* Length = 351 Back     alignment and structure
>3mi9_A Cell division protein kinase 9; P-TEFB, HIV-1, protein binding; HET: TPO; 2.10A {Homo sapiens} PDB: 3mia_A* 3blh_A* 3blq_A* 3blr_A* 3lq5_A* 3my1_A* 3tn8_A* 3tnh_A* 3tni_A* Length = 351 Back     alignment and structure
>4aaa_A Cyclin-dependent kinase-like 2; transferase, phospho-mimetic; HET: DKI; 1.53A {Homo sapiens} Length = 331 Back     alignment and structure
>4aaa_A Cyclin-dependent kinase-like 2; transferase, phospho-mimetic; HET: DKI; 1.53A {Homo sapiens} Length = 331 Back     alignment and structure
>2pmi_A Negative RE, cyclin-dependent protein kinase PHO85; cyclin-dependent kinase, signaling protein,transfera cycle complex; HET: MES AGS; 2.90A {Saccharomyces cerevisiae} PDB: 2pk9_A* Length = 317 Back     alignment and structure
>2pmi_A Negative RE, cyclin-dependent protein kinase PHO85; cyclin-dependent kinase, signaling protein,transfera cycle complex; HET: MES AGS; 2.90A {Saccharomyces cerevisiae} PDB: 2pk9_A* Length = 317 Back     alignment and structure
>3mtl_A Cell division protein kinase 16; pctaire1, indirubin, structural genomics, structural consortium, SGC, transferase; HET: FEF; 2.40A {Homo sapiens} Length = 324 Back     alignment and structure
>3mtl_A Cell division protein kinase 16; pctaire1, indirubin, structural genomics, structural consortium, SGC, transferase; HET: FEF; 2.40A {Homo sapiens} Length = 324 Back     alignment and structure
>3m2w_A MAP kinase-activated protein kinase 2; small molecule inhibitor, spiroazetidine-tetracycle, ATP-SIT inhibitor, novartis compound NVP-BXS169; HET: L8I; 2.41A {Homo sapiens} PDB: 3kga_A* 3m42_A* Length = 299 Back     alignment and structure
>3m2w_A MAP kinase-activated protein kinase 2; small molecule inhibitor, spiroazetidine-tetracycle, ATP-SIT inhibitor, novartis compound NVP-BXS169; HET: L8I; 2.41A {Homo sapiens} PDB: 3kga_A* 3m42_A* Length = 299 Back     alignment and structure
>3m2w_A MAP kinase-activated protein kinase 2; small molecule inhibitor, spiroazetidine-tetracycle, ATP-SIT inhibitor, novartis compound NVP-BXS169; HET: L8I; 2.41A {Homo sapiens} PDB: 3kga_A* 3m42_A* Length = 299 Back     alignment and structure
>2vwi_A Serine/threonine-protein kinase OSR1; STE kinase, hypertension, transferase; HET: ANP; 2.15A {Homo sapiens} PDB: 3dak_A* Length = 303 Back     alignment and structure
>2vwi_A Serine/threonine-protein kinase OSR1; STE kinase, hypertension, transferase; HET: ANP; 2.15A {Homo sapiens} PDB: 3dak_A* Length = 303 Back     alignment and structure
>3og7_A AKAP9-BRAF fusion protein; proto-oncogene, V600E, kinase, transferase; HET: 032; 2.45A {Homo sapiens} PDB: 3c4c_A* 3c4d_A* 3idp_A* 3ii5_A* 3d4q_A* 3ppj_A* 3ppk_A* 3prf_A* 3pri_A* 3psb_A* 3psd_A* 3q4c_A* 3skc_A* 3tv4_A* 3tv6_A* 2fb8_A* 4dbn_A* 1uwj_A* 1uwh_A* 3q96_A* Length = 289 Back     alignment and structure
>3og7_A AKAP9-BRAF fusion protein; proto-oncogene, V600E, kinase, transferase; HET: 032; 2.45A {Homo sapiens} PDB: 3c4c_A* 3c4d_A* 3idp_A* 3ii5_A* 3d4q_A* 3ppj_A* 3ppk_A* 3prf_A* 3pri_A* 3psb_A* 3psd_A* 3q4c_A* 3skc_A* 3tv4_A* 3tv6_A* 2fb8_A* 4dbn_A* 1uwj_A* 1uwh_A* 3q96_A* Length = 289 Back     alignment and structure
>3rgf_A Cyclin-dependent kinase 8; protein kinase complex, transferase,transcription; HET: BAX; 2.20A {Homo sapiens} Length = 405 Back     alignment and structure
>3rgf_A Cyclin-dependent kinase 8; protein kinase complex, transferase,transcription; HET: BAX; 2.20A {Homo sapiens} Length = 405 Back     alignment and structure
>3gbz_A Kinase, CMGC CDK; ssgcid, ATP-binding, nucleotide-binding, serine/threonine-protein kinase, transferase; 1.85A {Giardia lamblia} PDB: 3gc0_A* Length = 329 Back     alignment and structure
>3gbz_A Kinase, CMGC CDK; ssgcid, ATP-binding, nucleotide-binding, serine/threonine-protein kinase, transferase; 1.85A {Giardia lamblia} PDB: 3gc0_A* Length = 329 Back     alignment and structure
>2x7f_A TRAF2 and NCK-interacting protein kinase; serine/threonine-protein kinase, phosphoprotein; HET: 824; 2.80A {Homo sapiens} Length = 326 Back     alignment and structure
>2x7f_A TRAF2 and NCK-interacting protein kinase; serine/threonine-protein kinase, phosphoprotein; HET: 824; 2.80A {Homo sapiens} Length = 326 Back     alignment and structure
>2y4i_B KSR2, HKSR2, kinase suppressor of RAS 2; transferase, KSR1; HET: ATP; 3.46A {Homo sapiens} Length = 319 Back     alignment and structure
>2y4i_B KSR2, HKSR2, kinase suppressor of RAS 2; transferase, KSR1; HET: ATP; 3.46A {Homo sapiens} Length = 319 Back     alignment and structure
>3gni_B Strad alpha; kinase fold, pseudokinase, alpha helical repeat protein, ADA protein, ATP-binding, cell cycle, kinase, nucleotide-bindin nucleus; HET: ATP CIT; 2.35A {Homo sapiens} PDB: 2wtk_B* Length = 389 Back     alignment and structure
>3gni_B Strad alpha; kinase fold, pseudokinase, alpha helical repeat protein, ADA protein, ATP-binding, cell cycle, kinase, nucleotide-bindin nucleus; HET: ATP CIT; 2.35A {Homo sapiens} PDB: 2wtk_B* Length = 389 Back     alignment and structure
>3a7i_A MST3 kinase, serine/threonine kinase 24 (STE20 homolog, yeast); two-LOBE protein kinase fold, ATP-binding, nucleotid binding, transferase; HET: TPO ADE; 1.45A {Homo sapiens} PDB: 3a7g_A* 3a7h_A* 3a7f_A* 3a7j_A* 3ckw_A 3ckx_A* 3ggf_A* 2xik_A* Length = 303 Back     alignment and structure
>3a7i_A MST3 kinase, serine/threonine kinase 24 (STE20 homolog, yeast); two-LOBE protein kinase fold, ATP-binding, nucleotid binding, transferase; HET: TPO ADE; 1.45A {Homo sapiens} PDB: 3a7g_A* 3a7h_A* 3a7f_A* 3a7j_A* 3ckw_A 3ckx_A* 3ggf_A* 2xik_A* Length = 303 Back     alignment and structure
>2j7t_A Serine/threonine-protein kinase 10; transferase, ATP-binding, cell cycle progression, phosphorylation, disease mutation, nucleotide- binding; HET: 274; 2.0A {Homo sapiens} PDB: 4aot_A* 3zz2_A* 2j51_A* 2jfl_A* 2jfm_A* 2uv2_A* Length = 302 Back     alignment and structure
>2j7t_A Serine/threonine-protein kinase 10; transferase, ATP-binding, cell cycle progression, phosphorylation, disease mutation, nucleotide- binding; HET: 274; 2.0A {Homo sapiens} PDB: 4aot_A* 3zz2_A* 2j51_A* 2jfl_A* 2jfm_A* 2uv2_A* Length = 302 Back     alignment and structure
>4e7w_A Glycogen synthase kinase 3; GSK3, PTyr195, transferase; HET: PTR; 3.30A {Ustilago maydis} Length = 394 Back     alignment and structure
>4e7w_A Glycogen synthase kinase 3; GSK3, PTyr195, transferase; HET: PTR; 3.30A {Ustilago maydis} Length = 394 Back     alignment and structure
>3p86_A Serine/threonine-protein kinase CTR1; ETR1, ERS1, ETR2, phosphorylation, transferase; HET: STU; 2.50A {Arabidopsis thaliana} PDB: 3ppz_A* Length = 309 Back     alignment and structure
>3p86_A Serine/threonine-protein kinase CTR1; ETR1, ERS1, ETR2, phosphorylation, transferase; HET: STU; 2.50A {Arabidopsis thaliana} PDB: 3ppz_A* Length = 309 Back     alignment and structure
>1j1b_A Glycogen synthase kinase-3 beta; complex, TAU, AMPPNP, transferase; HET: ANP; 1.80A {Homo sapiens} SCOP: d.144.1.7 PDB: 1i09_A* 1j1c_A* 2jld_A* 3m1s_A* 3pup_A* 3du8_A* 1pyx_A* 1q41_A* 1q3w_A* 1q3d_A* 1q4l_A* 3q3b_A* 1q5k_A* 3i4b_A* 3l1s_A* 1r0e_A* 3zrk_A* 3zrl_A* 3zrm_A* 4dit_A* ... Length = 420 Back     alignment and structure
>1j1b_A Glycogen synthase kinase-3 beta; complex, TAU, AMPPNP, transferase; HET: ANP; 1.80A {Homo sapiens} SCOP: d.144.1.7 PDB: 1i09_A* 1j1c_A* 2jld_A* 3m1s_A* 3pup_A* 3du8_A* 1pyx_A* 1q41_A* 1q3w_A* 1q3d_A* 1q4l_A* 3q3b_A* 1q5k_A* 3i4b_A* 3l1s_A* 1r0e_A* 3zrk_A* 3zrl_A* 3zrm_A* 4dit_A* ... Length = 420 Back     alignment and structure
>1u5q_A Serine/threonine protein kinase TAO2; transferase; HET: SEP; 2.10A {Rattus norvegicus} SCOP: d.144.1.7 PDB: 1u5r_A* 2gcd_A* Length = 348 Back     alignment and structure
>1u5q_A Serine/threonine protein kinase TAO2; transferase; HET: SEP; 2.10A {Rattus norvegicus} SCOP: d.144.1.7 PDB: 1u5r_A* 2gcd_A* Length = 348 Back     alignment and structure
>3com_A Serine/threonine-protein kinase 4; MST1, STE20-like kinase, PSI, structural genomics, protein structure initiative; HET: TPO; 2.20A {Homo sapiens} Length = 314 Back     alignment and structure
>3com_A Serine/threonine-protein kinase 4; MST1, STE20-like kinase, PSI, structural genomics, protein structure initiative; HET: TPO; 2.20A {Homo sapiens} Length = 314 Back     alignment and structure
>3fxz_A Serine/threonine-protein kinase PAK 1; transferase, ATP-binding, phosphorylation, allosteric enzyme, alternative splicing, apoptosis, cell junction; HET: TPO FLL; 1.64A {Homo sapiens} PDB: 3fy0_A* 4daw_A* 3q52_A* 3q53_A* 1yhw_A 1f3m_C 1yhv_A 2hy8_1* 3q4z_A* Length = 297 Back     alignment and structure
>3fxz_A Serine/threonine-protein kinase PAK 1; transferase, ATP-binding, phosphorylation, allosteric enzyme, alternative splicing, apoptosis, cell junction; HET: TPO FLL; 1.64A {Homo sapiens} PDB: 3fy0_A* 4daw_A* 3q52_A* 3q53_A* 1yhw_A 1f3m_C 1yhv_A 2hy8_1* 3q4z_A* Length = 297 Back     alignment and structure
>2c30_A Serine/threonine-protein kinase PAK 6; CRIB domain, ATP-binding, transferase, nucleotide-binding; HET: SEP; 1.6A {Homo sapiens} PDB: 2f57_A* 2j0i_A* 2cdz_A* 2q0n_A* 2x4z_A* 2bva_A* Length = 321 Back     alignment and structure
>2c30_A Serine/threonine-protein kinase PAK 6; CRIB domain, ATP-binding, transferase, nucleotide-binding; HET: SEP; 1.6A {Homo sapiens} PDB: 2f57_A* 2j0i_A* 2cdz_A* 2q0n_A* 2x4z_A* 2bva_A* Length = 321 Back     alignment and structure
>3eb0_A Putative uncharacterized protein; kinase cryptosporidium parvum, ATP-binding, kinase, nucleoti binding; HET: PTR DRK; 2.65A {Cryptosporidium parvum iowa II} Length = 383 Back     alignment and structure
>3eb0_A Putative uncharacterized protein; kinase cryptosporidium parvum, ATP-binding, kinase, nucleoti binding; HET: PTR DRK; 2.65A {Cryptosporidium parvum iowa II} Length = 383 Back     alignment and structure
>4eqm_A Protein kinase; transferase; HET: ANP; 3.00A {Staphylococcus aureus subsp} Length = 294 Back     alignment and structure
>4eqm_A Protein kinase; transferase; HET: ANP; 3.00A {Staphylococcus aureus subsp} Length = 294 Back     alignment and structure
>3ork_A Serine/threonine protein kinase; structural genomics, TB structural genomics consortium, TBSG domain, signal transduction; HET: AGS; 1.60A {Mycobacterium tuberculosis} PDB: 3ori_A* 3orl_A* 3oro_A* 3orp_A* 3ort_A* 3f61_A* 1mru_A* 3f69_A* 3orm_A* 1o6y_A* 2fum_A* Length = 311 Back     alignment and structure
>3ork_A Serine/threonine protein kinase; structural genomics, TB structural genomics consortium, TBSG domain, signal transduction; HET: AGS; 1.60A {Mycobacterium tuberculosis} PDB: 3ori_A* 3orl_A* 3oro_A* 3orp_A* 3ort_A* 3f61_A* 1mru_A* 3f69_A* 3orm_A* 1o6y_A* 2fum_A* Length = 311 Back     alignment and structure
>3s95_A LIMK-1, LIM domain kinase 1; structural genomics, structural genomics consortium, SGC, PR kinase, transferase-antibiotic complex; HET: STU GOL; 1.65A {Homo sapiens} Length = 310 Back     alignment and structure
>3s95_A LIMK-1, LIM domain kinase 1; structural genomics, structural genomics consortium, SGC, PR kinase, transferase-antibiotic complex; HET: STU GOL; 1.65A {Homo sapiens} Length = 310 Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Length = 681 Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Length = 681 Back     alignment and structure
>3coi_A Mitogen-activated protein kinase 13; P38D, P38delta, ERK, MAP kinase, PMK, STK26, stress-activated protein kinase, structural genomics, PSI; 2.09A {Homo sapiens} Length = 353 Back     alignment and structure
>3coi_A Mitogen-activated protein kinase 13; P38D, P38delta, ERK, MAP kinase, PMK, STK26, stress-activated protein kinase, structural genomics, PSI; 2.09A {Homo sapiens} Length = 353 Back     alignment and structure
>3nsz_A CK II alpha, casein kinase II subunit alpha; inhibitor, transferase-transferase inhibitor CO; HET: ANP; 1.30A {Homo sapiens} PDB: 2r7i_A 3pe1_A* 1jwh_A* 3pe2_A* 3r0t_A* 3h30_A* 3q9w_A* 3q9x_A* 3q9y_A* 3q9z_A* 3qa0_A 3bqc_A* 2rkp_A* 3c13_A* 3fwq_A 3rps_A* 3mb7_A* 3mb6_A* 3owj_A* 3owk_A* ... Length = 330 Back     alignment and structure
>3nsz_A CK II alpha, casein kinase II subunit alpha; inhibitor, transferase-transferase inhibitor CO; HET: ANP; 1.30A {Homo sapiens} PDB: 2r7i_A 3pe1_A* 1jwh_A* 3pe2_A* 3r0t_A* 3h30_A* 3q9w_A* 3q9x_A* 3q9y_A* 3q9z_A* 3qa0_A 3bqc_A* 2rkp_A* 3c13_A* 3fwq_A 3rps_A* 3mb7_A* 3mb6_A* 3owj_A* 3owk_A* ... Length = 330 Back     alignment and structure
>3rp9_A Mitogen-activated protein kinase; structural genomics, structural genomics consortium, SGC, TR; 2.40A {Toxoplasma gondii} Length = 458 Back     alignment and structure
>3rp9_A Mitogen-activated protein kinase; structural genomics, structural genomics consortium, SGC, TR; 2.40A {Toxoplasma gondii} Length = 458 Back     alignment and structure
>3pg1_A Mitogen-activated protein kinase, putative (MAP K protein); EPK Ser/Thr protein kinase fold, Ser/Thr protein kinase, TRA; 1.95A {Leishmania major} Length = 362 Back     alignment and structure
>3pg1_A Mitogen-activated protein kinase, putative (MAP K protein); EPK Ser/Thr protein kinase fold, Ser/Thr protein kinase, TRA; 1.95A {Leishmania major} Length = 362 Back     alignment and structure
>2xrw_A Mitogen-activated protein kinase 8; transcription, MAPK signaling pathways, linear binding motif; HET: ANP; 1.33A {Homo sapiens} PDB: 1ukh_A 1uki_A* 2xs0_A* 3elj_A* 2h96_A* 2gmx_A* 2g01_A* 2no3_A* 3o2m_A* 3o17_A* 3pze_A* 3g9l_X* 2p33_A* 3cgf_A* 3cgo_A* 3g90_X* 2ok1_A* 3g9n_A* 1pmn_A* 1pmq_A* ... Length = 371 Back     alignment and structure
>2xrw_A Mitogen-activated protein kinase 8; transcription, MAPK signaling pathways, linear binding motif; HET: ANP; 1.33A {Homo sapiens} PDB: 1ukh_A 1uki_A* 2xs0_A* 3elj_A* 2h96_A* 2gmx_A* 2g01_A* 2no3_A* 3o2m_A* 3o17_A* 3pze_A* 3g9l_X* 2p33_A* 3cgf_A* 3cgo_A* 3g90_X* 2ok1_A* 3g9n_A* 1pmn_A* 1pmq_A* ... Length = 371 Back     alignment and structure
>1cm8_A Phosphorylated MAP kinase P38-gamma; phosphorylation, transferase; HET: TPO PTR ANP; 2.40A {Homo sapiens} SCOP: d.144.1.7 Length = 367 Back     alignment and structure
>1cm8_A Phosphorylated MAP kinase P38-gamma; phosphorylation, transferase; HET: TPO PTR ANP; 2.40A {Homo sapiens} SCOP: d.144.1.7 Length = 367 Back     alignment and structure
>4e5w_A Tyrosine-protein kinase JAK1; kinase domain, transferase-transferase inhibit complex; HET: PTR 0NT; 1.86A {Homo sapiens} PDB: 4e4l_A* 4e4n_A* 3eyg_A* 3eyh_A* Length = 302 Back     alignment and structure
>3qyz_A Mitogen-activated protein kinase 1; transferase, serine/threonine-protein kinase, ATP-binding CE phosphorylation; HET: CME Z8B SO4; 1.46A {Rattus norvegicus} PDB: 2fys_B 1erk_A* 3qyi_A* 3erk_A* 3qyw_A* 4erk_A* 2z7l_A* 2erk_A* 1gol_A* 2gph_A 3o71_A 3r63_A 3c9w_A* 2y9q_A* 3sa0_A* 1wzy_A* 2e14_A* 1tvo_A* 2ojg_A* 2oji_A* ... Length = 364 Back     alignment and structure
>3qyz_A Mitogen-activated protein kinase 1; transferase, serine/threonine-protein kinase, ATP-binding CE phosphorylation; HET: CME Z8B SO4; 1.46A {Rattus norvegicus} PDB: 2fys_B 1erk_A* 3qyi_A* 3erk_A* 3qyw_A* 4erk_A* 2z7l_A* 2erk_A* 1gol_A* 2gph_A 3o71_A 3r63_A 3c9w_A* 2y9q_A* 3sa0_A* 1wzy_A* 2e14_A* 1tvo_A* 2ojg_A* 2oji_A* ... Length = 364 Back     alignment and structure
>3fme_A Dual specificity mitogen-activated protein kinase; active mutant, structural genomics consortium, SCG, binding, nucleotide-binding, phosphoprotein; HET: STU; 2.26A {Homo sapiens} PDB: 3enm_A Length = 290 Back     alignment and structure
>3fme_A Dual specificity mitogen-activated protein kinase; active mutant, structural genomics consortium, SCG, binding, nucleotide-binding, phosphoprotein; HET: STU; 2.26A {Homo sapiens} PDB: 3enm_A Length = 290 Back     alignment and structure
>3ttj_A Mitogen-activated protein kinase 10; JNK3, protein kinase in transferase-transferase inhibitor complex; HET: JBI; 2.10A {Homo sapiens} PDB: 3tti_A* 1jnk_A* Length = 464 Back     alignment and structure
>3ttj_A Mitogen-activated protein kinase 10; JNK3, protein kinase in transferase-transferase inhibitor complex; HET: JBI; 2.10A {Homo sapiens} PDB: 3tti_A* 1jnk_A* Length = 464 Back     alignment and structure
>2eva_A TAK1 kinase - TAB1 chimera fusion protein; transferase/transferase activator complex; HET: ADN; 2.00A {Homo sapiens} Length = 307 Back     alignment and structure
>2eva_A TAK1 kinase - TAB1 chimera fusion protein; transferase/transferase activator complex; HET: ADN; 2.00A {Homo sapiens} Length = 307 Back     alignment and structure
>3ugc_A Tyrosine-protein kinase JAK2; small molecule inhibitor, ATP binding, transferase-transfera inhibitor complex; HET: 046; 1.34A {} PDB: 3krr_A* 3lpb_A* 4aqc_A* 3q32_A* 3rvg_A* 3tjc_A* 3tjd_A* 2b7a_A* 3fup_A* 3e64_A* 3e62_A* 3e63_A* 2xa4_A* 3iok_A* 3io7_A* 3kck_A* 3jy9_A* Length = 295 Back     alignment and structure
>3eqc_A Dual specificity mitogen-activated protein kinase; MEK1 kinase, ATP-binding, disease mutation, nucleoti binding, phosphoprotein; HET: 3BM AGS; 1.80A {Homo sapiens} PDB: 3eqd_A* 3eqf_A* 3eqg_A* 3eqh_A* 3eqi_A* 2y4i_C* 3eqb_A* 2p55_A* 1s9j_A* 3dy7_A* 3e8n_A* 3dv3_A* 3mbl_A* 3pp1_A* 3orn_A* 3os3_A* 3sls_A* 1s9i_A* Length = 360 Back     alignment and structure
>3eqc_A Dual specificity mitogen-activated protein kinase; MEK1 kinase, ATP-binding, disease mutation, nucleoti binding, phosphoprotein; HET: 3BM AGS; 1.80A {Homo sapiens} PDB: 3eqd_A* 3eqf_A* 3eqg_A* 3eqh_A* 3eqi_A* 2y4i_C* 3eqb_A* 2p55_A* 1s9j_A* 3dy7_A* 3e8n_A* 3dv3_A* 3mbl_A* 3pp1_A* 3orn_A* 3os3_A* 3sls_A* 1s9i_A* Length = 360 Back     alignment and structure
>2fst_X Mitogen-activated protein kinase 14; active mutants, lipids, MAP kinase insertion, autophosphorylation, transferase; HET: BOG; 1.45A {Homo sapiens} PDB: 2fso_X* 2fsl_X* 2fsm_X* 2npq_A* 2bal_A* 2baj_A* 2bak_A* 2baq_A* 2qd9_A* 1ian_A* 2rg5_A* 2rg6_A* 3bv2_A* 3bv3_A* 3bx5_A* 3c5u_A* 3cg2_A* 3l8x_A* 3mvl_A* 3mvm_A* ... Length = 367 Back     alignment and structure
>2fst_X Mitogen-activated protein kinase 14; active mutants, lipids, MAP kinase insertion, autophosphorylation, transferase; HET: BOG; 1.45A {Homo sapiens} PDB: 2fso_X* 2fsl_X* 2fsm_X* 2npq_A* 2bal_A* 2baj_A* 2bak_A* 2baq_A* 2qd9_A* 1ian_A* 2rg5_A* 2rg6_A* 3bv2_A* 3bv3_A* 3bx5_A* 3c5u_A* 3cg2_A* 3l8x_A* 3mvl_A* 3mvm_A* ... Length = 367 Back     alignment and structure
>3n9x_A Phosphotransferase; malaria kinase, structural genomics, structural genomics CON SGC; 2.05A {Plasmodium berghei} PDB: 3nie_A* Length = 432 Back     alignment and structure
>3n9x_A Phosphotransferase; malaria kinase, structural genomics, structural genomics CON SGC; 2.05A {Plasmodium berghei} PDB: 3nie_A* Length = 432 Back     alignment and structure
>3e3p_A Protein kinase, putative glycogen synthase kinase; leishmaniasis, transferase; 2.00A {Leishmania major} Length = 360 Back     alignment and structure
>3e3p_A Protein kinase, putative glycogen synthase kinase; leishmaniasis, transferase; 2.00A {Leishmania major} Length = 360 Back     alignment and structure
>3lxp_A Non-receptor tyrosine-protein kinase TYK2; JAK3, inflammation, cancer, PAN inhibitor, ATP-binding nucleotide-binding, phosphoprotein, SH2 domain; HET: PTR IZA; 1.65A {Homo sapiens} PDB: 3lxn_A* 3nz0_A* 3nyx_A* Length = 318 Back     alignment and structure
>2w1i_A JAK2; chromosomal rearrangement, nucleotide-binding, tyrosine-protein kinase, proto-oncogene, phosphoprotein, disease mutation, SH2 domain; HET: PTR L0I; 2.60A {Homo sapiens} Length = 326 Back     alignment and structure
>2dyl_A Dual specificity mitogen-activated protein kinase kinase 7; MKK7, activated mutant, ATP-binding, structural genomics, NPPSFA; 2.45A {Homo sapiens} Length = 318 Back     alignment and structure
>2dyl_A Dual specificity mitogen-activated protein kinase kinase 7; MKK7, activated mutant, ATP-binding, structural genomics, NPPSFA; 2.45A {Homo sapiens} Length = 318 Back     alignment and structure
>2b9h_A MAP kinase FUS3, mitogen-activated protein kinase FUS3; transferase; HET: ADP; 1.55A {Saccharomyces cerevisiae} PDB: 2b9i_A* 2b9j_A* 2f49_A 2fa2_A 2b9f_A* 2f9g_A* Length = 353 Back     alignment and structure
>2b9h_A MAP kinase FUS3, mitogen-activated protein kinase FUS3; transferase; HET: ADP; 1.55A {Saccharomyces cerevisiae} PDB: 2b9i_A* 2b9j_A* 2f49_A 2fa2_A 2b9f_A* 2f9g_A* Length = 353 Back     alignment and structure
>3lxl_A Tyrosine-protein kinase JAK3; TYK2, inflammation, cancer, PAN inhibitor, ATP-binding mutation, membrane, nucleotide-binding, phosphoprot SCID; HET: IZA; 1.74A {Homo sapiens} PDB: 3lxk_A* 3pjc_A* 1yvj_A* Length = 327 Back     alignment and structure
>2i6l_A Mitogen-activated protein kinase 6; MAPK6, ERK3, extracellular signal regulated kinase 3, serine phosphorylation, threonine phosphorylation; 2.25A {Homo sapiens} Length = 320 Back     alignment and structure
>2i6l_A Mitogen-activated protein kinase 6; MAPK6, ERK3, extracellular signal regulated kinase 3, serine phosphorylation, threonine phosphorylation; 2.25A {Homo sapiens} Length = 320 Back     alignment and structure
>3cbl_A C-FES, proto-oncogene tyrosine-protein kinase FES/FPS; V-FES, fujinami, avian sarcoma, viral, feline virus, SGC; HET: STU; 1.75A {Homo sapiens} PDB: 3bkb_A* 3cd3_A* 4e93_A* Length = 377 Back     alignment and structure
>1opk_A P150, C-ABL, proto-oncogene tyrosine-protein kinase ABL1; transferase; HET: MYR P16; 1.80A {Mus musculus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1opl_A* 2fo0_A* 2abl_A Length = 495 Back     alignment and structure
>3oz6_A Mitogen-activated protein kinase 1, serine/threon protein kinase; structural genomics consortium, SGC, transferase; 2.37A {Cryptosporidium parvum iowa II} Length = 388 Back     alignment and structure
>3oz6_A Mitogen-activated protein kinase 1, serine/threon protein kinase; structural genomics consortium, SGC, transferase; 2.37A {Cryptosporidium parvum iowa II} Length = 388 Back     alignment and structure
>3kmu_A ILK, integrin-linked kinase; cell adhesion, ANK repeat, ATP-binding, cell junction, cell membrane, integrin-binding protein, membrane, nucleotide- binding; 1.80A {Homo sapiens} PDB: 3kmw_A* 3rep_A* Length = 271 Back     alignment and structure
>3kmu_A ILK, integrin-linked kinase; cell adhesion, ANK repeat, ATP-binding, cell junction, cell membrane, integrin-binding protein, membrane, nucleotide- binding; 1.80A {Homo sapiens} PDB: 3kmw_A* 3rep_A* Length = 271 Back     alignment and structure
>3aln_A Dual specificity mitogen-activated protein kinase; protein AMP-PNP complex, transferase; HET: ANP; 2.30A {Homo sapiens} PDB: 3alo_A* Length = 327 Back     alignment and structure
>3aln_A Dual specificity mitogen-activated protein kinase; protein AMP-PNP complex, transferase; HET: ANP; 2.30A {Homo sapiens} PDB: 3alo_A* Length = 327 Back     alignment and structure
>3pls_A Macrophage-stimulating protein receptor; protein kinase, CIS autophosphorylation conformation, recept tyrosine kinase, AMP-PNP, unphosphorylated; HET: ANP; 2.24A {Homo sapiens} Length = 298 Back     alignment and structure
>3kfa_A Tyrosine-protein kinase ABL1; CML, drug resistance, inhibitor, ATP-binding, nucleotide-binding, oncogene, TRAN; HET: B91; 1.22A {Mus musculus} PDB: 2qoh_A* 3kf4_A* 3k5v_A* 1fpu_A* 1m52_A* 1iep_A* 2hzn_A* 1opj_A* 3ms9_A* 3mss_A* 3ik3_A* 2z60_A* 2e2b_A* 3pyy_A* 3oxz_A* 2g1t_A* 3ue4_A* 3oy3_A* 2hiw_A* 2v7a_A* ... Length = 288 Back     alignment and structure
>3lzb_A Epidermal growth factor receptor; epidermal growth factor kinase domain, multitargeted small M kinase inhibitor; HET: ITI; 2.70A {Homo sapiens} Length = 327 Back     alignment and structure
>2h34_A Serine/threonine-protein kinase PKNE; apoenzyme, transferase; 2.80A {Mycobacterium tuberculosis} Length = 309 Back     alignment and structure
>2h34_A Serine/threonine-protein kinase PKNE; apoenzyme, transferase; 2.80A {Mycobacterium tuberculosis} Length = 309 Back     alignment and structure
>4f0f_A Serine/threonine-protein kinase ROCO4; LRRK2, ATP-binding, nucleotide serine/threonine-protein kinase, transferase, signaling Pro; HET: ACP; 1.80A {Dictyostelium discoideum} PDB: 4f0g_A 4f1t_A* 4f1m_A* 4f1o_A* Length = 287 Back     alignment and structure
>4f0f_A Serine/threonine-protein kinase ROCO4; LRRK2, ATP-binding, nucleotide serine/threonine-protein kinase, transferase, signaling Pro; HET: ACP; 1.80A {Dictyostelium discoideum} PDB: 4f0g_A 4f1t_A* 4f1m_A* 4f1o_A* Length = 287 Back     alignment and structure
>3kex_A Receptor tyrosine-protein kinase ERBB-3; kinase domain, inactive kinase, HER3, ATP-binding, cell membrane, membrane, nucleotide-binding; HET: ANP; 2.80A {Homo sapiens} PDB: 3lmg_A* Length = 325 Back     alignment and structure
>3f66_A Hepatocyte growth factor receptor; C-Met, protein kinase, quinoxaline, alternative splicing, ATP-binding, chromosomal rearrangement; HET: IHX; 1.40A {Homo sapiens} PDB: 3i5n_A* 3u6h_A* 3u6i_A* 3ccn_A* 2rfn_A* 2rfs_A* 3cd8_A* 3efj_A* 3efk_A* 3lq8_A* 3zxz_A* 2wkm_A* 2wgj_A* 3zze_A* 3q6w_A* 3r7o_A* 3q6u_A* 3cth_A* 3ce3_A* 3ctj_A* ... Length = 298 Back     alignment and structure
>3qup_A Tyrosine-protein kinase receptor TYRO3; protein kinase inhibitor, receptor tyrosine kinase, spirocyc kinase domain, phosphotransfer, GAS6 ligand; HET: LUN; 1.90A {Mus musculus} Length = 323 Back     alignment and structure
>4aoj_A High affinity nerve growth factor receptor; transferase, inhibitor; HET: V4Z; 2.75A {Homo sapiens} Length = 329 Back     alignment and structure
>1k9a_A Carboxyl-terminal SRC kinase; COOH-terminal SRC kinase, CSK, SFK, signal transduction, SH2, SH3, SRC homology, tyrosine kinase; 2.50A {Rattus norvegicus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1jeg_A Length = 450 Back     alignment and structure
>3mdy_A Bone morphogenetic protein receptor type-1B; complex (isomerase-protein kinase), receptor serine/threonin structural genomics consortium, SGC; HET: LDN; 2.05A {Homo sapiens} Length = 337 Back     alignment and structure
>3mdy_A Bone morphogenetic protein receptor type-1B; complex (isomerase-protein kinase), receptor serine/threonin structural genomics consortium, SGC; HET: LDN; 2.05A {Homo sapiens} Length = 337 Back     alignment and structure
>2nru_A Interleukin-1 receptor-associated kinase 4; inhibitor, IRAK, transferase; HET: TPO SEP T12; 2.00A {Homo sapiens} PDB: 2nry_A* 2oib_A* 2oic_A* 2oid_A* 2o8y_A* Length = 307 Back     alignment and structure
>1mp8_A Focal adhesion kinase 1; tyrosine protein kinase, transferase; HET: ADP; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 2ijm_A* 2etm_A* 3pxk_A* 2jkq_A* 2j0m_B* 2jkm_A* 2j0l_A* 3bz3_A* 2jko_A* 2jkk_A* Length = 281 Back     alignment and structure
>3poz_A Epidermal growth factor receptor; kinase domain, anti-oncogene, ATP-binding, cell cycle, disea mutation, glycoprotein, membrane, nucleotide-binding; HET: 03P; 1.50A {Homo sapiens} PDB: 2itx_A* 2ity_A* 2j5f_A* 2j6m_A* 2itw_A* 1m14_A 1m17_A* 3vjo_A* 2gs6_A* 2gs2_A* 2rf9_A 1xkk_A* 2eb2_A 3gop_A 2eb3_A* 2itn_A* 2ito_A* 2itp_A* 2itq_A* 2jiu_A* ... Length = 327 Back     alignment and structure
>1xbb_A Tyrosine-protein kinase SYK; gleevec, STI-571, imatinib, spleen typrosine kinase, active conformation, structural genomics, structural genomix; HET: STI; 1.57A {Homo sapiens} SCOP: d.144.1.7 PDB: 1xba_A* 1xbc_A* 3fqe_A* 3fqh_A* 3fqs_A* 3emg_A* 3srv_A* 4dfl_A* 4dfn_A* 3vf8_A* 3vf9_A* Length = 291 Back     alignment and structure
>2i1m_A Macrophage colony-stimulating factor 1 receptor; kinase domain, kinase inhibitor complex, transferase; HET: 5CN; 1.80A {Homo sapiens} PDB: 3bea_A* 3lcd_A* 2i0y_A* 2i0v_A* 3dpk_A* 3krj_A* 3krl_A* 2ogv_A 3lco_A* Length = 333 Back     alignment and structure
>1fmk_A C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyrosine kinase, phosphorylation, SH2, SH3, phosphotyrosine, proto-oncogene, phosphotransferase; HET: PTR; 1.50A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1y57_A* 2src_A* 1ksw_A* 2ptk_A* 1yol_A* 2oiq_A* 3d7t_B* 3dqx_A* 3el7_A* 3el8_A* 3en4_A* 3en5_A* 3en6_A* 3en7_A* 3f6x_A* 3g6g_A* 3uqf_A* 3uqg_A* 4agw_A* 3oez_A* ... Length = 452 Back     alignment and structure
>1fmk_A C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyrosine kinase, phosphorylation, SH2, SH3, phosphotyrosine, proto-oncogene, phosphotransferase; HET: PTR; 1.50A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1y57_A* 2src_A* 1ksw_A* 2ptk_A* 1yol_A* 2oiq_A* 3d7t_B* 3dqx_A* 3el7_A* 3el8_A* 3en4_A* 3en5_A* 3en6_A* 3en7_A* 3f6x_A* 3g6g_A* 3uqf_A* 3uqg_A* 4agw_A* 3oez_A* ... Length = 452 Back     alignment and structure
>3q4u_A Activin receptor type-1; structural genomics consortium, SGC, protein kinase, transfe; HET: LDN FLC; 1.82A {Homo sapiens} PDB: 3mtf_A* 3oom_A* 4dym_A* 3h9r_A* 3my0_A* Length = 301 Back     alignment and structure
>3q4u_A Activin receptor type-1; structural genomics consortium, SGC, protein kinase, transfe; HET: LDN FLC; 1.82A {Homo sapiens} PDB: 3mtf_A* 3oom_A* 4dym_A* 3h9r_A* 3my0_A* Length = 301 Back     alignment and structure
>2h8h_A Proto-oncogene tyrosine-protein kinase SRC; SRC kinase, transferase; HET: PTR H8H; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 Length = 535 Back     alignment and structure
>2h8h_A Proto-oncogene tyrosine-protein kinase SRC; SRC kinase, transferase; HET: PTR H8H; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 Length = 535 Back     alignment and structure
>3dtc_A Mitogen-activated protein kinase kinase kinase 9; mixed-lineage kinase, MLK family, MLK1 and MLK3 subtype selective inhibitors; HET: VIN; 2.60A {Homo sapiens} Length = 271 Back     alignment and structure
>3dtc_A Mitogen-activated protein kinase kinase kinase 9; mixed-lineage kinase, MLK family, MLK1 and MLK3 subtype selective inhibitors; HET: VIN; 2.60A {Homo sapiens} Length = 271 Back     alignment and structure
>1qcf_A Haematopoetic cell kinase (HCK); tyrosine kinase-inhibitor complex, DOWN-regulated kinase, ordered activation loop; HET: PTR PP1; 2.00A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 2c0i_A* 2c0o_A* 2c0t_A* 1ad5_A* 2hck_A* 3nhn_A 3hck_A 1bu1_A 3rea_B 3rbb_B Length = 454 Back     alignment and structure
>3c1x_A Hepatocyte growth factor receptor; receptor tyrosine kinase, signal transduction, GRB2, SHC, ATP-binding, glycoprotein, membrane; HET: CKK; 2.17A {Homo sapiens} SCOP: d.144.1.7 Length = 373 Back     alignment and structure
>3uim_A Brassinosteroid insensitive 1-associated receptor; kinase, protein kinase, transferase; HET: SEP TPO ANP; 2.20A {Arabidopsis thaliana} PDB: 3tl8_A* Length = 326 Back     alignment and structure
>1byg_A CSK, protein (C-terminal SRC kinase); protein kinase, phosphorylation, staurosporine, transferase; HET: STU; 2.40A {Homo sapiens} SCOP: d.144.1.7 PDB: 3d7u_A 3d7t_A* Length = 278 Back     alignment and structure
>3brb_A Proto-oncogene tyrosine-protein kinase MER; ATP-binding, disease mutation, glycoprotein, nucleot binding, phosphorylation, receptor; HET: ADP; 1.90A {Homo sapiens} PDB: 3bpr_A* 2p0c_A* Length = 313 Back     alignment and structure
>1qpc_A LCK kinase; alpha beta fold, transferase; HET: PTR ANP; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1qpe_A* 1qpj_A* 2pl0_A* 3kxz_A* 3ac1_A* 2zm4_A* 2zyb_A* 2zm1_A* 3ac2_A* 3ac3_A* 3ac4_A* 3ac5_A* 3ac8_A* 3acj_A* 3ack_A* 3ad4_A* 3ad5_A* 3ad6_A* 3kmm_A* 1qpd_A* ... Length = 279 Back     alignment and structure
>2ivs_A Proto-oncogene tyrosine-protein kinase receptor RET; nucleotide-binding, hirschsprung disease, phosphorylation, disease mutation; HET: ACK; 2.00A {Homo sapiens} PDB: 2ivt_A* 2ivu_A* 2x2k_A* 2x2l_A* 2x2m_A* 2ivv_A* Length = 314 Back     alignment and structure
>1u46_A ACK-1, activated CDC42 kinase 1; tyrosine kinase, transferase; 2.00A {Homo sapiens} SCOP: d.144.1.7 PDB: 1u4d_A* 1u54_A* 3eqr_A* 3eqp_B* Length = 291 Back     alignment and structure
>1u46_A ACK-1, activated CDC42 kinase 1; tyrosine kinase, transferase; 2.00A {Homo sapiens} SCOP: d.144.1.7 PDB: 1u4d_A* 1u54_A* 3eqr_A* 3eqp_B* Length = 291 Back     alignment and structure
>2j0j_A Focal adhesion kinase 1; cell migration, FERM, transferase, integrin signaling; HET: 4ST; 2.80A {Gallus gallus} PDB: 2j0k_A* Length = 656 Back     alignment and structure
>1u59_A Tyrosine-protein kinase ZAP-70; transferase; HET: STU; 2.30A {Homo sapiens} SCOP: d.144.1.7 Length = 287 Back     alignment and structure
>3vhe_A Vascular endothelial growth factor receptor 2; kinase domain, kinase, transferase-transferase inhibitor COM; HET: 42Q; 1.55A {Homo sapiens} PDB: 1y6a_A* 1y6b_A* 3vid_A* 3hng_A* Length = 359 Back     alignment and structure
>3sxs_A Cytoplasmic tyrosine-protein kinase BMX; transferase-transferase inhibitor complex; HET: PP2; 1.89A {Homo sapiens} PDB: 3sxr_A* Length = 268 Back     alignment and structure
>3soc_A Activin receptor type-2A; structural genomics consortium, SGC, transferase, protein KI; HET: GVD; 1.95A {Homo sapiens} PDB: 3q4t_A* 2qlu_A* Length = 322 Back     alignment and structure
>3cc6_A Protein tyrosine kinase 2 beta; focal adhesion kinase, structural genomics, structural genom consortium, SGC, ATP-binding, membrane; 1.60A {Homo sapiens} PDB: 3fzs_A* 3et7_A 3fzo_A* 3fzr_A* 3fzp_A* 3fzt_A* 3h3c_A* Length = 281 Back     alignment and structure
>2xir_A Vascular endothelial growth factor receptor 2; angiogenesis, nucleotide-binding, inhibitor, phosphorylation receptor, transferase, transmembrane; HET: 00J; 1.50A {Homo sapiens} PDB: 1vr2_A* 1ywn_A* 3vnt_A* 3c7q_A* 2oh4_A* 3u6j_A* 3efl_A* 2p2i_A* 3cjf_A* 3cjg_A* 3ewh_A* 2qu5_A* 2qu6_A* 2rl5_A* 3b8q_A* 3b8r_A* 2p2h_A* 3cp9_A* 3cpb_A* 3cpc_A* ... Length = 316 Back     alignment and structure
>2ozo_A Tyrosine-protein kinase ZAP-70; inactive ZAP-70, tandem SH2, autoinhibition, ITAM, hydrogen bonding network, TCR signaling, transferase; HET: ANP; 2.60A {Homo sapiens} Length = 613 Back     alignment and structure
>1b6c_B TGF-B superfamily receptor type I; complex (isomerase/protein kinase), receptor serine/threonine kinase; 2.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1ias_A 2x7o_A* 3faa_A* 3kcf_A* Length = 342 Back     alignment and structure
>1b6c_B TGF-B superfamily receptor type I; complex (isomerase/protein kinase), receptor serine/threonine kinase; 2.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1ias_A 2x7o_A* 3faa_A* 3kcf_A* Length = 342 Back     alignment and structure
>1p4o_A Insulin-like growth factor I receptor protein; IGF-1R, kinase domain, hormone-growth factor complex; 1.50A {Homo sapiens} SCOP: d.144.1.7 PDB: 1m7n_A 3lvp_A* 3lw0_A* 1jqh_A* 2zm3_A* 3f5p_A* 3i81_A* 2oj9_A* 3nw5_A* 3nw6_A* 3nw7_A* 3o23_A* 3qqu_A* 3d94_A* 1k3a_A* 2z8c_A* 1ir3_A* 1gag_A* 1irk_A 3bu3_A* ... Length = 322 Back     alignment and structure
>1luf_A Muscle-specific tyrosine kinase receptor MUSK; phosphorylation, signal transduction, MASS spectrometry, transferase; 2.05A {Rattus norvegicus} SCOP: d.144.1.7 Length = 343 Back     alignment and structure
>1t46_A HOMO sapiens V-KIT hardy-zuckerman 4 feline sarcoma viral oncogene homolog; kinase, structure, inhibitor, STI-571, gleevec, transferase activator; HET: STI; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1pkg_A* 1t45_A 3g0e_A* 3g0f_A* Length = 313 Back     alignment and structure
>3gen_A Tyrosine-protein kinase BTK; bruton'S tyrosine kinase, 4-amino-5-(4-phenoxyphenyl)-5H- pyrrolo[3, 2-D]pyrimidin-7-YL-cyclopentane, TEC-family; HET: B43; 1.60A {Homo sapiens} PDB: 3k54_A* 3pj2_A* 3piy_A* 3piz_A* 3pj1_A* 3pix_A* 3pj3_A* 3p08_A 3ocs_A* 3oct_A* 1k2p_A Length = 283 Back     alignment and structure
>2pvf_A Fibroblast growth factor receptor 2; kinase domain fold consisting of N- and C-lobes, transferase; HET: PTR ACP; 1.80A {Homo sapiens} PDB: 3cly_A* 2pzr_A* 2pzp_A* 2pvy_A* 2pz5_A* 2q0b_A* 2pwl_A* 2py3_A* 3ri1_A* 1gjo_A 1oec_A* 3b2t_A* 3gql_A* 3gqi_A* 1fgk_A 1fgi_A* 1agw_A 2fgi_A* 3js2_A* 3ky2_A ... Length = 334 Back     alignment and structure
>3kul_A Ephrin type-A receptor 8; ATP-binding, kinase, nucleotide-binding, transfera phosphorylation, transmembrane, tyrosine-protein kinase; HET: PTR; 2.15A {Homo sapiens} Length = 325 Back     alignment and structure
>3v5q_A NT-3 growth factor receptor; kinase domain, kinase, phosphorylation, transferase-transfer inhibitor complex; HET: 0F4; 2.20A {Homo sapiens} Length = 297 Back     alignment and structure
>2qkw_B Protein kinase; three-helix bundle motif, AVRPTO-PTO duplex, layered beta- sheets, transferas; HET: SEP TPO; 3.20A {Solanum pimpinellifolium} PDB: 3hgk_A* Length = 321 Back     alignment and structure
>3t9t_A Tyrosine-protein kinase ITK/TSK; kinase domain, alpha/beta, ATP binding, phosphorylation, intracellular, transferase-transferase inhibitor complex; HET: IAQ; 1.65A {Homo sapiens} PDB: 3v5l_A* 3v5j_A* 3v8t_A* 3v8w_A* 1sm2_A* 1snu_A* 1snx_A 3qgw_A* 3qgy_A* 3miy_A* 3mj1_A* 3mj2_A* Length = 267 Back     alignment and structure
>2qol_A Ephrin receptor; receptor tyrosine kinase, juxtamembrane segment, structural genomics, mutant, structural genomics consortium, SGC, ATP- binding; 1.07A {Homo sapiens} PDB: 2qok_A 2qoi_A 2qoo_A 2qof_A 2qod_A 2qo9_A* 2gsf_A 2qo7_A* 2qo2_A* 2qoq_A* 2qon_A* 3fxx_A* 3fy2_A 2qoc_A* 2qob_A* 3dzq_A* 2r2p_A 2hel_A 2rei_A 3dko_A* ... Length = 373 Back     alignment and structure
>2psq_A Fibroblast growth factor receptor 2; kinase domain fold consisting of N- and C-lobes, transferase; 2.40A {Homo sapiens} SCOP: d.144.1.7 PDB: 1xr0_A Length = 370 Back     alignment and structure
>3tt0_A Basic fibroblast growth factor receptor 1; kinase domain, transferase, transferase-transferase inhibito; HET: 07J; 2.80A {Homo sapiens} Length = 382 Back     alignment and structure
>3zzw_A Tyrosine-protein kinase transmembrane receptor RO; transferase, neurotrophic tyrosine kinase, receptor-related NTRKR2; 2.90A {Homo sapiens} Length = 289 Back     alignment and structure
>1fvr_A Tyrosine-protein kinase TIE-2; tyrosine kinase, transferase; 2.20A {Homo sapiens} SCOP: d.144.1.7 PDB: 2oo8_X* 2osc_A* 2p4i_A* 3l8p_A* 2wqb_A* Length = 327 Back     alignment and structure
>3g2f_A Bone morphogenetic protein receptor type-2; kinase, structural genomics, structural genomics consortium, ATP-binding, disease mutation; HET: ADP; 2.35A {Homo sapiens} Length = 336 Back     alignment and structure
>1mqb_A Ephrin type-A receptor 2; tyrosine protein kinase, transferase; HET: ANP; 2.30A {Homo sapiens} SCOP: d.144.1.7 Length = 333 Back     alignment and structure
>1wak_A Serine/threonine-protein kinase SPRK1; SRPK, transferase, alternative splicing, ATP-binding, chromosome partition, differentiation, mRNA processing; 1.73A {Homo sapiens} PDB: 1wbp_A* 3beg_A* 2x7g_A* Length = 397 Back     alignment and structure
>1wak_A Serine/threonine-protein kinase SPRK1; SRPK, transferase, alternative splicing, ATP-binding, chromosome partition, differentiation, mRNA processing; 1.73A {Homo sapiens} PDB: 1wbp_A* 3beg_A* 2x7g_A* Length = 397 Back     alignment and structure
>1rjb_A FL cytokine receptor; kinase, structure, autoinhibition, juxtamembrane domain, transferase; 2.10A {Homo sapiens} SCOP: d.144.1.7 Length = 344 Back     alignment and structure
>3uqc_A Probable conserved transmembrane protein; structural genomics, TB structural genomics consortium, TBSG fold, FHAA, transferase; 2.26A {Mycobacterium tuberculosis} PDB: 3oun_B* 3otv_A 3ouk_A Length = 286 Back     alignment and structure
>3uqc_A Probable conserved transmembrane protein; structural genomics, TB structural genomics consortium, TBSG fold, FHAA, transferase; 2.26A {Mycobacterium tuberculosis} PDB: 3oun_B* 3otv_A 3ouk_A Length = 286 Back     alignment and structure
>4fvq_A Tyrosine-protein kinase JAK2; janus protein kinase, pseudokinase, ATP binding, phosphoryla transferase; HET: ATP; 1.75A {Homo sapiens} PDB: 4fvp_A* 4fvr_A* Length = 289 Back     alignment and structure
>2yfx_A Tyrosine-protein kinase receptor; nucleotide-binding, transferase; HET: VGH; 1.70A {Homo sapiens} PDB: 2xp2_A* 3aox_A* 2yhv_A 3lcs_A* 3lct_A* 4dce_A* 2xba_A* 2xb7_A* Length = 327 Back     alignment and structure
>3l9p_A Anaplastic lymphoma kinase; kinase domain, ATP-binding, glycoprotein, membrane, nucleotide-binding, phosphoprotein, proto-oncogene; 1.80A {Homo sapiens} Length = 367 Back     alignment and structure
>3kvw_A DYRK2, dual specificity tyrosine-phosphorylation-regulat 2; KI-(Y)-phosphorylation REG kinase 2, PSK-H2, kinase, structural genomics consortium; HET: SEP PTR IRB; 2.28A {Homo sapiens} PDB: 3k2l_A* Length = 429 Back     alignment and structure
>3kvw_A DYRK2, dual specificity tyrosine-phosphorylation-regulat 2; KI-(Y)-phosphorylation REG kinase 2, PSK-H2, kinase, structural genomics consortium; HET: SEP PTR IRB; 2.28A {Homo sapiens} PDB: 3k2l_A* Length = 429 Back     alignment and structure
>2eu9_A Dual specificity protein kinase CLK3; kinase domain, transferase; 1.53A {Homo sapiens} PDB: 2wu6_A* 2wu7_A* 3raw_A* 2exe_A 3nr9_A* Length = 355 Back     alignment and structure
>2eu9_A Dual specificity protein kinase CLK3; kinase domain, transferase; 1.53A {Homo sapiens} PDB: 2wu6_A* 2wu7_A* 3raw_A* 2exe_A 3nr9_A* Length = 355 Back     alignment and structure
>1q8y_A SR protein kinase; transferase; HET: ADP ADE; 2.05A {Saccharomyces cerevisiae} SCOP: d.144.1.7 PDB: 1q8z_A 1q97_A* 1q99_A* 1how_A 2jd5_A Length = 373 Back     alignment and structure
>1q8y_A SR protein kinase; transferase; HET: ADP ADE; 2.05A {Saccharomyces cerevisiae} SCOP: d.144.1.7 PDB: 1q8z_A 1q97_A* 1q99_A* 1how_A 2jd5_A Length = 373 Back     alignment and structure
>2vx3_A Dual specificity tyrosine-phosphorylation- regula kinase 1A; serine/threonine-protein kinase, minibrain homolog, nucleotide-binding, transferase; HET: PTR D15 P6G; 2.40A {Homo sapiens} PDB: 2wo6_A* 3anq_A* 3anr_A* Length = 382 Back     alignment and structure
>2vx3_A Dual specificity tyrosine-phosphorylation- regula kinase 1A; serine/threonine-protein kinase, minibrain homolog, nucleotide-binding, transferase; HET: PTR D15 P6G; 2.40A {Homo sapiens} PDB: 2wo6_A* 3anq_A* 3anr_A* Length = 382 Back     alignment and structure
>3llt_A Serine/threonine kinase-1, pflammer; lammer kinase, malaria, structural GE structural genomics consortium, SGC, transferase; HET: ANP; 2.50A {Plasmodium falciparum 3D7} Length = 360 Back     alignment and structure
>3llt_A Serine/threonine kinase-1, pflammer; lammer kinase, malaria, structural GE structural genomics consortium, SGC, transferase; HET: ANP; 2.50A {Plasmodium falciparum 3D7} Length = 360 Back     alignment and structure
>1z57_A Dual specificity protein kinase CLK1; protein tyrosine kinase, splicing, human, 10Z-hymendialdisine, structural genomics; HET: DBQ; 1.70A {Homo sapiens} PDB: 2vag_A* Length = 339 Back     alignment and structure
>1z57_A Dual specificity protein kinase CLK1; protein tyrosine kinase, splicing, human, 10Z-hymendialdisine, structural genomics; HET: DBQ; 1.70A {Homo sapiens} PDB: 2vag_A* Length = 339 Back     alignment and structure
>2jii_A Serine/threonine-protein kinase VRK3 molecule: VA related kinase 3; transferase, pseudo kinase domain, vaccinia related kinase, ATP-binding; 2.00A {Homo sapiens} Length = 352 Back     alignment and structure
>2v62_A Serine/threonine-protein kinase VRK2; transferase, ATP-binding, membrane, nucleotide-binding, TRAN; 1.7A {Homo sapiens} Length = 345 Back     alignment and structure
>3op5_A Serine/threonine-protein kinase VRK1; adenosine triphosphate, amino acid sequence, binding sites, domain, models, molecular; HET: REB; 2.40A {Homo sapiens} PDB: 2lav_A 2kty_A 2kul_A Length = 364 Back     alignment and structure
>2izr_A Casein kinase I isoform gamma-3; serine/threonine-protein kinase, transferase, ATP- binding, phosphorylation, nucleotide-binding; HET: BRK; 1.3A {Homo sapiens} PDB: 2izs_A* 2izt_A* 2izu_A* 2chl_A* 2c47_A* 2cmw_A* Length = 330 Back     alignment and structure
>2vuw_A Serine/threonine-protein kinase haspin; cell cycle, transferase, CAsp8, nucleotide binding; HET: MSE 5ID MPD; 1.80A {Homo sapiens} PDB: 3f2n_A* 3e7v_A* 3dlz_A* 3fmd_A* 3iq7_A* 2wb8_A Length = 336 Back     alignment and structure
>3uzp_A CKI-delta, CKID, casein kinase I isoform delta; CK1D, inhibitor, PF670462, transferase-transferase I complex; HET: 0CK; 1.94A {Homo sapiens} PDB: 3uys_A* 3uyt_A* 1cki_A 1ckj_A Length = 296 Back     alignment and structure
>1csn_A Casein kinase-1; phosphotransferase; HET: ATP; 2.00A {Schizosaccharomyces pombe} SCOP: d.144.1.7 PDB: 1eh4_A* 2csn_A* Length = 298 Back     alignment and structure
>1mby_A SAK, serine/threonine kinase; POLO domain, strand exchange, transferase; 2.00A {Mus musculus} SCOP: d.223.1.1 Length = 88 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query305
4aw0_A311 HPDK1, 3-phosphoinositide-dependent protein kinase 100.0
4fih_A346 Serine/threonine-protein kinase PAK 4; kinase doma 100.0
3ubd_A304 Ribosomal protein S6 kinase alpha-3; kinase-inhibi 100.0
4b9d_A350 Serine/threonine-protein kinase NEK1; transferase, 100.0
3hyh_A275 Carbon catabolite-derepressing protein kinase; kin 100.0
4fie_A423 Serine/threonine-protein kinase PAK 4; kinase doma 100.0
3fpq_A290 Serine/threonine-protein kinase WNK1; protein seri 100.0
4g3f_A336 NF-kappa-beta-inducing kinase; non-RD kinase, prot 100.0
3v5w_A 689 G-protein coupled receptor kinase 2; inhibitor com 100.0
4b99_A398 Mitogen-activated protein kinase 7; transferase, i 100.0
3uto_A573 Twitchin; kinase, muscle sarcomere, transferase; H 100.0
4g31_A299 Eukaryotic translation initiation factor 2-alpha; 100.0
4asz_A299 BDNF/NT-3 growth factors receptor; transferase, TR 100.0
4f9c_A361 Cell division cycle 7-related protein kinase; Ser/ 100.0
4aoj_A329 High affinity nerve growth factor receptor; transf 100.0
4gt4_A308 Tyrosine-protein kinase transmembrane receptor RO; 100.0
3omv_A307 RAF proto-oncogene serine/threonine-protein kinas; 100.0
3fe3_A328 MAP/microtubule affinity-regulating kinase 3; seri 100.0
3zgw_A347 Maternal embryonic leucine zipper kinase; transfer 100.0
1o6l_A337 RAC-beta serine/threonine protein kinase; protein 100.0
2yab_A361 Death-associated protein kinase 2; apoptosis, tran 100.0
4ase_A353 Vascular endothelial growth factor receptor 2; tra 100.0
1fot_A318 TPK1 delta, CAMP-dependent protein kinase type 1; 100.0
3txo_A353 PKC-L, NPKC-ETA, protein kinase C ETA type; phosph 100.0
1xjd_A345 Protein kinase C, theta type; PKC-theta, ATP, AMP, 100.0
1rdq_E350 PKA C-alpha, CAMP-dependent protein kinase, alpha- 100.0
3soa_A444 Calcium/calmodulin-dependent protein kinase type a 100.0
2i0e_A353 Protein kinase C-beta II; serine/threonine protein 100.0
4dc2_A396 Protein kinase C IOTA type; kinase, substrate, cel 100.0
3a8x_A345 Protein kinase C IOTA type; transferase; HET: TPO; 100.0
3a62_A327 Ribosomal protein S6 kinase beta-1; kinase domain, 100.0
3h4j_B336 AMPK kdaid, SNF1-like protein kinase SSP2; ATP-bin 100.0
2bdw_A362 Hypothetical protein K11E8.1D; kinase, calmodulin 100.0
2y0a_A326 Death-associated protein kinase 1; transferase, ca 100.0
3fxz_A297 Serine/threonine-protein kinase PAK 1; transferase 100.0
4fr4_A384 YANK1, serine/threonine-protein kinase 32A; struct 100.0
3v8s_A410 RHO-associated protein kinase 1; dimerization, myo 100.0
2r5t_A373 Serine/threonine-protein kinase SGK1; AGC protein 100.0
2y94_A476 5'-AMP-activated protein kinase catalytic subunit; 100.0
1tki_A321 Titin; serine kinase, muscle, autoinhibition; 2.00 100.0
2qr7_A342 Ribosomal protein S6 kinase alpha-3; kinase domain 100.0
4ejn_A446 RAC-alpha serine/threonine-protein kinase; AKT1, a 100.0
3c0i_A351 Peripheral plasma membrane protein CASK; neurexin, 100.0
3gni_B389 Strad alpha; kinase fold, pseudokinase, alpha heli 100.0
3uc3_A361 Serine/threonine-protein kinase SRK2I; SNRK2, ABA 100.0
4aw2_A437 Serine/threonine-protein kinase MRCK alpha; transf 100.0
2acx_A576 G protein-coupled receptor kinase 6; GRK, G transf 100.0
2owb_A335 Serine/threonine-protein kinase PLK1; catalytic do 100.0
2vgo_A284 Serine/threonine-protein kinase 12-A; nucleotide-b 100.0
2rku_A294 Serine/threonine-protein kinase PLK1; structure of 100.0
3q5i_A504 Protein kinase; CDPK, malaria, phosphotransferase, 100.0
3pfq_A674 PKC-B, PKC-beta, protein kinase C beta type; phosp 100.0
2x4f_A373 Myosin light chain kinase family member 4; LUNG, b 100.0
1kob_A387 Twitchin; kinase, intrasteric regulation; 2.30A {A 100.0
3fdn_A279 Serine/threonine-protein kinase 6; aurora kinase i 100.0
2vd5_A412 DMPK protein; serine/threonine-protein kinase, kin 100.0
3kn6_A325 Ribosomal protein S6 kinase alpha-5; AMP-PNP, MSK1 100.0
2eue_A275 Carbon catabolite derepressing protein kinase; kin 100.0
3nyv_A484 Calmodulin-domain protein kinase 1; serine/threoni 100.0
3mwu_A486 Calmodulin-domain protein kinase 1; serine/threoni 100.0
3lij_A494 Calcium/calmodulin dependent protein kinase with A 100.0
2pmi_A317 Negative RE, cyclin-dependent protein kinase PHO85 100.0
3c4z_A543 Rhodopsin kinase; Ser/Thr kinase, RGS homology dom 100.0
2a2a_A321 Death-associated protein kinase 2; autoinhibition, 100.0
2w4o_A349 Calcium/calmodulin-dependent protein kinase type I 100.0
3f3z_A277 Calcium/calmodulin-dependent protein kinase with d 100.0
3hmm_A303 TGF-beta receptor type-1; ALK5, kinase, inhibitor, 100.0
2zv2_A298 Calcium/calmodulin-dependent protein kinase kinas; 100.0
3kk8_A284 Calcium/calmodulin dependent protein kinase II; AT 100.0
3niz_A311 Rhodanese family protein; structural genomics, str 100.0
2ac3_A316 MAP kinase-interacting serine/threonine kinase 2; 100.0
1ob3_A288 PFPK5, cell division control protein 2 homolog; tr 100.0
3o0g_A292 Cell division protein kinase 5; kinase activator c 100.0
2h6d_A276 5'-AMP-activated protein kinase catalytic subunit 100.0
2c30_A321 Serine/threonine-protein kinase PAK 6; CRIB domain 100.0
3tki_A323 Serine/threonine-protein kinase CHK1; cell checkpo 100.0
2jam_A304 Calcium/calmodulin-dependent protein kinase type 1 100.0
3cok_A278 Serine/threonine-protein kinase PLK4; POLO-like ki 100.0
3gbz_A329 Kinase, CMGC CDK; ssgcid, ATP-binding, nucleotide- 100.0
1nxk_A400 MAP kinase-activated protein kinase 2; MK2, phosph 100.0
3is5_A285 Calcium-dependent protein kinase; CDPK, structural 100.0
3hko_A345 Calcium/calmodulin-dependent protein kinase with d 100.0
3oz6_A388 Mitogen-activated protein kinase 1, serine/threon 100.0
1u5q_A348 Serine/threonine protein kinase TAO2; transferase; 100.0
2y7j_A365 Phosphorylase B kinase gamma catalytic chain, test 100.0
3mtl_A324 Cell division protein kinase 16; pctaire1, indirub 100.0
1t4h_A290 Serine/threonine-protein kinase WNK1; protein seri 100.0
3ttj_A464 Mitogen-activated protein kinase 10; JNK3, protein 100.0
3dls_A335 PAS domain-containing serine/threonine-protein KI; 100.0
3llt_A360 Serine/threonine kinase-1, pflammer; lammer kinase 100.0
3bhy_A283 Death-associated protein kinase 3; death associate 100.0
4agu_A311 Cyclin-dependent kinase-like 1; transferase, phosp 100.0
2wtk_C305 Serine/threonine-protein kinase 11; transferase-me 100.0
3eqc_A360 Dual specificity mitogen-activated protein kinase; 100.0
3g33_A308 Cell division protein kinase 4; Ser/Thr protein ki 100.0
1ua2_A346 CAK, cell division protein kinase 7; cell cycle, p 100.0
2r3i_A299 Cell division protein kinase 2; serine/threonine-p 100.0
3p86_A309 Serine/threonine-protein kinase CTR1; ETR1, ERS1, 100.0
4e7w_A394 Glycogen synthase kinase 3; GSK3, PTyr195, transfe 100.0
1cm8_A367 Phosphorylated MAP kinase P38-gamma; phosphorylati 100.0
3lm5_A327 Serine/threonine-protein kinase 17B; STK17B, serin 100.0
1vzo_A355 Ribosomal protein S6 kinase alpha 5; protein kinas 100.0
2w5a_A279 Serine/threonine-protein kinase NEK2; Ser/Thr prot 100.0
2j7t_A302 Serine/threonine-protein kinase 10; transferase, A 100.0
4aaa_A331 Cyclin-dependent kinase-like 2; transferase, phosp 100.0
3i6u_A419 CDS1, serine/threonine-protein kinase CHK2; Ser/Th 100.0
2pml_X348 PFPK7, Ser/Thr protein kinase; phosphorylati trans 100.0
1phk_A298 Phosphorylase kinase; glycogen metabolism, transfe 100.0
3ork_A311 Serine/threonine protein kinase; structural genomi 100.0
1x8b_A289 WEE1HU, WEE1-like protein kinase; cell cycle, tran 100.0
3rp9_A458 Mitogen-activated protein kinase; structural genom 100.0
3eb0_A383 Putative uncharacterized protein; kinase cryptospo 100.0
2wei_A287 Calmodulin-domain protein kinase 1, putative; nucl 100.0
3qd2_B332 Eukaryotic translation initiation factor 2-alpha; 100.0
2clq_A295 Mitogen-activated protein kinase kinase kinase 5; 100.0
3mi9_A351 Cell division protein kinase 9; P-TEFB, HIV-1, pro 100.0
2yex_A276 Serine/threonine-protein kinase CHK1; transferase, 100.0
1j1b_A420 Glycogen synthase kinase-3 beta; complex, TAU, AMP 100.0
3kvw_A429 DYRK2, dual specificity tyrosine-phosphorylation-r 100.0
3com_A314 Serine/threonine-protein kinase 4; MST1, STE20-lik 100.0
2vwi_A303 Serine/threonine-protein kinase OSR1; STE kinase, 100.0
3l9p_A367 Anaplastic lymphoma kinase; kinase domain, ATP-bin 100.0
2xrw_A371 Mitogen-activated protein kinase 8; transcription, 100.0
3rgf_A405 Cyclin-dependent kinase 8; protein kinase complex, 100.0
3n9x_A432 Phosphotransferase; malaria kinase, structural gen 100.0
2fst_X367 Mitogen-activated protein kinase 14; active mutant 100.0
2x7f_A326 TRAF2 and NCK-interacting protein kinase; serine/t 100.0
4eqm_A294 Protein kinase; transferase; HET: ANP; 3.00A {Stap 100.0
4hcu_A269 Tyrosine-protein kinase ITK/TSK; transferase-trans 100.0
3a7i_A303 MST3 kinase, serine/threonine kinase 24 (STE20 hom 100.0
2ycf_A322 Serine/threonine-protein kinase CHK2; transferase, 100.0
3p23_A432 Serine/threonine-protein kinase/endoribonuclease; 100.0
2zmd_A390 Dual specificity protein kinase TTK; MPS1, T686A, 100.0
3qyz_A364 Mitogen-activated protein kinase 1; transferase, s 100.0
2psq_A370 Fibroblast growth factor receptor 2; kinase domain 99.98
3dbq_A343 Dual specificity protein kinase TTK; MPS1 structur 99.98
1blx_A326 Cyclin-dependent kinase 6; inhibitor protein, cycl 99.98
4fvq_A289 Tyrosine-protein kinase JAK2; janus protein kinase 99.98
3pg1_A362 Mitogen-activated protein kinase, putative (MAP K 99.98
3kmu_A271 ILK, integrin-linked kinase; cell adhesion, ANK re 99.98
1z57_A339 Dual specificity protein kinase CLK1; protein tyro 99.98
3qup_A323 Tyrosine-protein kinase receptor TYRO3; protein ki 99.98
1luf_A343 Muscle-specific tyrosine kinase receptor MUSK; pho 99.98
4exu_A371 Mitogen-activated protein kinase 13; P38 kinase, t 99.98
3kul_A325 Ephrin type-A receptor 8; ATP-binding, kinase, nuc 99.98
2b9h_A353 MAP kinase FUS3, mitogen-activated protein kinase 99.97
3nsz_A330 CK II alpha, casein kinase II subunit alpha; inhib 99.97
4euu_A319 Serine/threonine-protein kinase TBK1; ATP binding, 99.97
3e3p_A360 Protein kinase, putative glycogen synthase kinase; 99.97
3p1a_A311 MYT1 kinase, membrane-associated tyrosine- and thr 99.97
3gen_A283 Tyrosine-protein kinase BTK; bruton'S tyrosine kin 99.97
3q60_A371 ROP5B; pseudokinase, transferase; HET: ATP; 1.72A 99.97
2i6l_A320 Mitogen-activated protein kinase 6; MAPK6, ERK3, e 99.97
3byv_A377 Rhoptry kinase; malaria, transferase, structural g 99.97
2yfx_A327 Tyrosine-protein kinase receptor; nucleotide-bindi 99.97
2rio_A434 Serine/threonine-protein kinase/endoribonuclease I 99.97
3fme_A290 Dual specificity mitogen-activated protein kinase; 99.97
3cbl_A377 C-FES, proto-oncogene tyrosine-protein kinase FES/ 99.97
2eu9_A355 Dual specificity protein kinase CLK3; kinase domai 99.97
3t9t_A267 Tyrosine-protein kinase ITK/TSK; kinase domain, al 99.97
3tt0_A382 Basic fibroblast growth factor receptor 1; kinase 99.97
3sxs_A268 Cytoplasmic tyrosine-protein kinase BMX; transfera 99.97
2ivs_A314 Proto-oncogene tyrosine-protein kinase receptor RE 99.97
3lb7_A307 RAF proto-oncogene serine/threonine-protein kinas; 99.97
1mp8_A281 Focal adhesion kinase 1; tyrosine protein kinase, 99.97
3dtc_A271 Mitogen-activated protein kinase kinase kinase 9; 99.97
1k9a_A450 Carboxyl-terminal SRC kinase; COOH-terminal SRC ki 99.97
3fhr_A336 MAP kinase-activated protein kinase 3; kinase-inhi 99.97
3kfa_A288 Tyrosine-protein kinase ABL1; CML, drug resistance 99.97
3coi_A353 Mitogen-activated protein kinase 13; P38D, P38delt 99.97
2qol_A373 Ephrin receptor; receptor tyrosine kinase, juxtame 99.97
3kex_A325 Receptor tyrosine-protein kinase ERBB-3; kinase do 99.97
1zy4_A303 Serine/threonine-protein kinase GCN2; translation 99.97
3s95_A310 LIMK-1, LIM domain kinase 1; structural genomics, 99.97
3an0_A340 Dual specificity mitogen-activated protein kinase; 99.97
1qcf_A454 Haematopoetic cell kinase (HCK); tyrosine kinase-i 99.97
1wak_A397 Serine/threonine-protein kinase SPRK1; SRPK, trans 99.97
2vx3_A382 Dual specificity tyrosine-phosphorylation- regula 99.97
1fvr_A327 Tyrosine-protein kinase TIE-2; tyrosine kinase, tr 99.97
1p4o_A322 Insulin-like growth factor I receptor protein; IGF 99.97
2h34_A309 Serine/threonine-protein kinase PKNE; apoenzyme, t 99.97
1mqb_A333 Ephrin type-A receptor 2; tyrosine protein kinase, 99.97
1opk_A495 P150, C-ABL, proto-oncogene tyrosine-protein kinas 99.97
3vhe_A359 Vascular endothelial growth factor receptor 2; kin 99.97
1q8y_A373 SR protein kinase; transferase; HET: ADP ADE; 2.05 99.97
1fmk_A452 C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyros 99.97
1rjb_A344 FL cytokine receptor; kinase, structure, autoinhib 99.97
3poz_A327 Epidermal growth factor receptor; kinase domain, a 99.97
2izr_A330 Casein kinase I isoform gamma-3; serine/threonine- 99.97
3a99_A320 Proto-oncogene serine/threonine-protein kinase PI; 99.97
1t46_A313 HOMO sapiens V-KIT hardy-zuckerman 4 feline sarcom 99.97
2eva_A307 TAK1 kinase - TAB1 chimera fusion protein; transfe 99.97
1u59_A287 Tyrosine-protein kinase ZAP-70; transferase; HET: 99.97
1byg_A278 CSK, protein (C-terminal SRC kinase); protein kina 99.97
2iwi_A312 Serine/threonine-protein kinase PIM-2; nucleotide- 99.97
4fl3_A635 Tyrosine-protein kinase SYK; transferase; HET: ANP 99.97
2v62_A345 Serine/threonine-protein kinase VRK2; transferase, 99.97
4f0f_A287 Serine/threonine-protein kinase ROCO4; LRRK2, ATP- 99.97
2pvf_A334 Fibroblast growth factor receptor 2; kinase domain 99.97
3cc6_A281 Protein tyrosine kinase 2 beta; focal adhesion kin 99.97
1xbb_A291 Tyrosine-protein kinase SYK; gleevec, STI-571, ima 99.97
3f66_A298 Hepatocyte growth factor receptor; C-Met, protein 99.97
3c1x_A373 Hepatocyte growth factor receptor; receptor tyrosi 99.97
2dyl_A318 Dual specificity mitogen-activated protein kinase 99.97
3lzb_A327 Epidermal growth factor receptor; epidermal growth 99.97
2i1m_A333 Macrophage colony-stimulating factor 1 receptor; k 99.97
3soc_A322 Activin receptor type-2A; structural genomics cons 99.97
2ozo_A613 Tyrosine-protein kinase ZAP-70; inactive ZAP-70, t 99.97
1qpc_A279 LCK kinase; alpha beta fold, transferase; HET: PTR 99.97
1csn_A298 Casein kinase-1; phosphotransferase; HET: ATP; 2.0 99.97
3pls_A298 Macrophage-stimulating protein receptor; protein k 99.97
3cek_A313 Dual specificity protein kinase TTK; HMPS1, PYT, E 99.97
2h8h_A535 Proto-oncogene tyrosine-protein kinase SRC; SRC ki 99.97
3brb_A313 Proto-oncogene tyrosine-protein kinase MER; ATP-bi 99.97
2wqm_A310 Serine/threonine-protein kinase NEK7; ATP-binding, 99.97
3ugc_A295 Tyrosine-protein kinase JAK2; small molecule inhib 99.96
2a19_B284 Interferon-induced, double-stranded RNA-activated 99.96
2qkw_B321 Protein kinase; three-helix bundle motif, AVRPTO-P 99.96
2xir_A316 Vascular endothelial growth factor receptor 2; ang 99.96
3op5_A364 Serine/threonine-protein kinase VRK1; adenosine tr 99.96
1u46_A291 ACK-1, activated CDC42 kinase 1; tyrosine kinase, 99.96
2nru_A307 Interleukin-1 receptor-associated kinase 4; inhibi 99.96
3og7_A289 AKAP9-BRAF fusion protein; proto-oncogene, V600E, 99.96
3aln_A327 Dual specificity mitogen-activated protein kinase; 99.96
2y4i_B319 KSR2, HKSR2, kinase suppressor of RAS 2; transfera 99.96
3qa8_A 676 MGC80376 protein; kinase ubiquitin-like domain, ph 99.96
2j0j_A656 Focal adhesion kinase 1; cell migration, FERM, tra 99.96
3lxp_A318 Non-receptor tyrosine-protein kinase TYK2; JAK3, i 99.96
3uim_A326 Brassinosteroid insensitive 1-associated receptor; 99.96
3lxl_A327 Tyrosine-protein kinase JAK3; TYK2, inflammation, 99.96
2jii_A352 Serine/threonine-protein kinase VRK3 molecule: VA 99.96
2buj_A317 Serine/threonine-protein kinase 16; transferase, A 99.96
4eut_A396 Serine/threonine-protein kinase TBK1; ATP binding, 99.96
3uzp_A296 CKI-delta, CKID, casein kinase I isoform delta; CK 99.96
3m2w_A299 MAP kinase-activated protein kinase 2; small molec 99.96
4e5w_A302 Tyrosine-protein kinase JAK1; kinase domain, trans 99.96
4hgt_A296 Casein kinase I isoform delta; CK1D, inhibitor, tr 99.96
3q4u_A301 Activin receptor type-1; structural genomics conso 99.96
3ll6_A337 Cyclin G-associated kinase; transferase, protein k 99.95
3mdy_A337 Bone morphogenetic protein receptor type-1B; compl 99.95
3gxj_A303 TGF-beta receptor type-1; ALK5, kinase, inhibitor, 99.95
2w1i_A326 JAK2; chromosomal rearrangement, nucleotide-bindin 99.95
3g2f_A336 Bone morphogenetic protein receptor type-2; kinase 99.95
1b6c_B342 TGF-B superfamily receptor type I; complex (isomer 99.95
3e7e_A365 HBUB1, BUB1A, mitotic checkpoint serine/threonine- 99.95
3uqc_A286 Probable conserved transmembrane protein; structur 99.95
3sv0_A 483 Casein kinase I-like; typical kinase domain fold, 99.95
2pzi_A 681 Probable serine/threonine-protein kinase PKNG; ATP 99.94
2vuw_A336 Serine/threonine-protein kinase haspin; cell cycle 99.93
3dzo_A413 Rhoptry kinase domain; parasitic disease, transfer 99.91
4azs_A569 Methyltransferase WBDD; kinase; HET: AMP SAM; 2.15 99.88
3en9_A540 Glycoprotease, O-sialoglycoprotein endopeptidase/p 99.62
4aw0_A 311 HPDK1, 3-phosphoinositide-dependent protein kinase 99.41
4fih_A 346 Serine/threonine-protein kinase PAK 4; kinase doma 99.37
3hyh_A 275 Carbon catabolite-derepressing protein kinase; kin 99.37
3ubd_A 304 Ribosomal protein S6 kinase alpha-3; kinase-inhibi 99.35
4g3f_A 336 NF-kappa-beta-inducing kinase; non-RD kinase, prot 99.35
4fie_A 423 Serine/threonine-protein kinase PAK 4; kinase doma 99.35
3omv_A 307 RAF proto-oncogene serine/threonine-protein kinas; 99.33
4b9d_A 350 Serine/threonine-protein kinase NEK1; transferase, 99.33
3v5w_A 689 G-protein coupled receptor kinase 2; inhibitor com 99.27
4g31_A 299 Eukaryotic translation initiation factor 2-alpha; 99.27
4b99_A 398 Mitogen-activated protein kinase 7; transferase, i 99.25
3fpq_A290 Serine/threonine-protein kinase WNK1; protein seri 99.25
4f9c_A 361 Cell division cycle 7-related protein kinase; Ser/ 99.23
4ase_A 353 Vascular endothelial growth factor receptor 2; tra 99.23
4asz_A 299 BDNF/NT-3 growth factors receptor; transferase, TR 99.22
4gt4_A 308 Tyrosine-protein kinase transmembrane receptor RO; 99.21
4aoj_A 329 High affinity nerve growth factor receptor; transf 99.21
4azs_A 569 Methyltransferase WBDD; kinase; HET: AMP SAM; 2.15 99.14
3hmm_A 303 TGF-beta receptor type-1; ALK5, kinase, inhibitor, 99.12
3uto_A 573 Twitchin; kinase, muscle sarcomere, transferase; H 99.11
4aw2_A 437 Serine/threonine-protein kinase MRCK alpha; transf 99.01
2vd5_A 412 DMPK protein; serine/threonine-protein kinase, kin 98.99
3txo_A 353 PKC-L, NPKC-ETA, protein kinase C ETA type; phosph 98.98
4dc2_A 396 Protein kinase C IOTA type; kinase, substrate, cel 98.96
3rp9_A 458 Mitogen-activated protein kinase; structural genom 98.95
2vuw_A336 Serine/threonine-protein kinase haspin; cell cycle 98.94
3kex_A 325 Receptor tyrosine-protein kinase ERBB-3; kinase do 98.94
3v8s_A 410 RHO-associated protein kinase 1; dimerization, myo 98.93
1o6l_A 337 RAC-beta serine/threonine protein kinase; protein 98.93
2i0e_A 353 Protein kinase C-beta II; serine/threonine protein 98.93
3op5_A 364 Serine/threonine-protein kinase VRK1; adenosine tr 98.93
4fr4_A 384 YANK1, serine/threonine-protein kinase 32A; struct 98.92
1xjd_A 345 Protein kinase C, theta type; PKC-theta, ATP, AMP, 98.91
3e7e_A 365 HBUB1, BUB1A, mitotic checkpoint serine/threonine- 98.91
3fe3_A 328 MAP/microtubule affinity-regulating kinase 3; seri 98.91
3o0g_A 292 Cell division protein kinase 5; kinase activator c 98.91
3a8x_A 345 Protein kinase C IOTA type; transferase; HET: TPO; 98.91
2r5t_A 373 Serine/threonine-protein kinase SGK1; AGC protein 98.9
3n9x_A 432 Phosphotransferase; malaria kinase, structural gen 98.89
3oz6_A 388 Mitogen-activated protein kinase 1, serine/threon 98.89
1fot_A 318 TPK1 delta, CAMP-dependent protein kinase type 1; 98.89
1rdq_E 350 PKA C-alpha, CAMP-dependent protein kinase, alpha- 98.89
3pfq_A 674 PKC-B, PKC-beta, protein kinase C beta type; phosp 98.89
3niz_A 311 Rhodanese family protein; structural genomics, str 98.88
3poz_A 327 Epidermal growth factor receptor; kinase domain, a 98.87
3p1a_A311 MYT1 kinase, membrane-associated tyrosine- and thr 98.87
1tki_A 321 Titin; serine kinase, muscle, autoinhibition; 2.00 98.86
4e7w_A 394 Glycogen synthase kinase 3; GSK3, PTyr195, transfe 98.86
1j1b_A 420 Glycogen synthase kinase-3 beta; complex, TAU, AMP 98.86
3ttj_A 464 Mitogen-activated protein kinase 10; JNK3, protein 98.86
3fxz_A 297 Serine/threonine-protein kinase PAK 1; transferase 98.86
3zgw_A 347 Maternal embryonic leucine zipper kinase; transfer 98.85
3dzo_A 413 Rhoptry kinase domain; parasitic disease, transfer 98.85
2zv2_A 298 Calcium/calmodulin-dependent protein kinase kinas; 98.85
3h4j_B 336 AMPK kdaid, SNF1-like protein kinase SSP2; ATP-bin 98.85
3c4z_A 543 Rhodopsin kinase; Ser/Thr kinase, RGS homology dom 98.85
3lzb_A 327 Epidermal growth factor receptor; epidermal growth 98.84
3g33_A 308 Cell division protein kinase 4; Ser/Thr protein ki 98.84
2psq_A 370 Fibroblast growth factor receptor 2; kinase domain 98.84
3kul_A 325 Ephrin type-A receptor 8; ATP-binding, kinase, nuc 98.84
3s95_A 310 LIMK-1, LIM domain kinase 1; structural genomics, 98.83
2izr_A 330 Casein kinase I isoform gamma-3; serine/threonine- 98.83
3lb7_A 307 RAF proto-oncogene serine/threonine-protein kinas; 98.83
3mi9_A 351 Cell division protein kinase 9; P-TEFB, HIV-1, pro 98.83
3tki_A 323 Serine/threonine-protein kinase CHK1; cell checkpo 98.83
3a62_A 327 Ribosomal protein S6 kinase beta-1; kinase domain, 98.83
1cm8_A 367 Phosphorylated MAP kinase P38-gamma; phosphorylati 98.82
4hgt_A 296 Casein kinase I isoform delta; CK1D, inhibitor, tr 98.82
1csn_A 298 Casein kinase-1; phosphotransferase; HET: ATP; 2.0 98.81
3ugc_A 295 Tyrosine-protein kinase JAK2; small molecule inhib 98.81
3eb0_A 383 Putative uncharacterized protein; kinase cryptospo 98.81
4eqm_A 294 Protein kinase; transferase; HET: ANP; 3.00A {Stap 98.81
2v62_A 345 Serine/threonine-protein kinase VRK2; transferase, 98.81
1vzo_A 355 Ribosomal protein S6 kinase alpha 5; protein kinas 98.81
1ob3_A 288 PFPK5, cell division control protein 2 homolog; tr 98.81
3cbl_A 377 C-FES, proto-oncogene tyrosine-protein kinase FES/ 98.81
3dls_A 335 PAS domain-containing serine/threonine-protein KI; 98.81
4ejn_A 446 RAC-alpha serine/threonine-protein kinase; AKT1, a 98.8
3pls_A 298 Macrophage-stimulating protein receptor; protein k 98.8
2pmi_A 317 Negative RE, cyclin-dependent protein kinase PHO85 98.8
3byv_A 377 Rhoptry kinase; malaria, transferase, structural g 98.8
1nxk_A 400 MAP kinase-activated protein kinase 2; MK2, phosph 98.8
2acx_A 576 G protein-coupled receptor kinase 6; GRK, G transf 98.8
2yab_A 361 Death-associated protein kinase 2; apoptosis, tran 98.8
3q60_A 371 ROP5B; pseudokinase, transferase; HET: ATP; 1.72A 98.8
3f66_A 298 Hepatocyte growth factor receptor; C-Met, protein 98.8
3tt0_A 382 Basic fibroblast growth factor receptor 1; kinase 98.79
1mp8_A 281 Focal adhesion kinase 1; tyrosine protein kinase, 98.79
3qup_A 323 Tyrosine-protein kinase receptor TYRO3; protein ki 98.79
2y94_A 476 5'-AMP-activated protein kinase catalytic subunit; 98.79
3q4u_A 301 Activin receptor type-1; structural genomics conso 98.79
1ua2_A 346 CAK, cell division protein kinase 7; cell cycle, p 98.78
3c1x_A 373 Hepatocyte growth factor receptor; receptor tyrosi 98.78
3sxs_A 268 Cytoplasmic tyrosine-protein kinase BMX; transfera 98.78
1kob_A 387 Twitchin; kinase, intrasteric regulation; 2.30A {A 98.78
3ork_A 311 Serine/threonine protein kinase; structural genomi 98.78
3qd2_B 332 Eukaryotic translation initiation factor 2-alpha; 98.77
2fst_X 367 Mitogen-activated protein kinase 14; active mutant 98.77
4e5w_A 302 Tyrosine-protein kinase JAK1; kinase domain, trans 98.77
3soa_A 444 Calcium/calmodulin-dependent protein kinase type a 98.77
3sv0_A 483 Casein kinase I-like; typical kinase domain fold, 98.77
3mtl_A 324 Cell division protein kinase 16; pctaire1, indirub 98.77
2y0a_A 326 Death-associated protein kinase 1; transferase, ca 98.76
3brb_A 313 Proto-oncogene tyrosine-protein kinase MER; ATP-bi 98.76
3qyz_A 364 Mitogen-activated protein kinase 1; transferase, s 98.76
2qol_A 373 Ephrin receptor; receptor tyrosine kinase, juxtame 98.76
2c30_A 321 Serine/threonine-protein kinase PAK 6; CRIB domain 98.76
3vhe_A 359 Vascular endothelial growth factor receptor 2; kin 98.76
1u5q_A 348 Serine/threonine protein kinase TAO2; transferase; 98.76
2x4f_A 373 Myosin light chain kinase family member 4; LUNG, b 98.76
3uzp_A 296 CKI-delta, CKID, casein kinase I isoform delta; CK 98.75
1zar_A282 RIO2 kinase; serine kinase, winged-helix, RIO doma 98.75
2ivs_A 314 Proto-oncogene tyrosine-protein kinase receptor RE 98.75
3gen_A 283 Tyrosine-protein kinase BTK; bruton'S tyrosine kin 98.75
2qkw_B 321 Protein kinase; three-helix bundle motif, AVRPTO-P 98.75
3c0i_A 351 Peripheral plasma membrane protein CASK; neurexin, 98.75
1u46_A 291 ACK-1, activated CDC42 kinase 1; tyrosine kinase, 98.75
3gni_B 389 Strad alpha; kinase fold, pseudokinase, alpha heli 98.74
3rgf_A 405 Cyclin-dependent kinase 8; protein kinase complex, 98.74
3nsz_A 330 CK II alpha, casein kinase II subunit alpha; inhib 98.74
3dbq_A 343 Dual specificity protein kinase TTK; MPS1 structur 98.74
2jii_A 352 Serine/threonine-protein kinase VRK3 molecule: VA 98.74
4euu_A 319 Serine/threonine-protein kinase TBK1; ATP binding, 98.74
3kn6_A 325 Ribosomal protein S6 kinase alpha-5; AMP-PNP, MSK1 98.74
3lxl_A 327 Tyrosine-protein kinase JAK3; TYK2, inflammation, 98.74
2eue_A 275 Carbon catabolite derepressing protein kinase; kin 98.74
4hcu_A 269 Tyrosine-protein kinase ITK/TSK; transferase-trans 98.74
3soc_A 322 Activin receptor type-2A; structural genomics cons 98.73
1zar_A282 RIO2 kinase; serine kinase, winged-helix, RIO doma 98.73
2owb_A 335 Serine/threonine-protein kinase PLK1; catalytic do 98.73
3fme_A 290 Dual specificity mitogen-activated protein kinase; 98.73
3llt_A 360 Serine/threonine kinase-1, pflammer; lammer kinase 98.73
3m2w_A 299 MAP kinase-activated protein kinase 2; small molec 98.73
3uc3_A 361 Serine/threonine-protein kinase SRK2I; SNRK2, ABA 98.73
3pg1_A 362 Mitogen-activated protein kinase, putative (MAP K 98.73
1rjb_A 344 FL cytokine receptor; kinase, structure, autoinhib 98.73
4agu_A 311 Cyclin-dependent kinase-like 1; transferase, phosp 98.73
3og7_A 289 AKAP9-BRAF fusion protein; proto-oncogene, V600E, 98.72
3cc6_A 281 Protein tyrosine kinase 2 beta; focal adhesion kin 98.72
2bdw_A 362 Hypothetical protein K11E8.1D; kinase, calmodulin 98.72
2ozo_A 613 Tyrosine-protein kinase ZAP-70; inactive ZAP-70, t 98.72
3mdy_A 337 Bone morphogenetic protein receptor type-1B; compl 98.72
3g2f_A 336 Bone morphogenetic protein receptor type-2; kinase 98.72
2b9h_A 353 MAP kinase FUS3, mitogen-activated protein kinase 98.72
2rku_A 294 Serine/threonine-protein kinase PLK1; structure of 98.72
1u59_A 287 Tyrosine-protein kinase ZAP-70; transferase; HET: 98.72
2xrw_A 371 Mitogen-activated protein kinase 8; transcription, 98.72
2a19_B 284 Interferon-induced, double-stranded RNA-activated 98.72
1luf_A 343 Muscle-specific tyrosine kinase receptor MUSK; pho 98.71
2y7j_A 365 Phosphorylase B kinase gamma catalytic chain, test 98.71
1t46_A 313 HOMO sapiens V-KIT hardy-zuckerman 4 feline sarcom 98.71
2zmd_A 390 Dual specificity protein kinase TTK; MPS1, T686A, 98.71
3cok_A 278 Serine/threonine-protein kinase PLK4; POLO-like ki 98.71
2qr7_A 342 Ribosomal protein S6 kinase alpha-3; kinase domain 98.71
3uim_A 326 Brassinosteroid insensitive 1-associated receptor; 98.71
3a99_A 320 Proto-oncogene serine/threonine-protein kinase PI; 98.71
3kvw_A 429 DYRK2, dual specificity tyrosine-phosphorylation-r 98.7
1mqb_A 333 Ephrin type-A receptor 2; tyrosine protein kinase, 98.7
2w1i_A 326 JAK2; chromosomal rearrangement, nucleotide-bindin 98.69
3l9p_A 367 Anaplastic lymphoma kinase; kinase domain, ATP-bin 98.69
1xbb_A 291 Tyrosine-protein kinase SYK; gleevec, STI-571, ima 98.68
3ll6_A 337 Cyclin G-associated kinase; transferase, protein k 98.68
4fvq_A 289 Tyrosine-protein kinase JAK2; janus protein kinase 98.68
3f3z_A 277 Calcium/calmodulin-dependent protein kinase with d 98.68
1qcf_A 454 Haematopoetic cell kinase (HCK); tyrosine kinase-i 98.68
4aaa_A 331 Cyclin-dependent kinase-like 2; transferase, phosp 98.68
4eut_A 396 Serine/threonine-protein kinase TBK1; ATP binding, 98.68
4fl3_A 635 Tyrosine-protein kinase SYK; transferase; HET: ANP 98.68
4f0f_A287 Serine/threonine-protein kinase ROCO4; LRRK2, ATP- 98.68
1qpc_A 279 LCK kinase; alpha beta fold, transferase; HET: PTR 98.68
3an0_A 340 Dual specificity mitogen-activated protein kinase; 98.68
3i6u_A 419 CDS1, serine/threonine-protein kinase CHK2; Ser/Th 98.68
1x8b_A289 WEE1HU, WEE1-like protein kinase; cell cycle, tran 98.68
3lxp_A 318 Non-receptor tyrosine-protein kinase TYK2; JAK3, i 98.67
1p4o_A 322 Insulin-like growth factor I receptor protein; IGF 98.67
2buj_A 317 Serine/threonine-protein kinase 16; transferase, A 98.67
2yex_A 276 Serine/threonine-protein kinase CHK1; transferase, 98.67
4exu_A 371 Mitogen-activated protein kinase 13; P38 kinase, t 98.67
3fdn_A 279 Serine/threonine-protein kinase 6; aurora kinase i 98.67
2pvf_A 334 Fibroblast growth factor receptor 2; kinase domain 98.67
3lm5_A 327 Serine/threonine-protein kinase 17B; STK17B, serin 98.67
1blx_A 326 Cyclin-dependent kinase 6; inhibitor protein, cycl 98.67
1opk_A 495 P150, C-ABL, proto-oncogene tyrosine-protein kinas 98.67
3is5_A285 Calcium-dependent protein kinase; CDPK, structural 98.66
3e3p_A 360 Protein kinase, putative glycogen synthase kinase; 98.66
2i1m_A 333 Macrophage colony-stimulating factor 1 receptor; k 98.66
2xir_A 316 Vascular endothelial growth factor receptor 2; ang 98.66
2ac3_A 316 MAP kinase-interacting serine/threonine kinase 2; 98.66
1zy4_A 303 Serine/threonine-protein kinase GCN2; translation 98.66
2nru_A 307 Interleukin-1 receptor-associated kinase 4; inhibi 98.66
3gbz_A 329 Kinase, CMGC CDK; ssgcid, ATP-binding, nucleotide- 98.66
3coi_A 353 Mitogen-activated protein kinase 13; P38D, P38delt 98.65
2vgo_A 284 Serine/threonine-protein kinase 12-A; nucleotide-b 98.65
2eu9_A 355 Dual specificity protein kinase CLK3; kinase domai 98.65
1fvr_A 327 Tyrosine-protein kinase TIE-2; tyrosine kinase, tr 98.65
3p86_A 309 Serine/threonine-protein kinase CTR1; ETR1, ERS1, 98.65
3t9t_A 267 Tyrosine-protein kinase ITK/TSK; kinase domain, al 98.64
2wtk_C 305 Serine/threonine-protein kinase 11; transferase-me 98.64
2w4o_A 349 Calcium/calmodulin-dependent protein kinase type I 98.64
1wak_A 397 Serine/threonine-protein kinase SPRK1; SRPK, trans 98.64
1phk_A 298 Phosphorylase kinase; glycogen metabolism, transfe 98.64
1k9a_A 450 Carboxyl-terminal SRC kinase; COOH-terminal SRC ki 98.64
2a2a_A 321 Death-associated protein kinase 2; autoinhibition, 98.64
1z57_A 339 Dual specificity protein kinase CLK1; protein tyro 98.63
1fmk_A 452 C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyros 98.63
2iwi_A 312 Serine/threonine-protein kinase PIM-2; nucleotide- 98.63
3a7i_A 303 MST3 kinase, serine/threonine kinase 24 (STE20 hom 98.63
2ycf_A 322 Serine/threonine-protein kinase CHK2; transferase, 98.63
3lij_A 494 Calcium/calmodulin dependent protein kinase with A 98.63
2vwi_A 303 Serine/threonine-protein kinase OSR1; STE kinase, 98.62
3nyv_A 484 Calmodulin-domain protein kinase 1; serine/threoni 98.62
3kk8_A 284 Calcium/calmodulin dependent protein kinase II; AT 98.62
2i6l_A 320 Mitogen-activated protein kinase 6; MAPK6, ERK3, e 98.62
3kfa_A 288 Tyrosine-protein kinase ABL1; CML, drug resistance 98.62
2j0j_A 656 Focal adhesion kinase 1; cell migration, FERM, tra 98.62
1zth_A258 RIO1 serine protein kinase; ribosome biogenesis, r 98.61
3mwu_A 486 Calmodulin-domain protein kinase 1; serine/threoni 98.61
2x7f_A 326 TRAF2 and NCK-interacting protein kinase; serine/t 98.61
3com_A 314 Serine/threonine-protein kinase 4; MST1, STE20-lik 98.6
1byg_A 278 CSK, protein (C-terminal SRC kinase); protein kina 98.6
2wqm_A 310 Serine/threonine-protein kinase NEK7; ATP-binding, 98.59
2r3i_A 299 Cell division protein kinase 2; serine/threonine-p 98.59
3q5i_A 504 Protein kinase; CDPK, malaria, phosphotransferase, 98.59
2h34_A 309 Serine/threonine-protein kinase PKNE; apoenzyme, t 98.59
3fhr_A 336 MAP kinase-activated protein kinase 3; kinase-inhi 98.59
2h6d_A 276 5'-AMP-activated protein kinase catalytic subunit 98.59
2h8h_A 535 Proto-oncogene tyrosine-protein kinase SRC; SRC ki 98.58
1b6c_B 342 TGF-B superfamily receptor type I; complex (isomer 98.57
2y4i_B 319 KSR2, HKSR2, kinase suppressor of RAS 2; transfera 98.57
3bhy_A 283 Death-associated protein kinase 3; death associate 98.57
3hko_A 345 Calcium/calmodulin-dependent protein kinase with d 98.56
1q8y_A 373 SR protein kinase; transferase; HET: ADP ADE; 2.05 98.55
3dtc_A271 Mitogen-activated protein kinase kinase kinase 9; 98.55
1t4h_A290 Serine/threonine-protein kinase WNK1; protein seri 98.55
2pml_X 348 PFPK7, Ser/Thr protein kinase; phosphorylati trans 98.54
3cek_A 313 Dual specificity protein kinase TTK; HMPS1, PYT, E 98.54
3p23_A 432 Serine/threonine-protein kinase/endoribonuclease; 98.54
2j7t_A 302 Serine/threonine-protein kinase 10; transferase, A 98.54
3aln_A 327 Dual specificity mitogen-activated protein kinase; 98.53
2vx3_A 382 Dual specificity tyrosine-phosphorylation- regula 98.53
2clq_A 295 Mitogen-activated protein kinase kinase kinase 5; 98.52
2w5a_A 279 Serine/threonine-protein kinase NEK2; Ser/Thr prot 98.5
2rio_A 434 Serine/threonine-protein kinase/endoribonuclease I 98.5
2dyl_A 318 Dual specificity mitogen-activated protein kinase 98.49
3en9_A540 Glycoprotease, O-sialoglycoprotein endopeptidase/p 98.49
3gxj_A 303 TGF-beta receptor type-1; ALK5, kinase, inhibitor, 98.49
2pzi_A 681 Probable serine/threonine-protein kinase PKNG; ATP 98.49
2jam_A 304 Calcium/calmodulin-dependent protein kinase type 1 98.49
>4aw0_A HPDK1, 3-phosphoinositide-dependent protein kinase 1; transferase, allosteric regulation, allosteric site, phosphorylation, AGC protein kinase; HET: SEP ATP MJF; 1.43A {Homo sapiens} PDB: 3hrc_A* 3hrf_A* 4a06_A* 4a07_A* 3rcj_A* 4aw1_A* 3rwq_A* 3sc1_A* 3qd0_A* 2r7b_A* 3ion_A* 3qcq_A* 3qcs_A* 3qcx_A* 3qcy_A* 3iop_A* 3qd3_A* 3qd4_A* 3h9o_A* 1uu3_A* ... Back     alignment and structure
Probab=100.00  E-value=2.4e-50  Score=343.16  Aligned_cols=198  Identities=23%  Similarity=0.463  Sum_probs=171.5

Q ss_pred             hhHHHHHhcCCCCCccceeEEEEcCCeEEEEEeccCCCCHHHHHHHhcCCCCCCCcCchhH-HHHHHHHHHhhhhCCcee
Q psy6191           2 SQEIAIHRSLKHRNVVGFHSFFEDSKFVYIILELCRKRSMMELYNSACDLEEMSDPAAQPV-IWVSKWVDYSDKYGFGYQ   80 (305)
Q Consensus         2 ~~Ei~il~~l~HpnIV~l~~~~~~~~~~ylVmEy~~~g~L~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~   80 (305)
                      .+|+++|++|+|||||+++++|++++.+|||||||+||+|.+++.+.+.+   .+..+..+ .++..++.|+|..++.|+
T Consensus        80 ~~E~~il~~l~HpnIv~l~~~~~~~~~~yivmEy~~gG~L~~~i~~~~~l---~e~~~~~~~~qi~~al~ylH~~~IiHR  156 (311)
T 4aw0_A           80 TRERDVMSRLDHPFFVKLYFTFQDDEKLYFGLSYAKNGELLKYIRKIGSF---DETCTRFYTAEIVSALEYLHGKGIIHR  156 (311)
T ss_dssp             HHHHHHHTTCCCTTBCCEEEEEECSSEEEEEECCCTTEEHHHHHHHHSSC---CHHHHHHHHHHHHHHHHHHHHTTEECS
T ss_pred             HHHHHHHHhCCCCCCCeEEEEEEeCCEEEEEEecCCCCCHHHHHHHcCCC---CHHHHHHHHHHHHHHHHHHHHCCCccC
Confidence            58999999999999999999999999999999999999999999877655   33333333 345788999998876543


Q ss_pred             -------ecCCCCCeeEcchhHHHHhc------CCcccccCCCcccccccccCCCCccchHHHHHHHHHHHHhCCCCCCC
Q psy6191          81 -------LNDDSSGVMFNDLTRMIMLA------NKNTLCGTPNYIAPEILNKNGHSFEVDVWSIGCIMYTLLVGKPPFET  147 (305)
Q Consensus        81 -------~~~~~~~v~~~d~~~~~~~~------~~~~~~Gt~~y~aPE~~~~~~~~~~~DiwSlGvilye~l~g~~Pf~~  147 (305)
                             +.+..+.+++.||+.+..+.      ...++||||.|||||++.+..|+.++||||+||++|||++|++||.+
T Consensus       157 DlKPeNILl~~~g~vKl~DFGla~~~~~~~~~~~~~~~~GTp~YmAPEvl~~~~y~~~~DiWSlGvilyeml~G~~PF~~  236 (311)
T 4aw0_A          157 DLKPENILLNEDMHIQITDFGTAKVLSPESKQARANSFVGTAQYVSPELLTEKSACKSSDLWALGCIIYQLVAGLPPFRA  236 (311)
T ss_dssp             CCSGGGEEECTTSCEEECCCTTCEECCTTTTCCCBCCCCSCGGGCCHHHHHHSCBCHHHHHHHHHHHHHHHHHSSCSSCC
T ss_pred             CCCHHHeEEcCCCCEEEEEcCCceecCCCCCcccccCcccCcccCCHHHHcCCCCCcHHHHHHHHHHHHHHHhCCCCCCC
Confidence                   33455788999998665432      23578999999999999999999999999999999999999999999


Q ss_pred             CCHHHHHHHHhccccCCCCCCCHHHHHHHHHHhhcCCCCCCCHhh------hhcCcccccc
Q psy6191         148 STLKETYSRIKKVEYKLPATLKKPAATMIKKMLLLDPVQRPPVAQ------LLHFEFFNDY  202 (305)
Q Consensus       148 ~~~~~~~~~i~~~~~~~~~~~~~~~~~li~~~l~~dp~~R~~~~~------~l~~~~~~~~  202 (305)
                      .+..+++.+|.+..+.+|..+++++++||.+||++||.+|+|++|      +++||||++.
T Consensus       237 ~~~~~~~~~i~~~~~~~p~~~s~~~~dli~~lL~~dp~~R~t~~e~~~~~~i~~Hp~F~~i  297 (311)
T 4aw0_A          237 GNEGLIFAKIIKLEYDFPEKFFPKARDLVEKLLVLDATKRLGCEEMEGYGPLKAHPFFESV  297 (311)
T ss_dssp             SSHHHHHHHHHHTCCCCCTTCCHHHHHHHHHHSCSSGGGSTTSGGGTCHHHHHTSGGGTTC
T ss_pred             CCHHHHHHHHHcCCCCCCcccCHHHHHHHHHHccCCHhHCcChHHHcCCHHHHCCCCcCCC
Confidence            999999999999999999999999999999999999999999998      4789999863



>4fih_A Serine/threonine-protein kinase PAK 4; kinase domain, protein ATP binding, phosphorylation, transferase; HET: SEP; 1.97A {Homo sapiens} PDB: 4fig_A* 4fif_A* 4fii_A* 4fij_A* Back     alignment and structure
>3ubd_A Ribosomal protein S6 kinase alpha-3; kinase-inhibitor complex, induced FIT, transferase-transfera inhibitor complex; HET: SL0; 1.53A {Mus musculus} PDB: 4el9_A* 3g51_A* 2z7q_A* 2z7r_A* 2z7s_A* Back     alignment and structure
>4b9d_A Serine/threonine-protein kinase NEK1; transferase, inhibitor; HET: CK7; 1.90A {Homo sapiens} PDB: 4apc_A* Back     alignment and structure
>3hyh_A Carbon catabolite-derepressing protein kinase; kinase domain, transferase, ATP-binding, carbohydrate metabo kinase, membrane; 2.20A {Saccharomyces cerevisiae} PDB: 3dae_A 2fh9_A 3mn3_A Back     alignment and structure
>4fie_A Serine/threonine-protein kinase PAK 4; kinase domain, protein ATP binding, phosphorylation, transferase; HET: SEP ANP; 3.11A {Homo sapiens} Back     alignment and structure
>3fpq_A Serine/threonine-protein kinase WNK1; protein serine/threonine kinase, transferase, ATP-BIND kinase, nucleotide-binding, phosphoprotein; 1.80A {Rattus norvegicus} Back     alignment and structure
>4g3f_A NF-kappa-beta-inducing kinase; non-RD kinase, protein serine/threonine kinase, S based drug design, MAP3K14, transferase; HET: 0WB; 1.64A {Mus musculus} PDB: 4g3g_A* 4g3c_A 4dn5_A* Back     alignment and structure
>3v5w_A G-protein coupled receptor kinase 2; inhibitor complex, protein kinase, beta propeller, RGS homol domain; HET: 8PR; 2.07A {Homo sapiens} PDB: 3cik_A* 3krw_A* 3krx_A* 1omw_A 1ym7_A 2bcj_A* 3uzs_A 3uzt_A 3pvu_A* 3psc_A* 3pvw_A* 1bak_A Back     alignment and structure
>4b99_A Mitogen-activated protein kinase 7; transferase, inhibitor; HET: R4L; 2.80A {Homo sapiens} Back     alignment and structure
>3uto_A Twitchin; kinase, muscle sarcomere, transferase; HET: FLC P33; 2.40A {Caenorhabditis elegans} PDB: 1koa_A Back     alignment and structure
>4g31_A Eukaryotic translation initiation factor 2-alpha; deletion mutant, catalytic domain, synthetic inhibitor, TRAN transferase inhibitor complex; HET: 0WH; 2.28A {Homo sapiens} PDB: 4g34_A* Back     alignment and structure
>4asz_A BDNF/NT-3 growth factors receptor; transferase, TRKA, TRKB; 1.70A {Homo sapiens} PDB: 4at3_A* 4at4_A* 4at5_A* 3v5q_A* Back     alignment and structure
>4f9c_A Cell division cycle 7-related protein kinase; Ser/Thr protein kinase, transferase, phosphorylation, cell C cell division, mitosis, S phase; HET: 0SX; 2.08A {Homo sapiens} PDB: 4f99_A* 4f9b_A* 4f9a_A* Back     alignment and structure
>4aoj_A High affinity nerve growth factor receptor; transferase, inhibitor; HET: V4Z; 2.75A {Homo sapiens} Back     alignment and structure
>4gt4_A Tyrosine-protein kinase transmembrane receptor RO; ATP binding, phosphorylation, transferase; 2.41A {Homo sapiens} PDB: 3zzw_A Back     alignment and structure
>3omv_A RAF proto-oncogene serine/threonine-protein kinas; serine/threonine-protein kinase, transferase; HET: SM5; 4.00A {Homo sapiens} Back     alignment and structure
>3fe3_A MAP/microtubule affinity-regulating kinase 3; serine/threonine protein kinase, MARK;PAR-1, UBA domai TAK1;P78;MARK3, ATP-binding; 1.90A {Homo sapiens} PDB: 2qnj_A 1y8g_A* 1zmw_A 1zmu_A 1zmv_A 2wzj_A 2r0i_A 2hak_A 3iec_A Back     alignment and structure
>1o6l_A RAC-beta serine/threonine protein kinase; protein kinase, transferase, serine/threonine-protein kinase; HET: TPO ANP; 1.6A {Homo sapiens} SCOP: d.144.1.7 PDB: 2jdo_A* 2jdr_A* 2uw9_A* 2x37_A* 2x39_A* 2xh5_A* 3d0e_A* 3e87_A* 3e88_A* 3e8d_A* 1o6k_A* 1mrv_A 1mry_A 1gzn_A 1gzk_A 1gzo_A 3qkl_A* 3ocb_A* 3ow4_A* 3qkk_A* ... Back     alignment and structure
>2yab_A Death-associated protein kinase 2; apoptosis, transferase; HET: AMP; 1.90A {Mus musculus} PDB: 2yaa_A* 2ya9_A* Back     alignment and structure
>4ase_A Vascular endothelial growth factor receptor 2; transferase, angiogenesis, signaling protein, phosphorylatio receptor, inhibitor; HET: AV9; 1.83A {Homo sapiens} PDB: 4agd_A* 4asd_A* 4agc_A* Back     alignment and structure
>1fot_A TPK1 delta, CAMP-dependent protein kinase type 1; open conformation, transferase; HET: TPO; 2.80A {Saccharomyces cerevisiae} SCOP: d.144.1.7 Back     alignment and structure
>3txo_A PKC-L, NPKC-ETA, protein kinase C ETA type; phosphotransferase, transferase-transferase inhibito; HET: TPO 07U; 2.05A {Homo sapiens} Back     alignment and structure
>1xjd_A Protein kinase C, theta type; PKC-theta, ATP, AMP,, transferase; HET: TPO SEP STU; 2.00A {Homo sapiens} SCOP: d.144.1.7 PDB: 2jed_A* Back     alignment and structure
>1rdq_E PKA C-alpha, CAMP-dependent protein kinase, alpha-catalytic SU; CAMP-dependent protein kinase,catalytic mechanism, ATP hydro two nucleotide states; HET: TPO SEP ADP ATP; 1.26A {Mus musculus} SCOP: d.144.1.7 PDB: 2erz_E* 3fjq_E* 1bkx_A* 1atp_E* 1fmo_E* 1j3h_A* 1jlu_E* 1bx6_A* 1re8_A* 1rej_A* 1rek_A* 2cpk_E* 2qcs_A* 2qvs_E* 1l3r_E* 3idb_A* 3idc_A* 3o7l_D* 3ow3_A* 3tnp_C* ... Back     alignment and structure
>3soa_A Calcium/calmodulin-dependent protein kinase type alpha with A beta 7 linker; phosphorylation, cytosolic, transferase-transferase inhibitor complex; HET: DB8; 3.55A {Homo sapiens} Back     alignment and structure
>2i0e_A Protein kinase C-beta II; serine/threonine protein kinase, transferase; HET: TPO SEP PDS; 2.60A {Homo sapiens} PDB: 3iw4_A* Back     alignment and structure
>4dc2_A Protein kinase C IOTA type; kinase, substrate, cell polarity, atypical PKC, trans transferase substrate complex; HET: TPO ADE; 2.40A {Mus musculus} Back     alignment and structure
>3a8x_A Protein kinase C IOTA type; transferase; HET: TPO; 2.00A {Homo sapiens} PDB: 3a8w_A* 1zrz_A* Back     alignment and structure
>3a62_A Ribosomal protein S6 kinase beta-1; kinase domain, inactive, active, ribosomal S6 kinase, activation, alternative initiation, ATP-binding; HET: TPO STU; 2.35A {Homo sapiens} PDB: 3a61_A* 3a60_A* Back     alignment and structure
>3h4j_B AMPK kdaid, SNF1-like protein kinase SSP2; ATP-binding, nucleotide-binding, phosphoprotei serine/threonine-protein kinase, transferase; 2.80A {Schizosaccharomyces pombe} Back     alignment and structure
>2bdw_A Hypothetical protein K11E8.1D; kinase, calmodulin activated, transferase; 1.80A {Caenorhabditis elegans} PDB: 2wel_A* 2v7o_A* 2vz6_A* 1cdm_B 1cm1_B 1cm4_B Back     alignment and structure
>2y0a_A Death-associated protein kinase 1; transferase, calmodulin, esprit; HET: MES; 2.60A {Homo sapiens} Back     alignment and structure
>3fxz_A Serine/threonine-protein kinase PAK 1; transferase, ATP-binding, phosphorylation, allosteric enzyme, alternative splicing, apoptosis, cell junction; HET: TPO FLL; 1.64A {Homo sapiens} SCOP: d.144.1.7 PDB: 3fy0_A* 4daw_A* 3q52_A* 3q53_A* 1yhw_A 1f3m_C 1yhv_A 2hy8_1* 3q4z_A* Back     alignment and structure
>4fr4_A YANK1, serine/threonine-protein kinase 32A; structural genomics, structural genomics consortium, SGC, TR; HET: STU; 2.29A {Homo sapiens} Back     alignment and structure
>3v8s_A RHO-associated protein kinase 1; dimerization, myosin, transferase, inhibitor, transf transferase inhibitor complex; HET: 0HD; 2.29A {Homo sapiens} PDB: 3twj_A* 3tv7_A* 2etr_A* 2esm_A* 2eto_A* 2etk_A* 3d9v_A* 3ncz_A* 3ndm_A* 2v55_A* 2f2u_A* 2h9v_A* Back     alignment and structure
>2r5t_A Serine/threonine-protein kinase SGK1; AGC protein kinase, apoptosis, ATP-binding, cytoplasm, endoplasmic reticulum, nucleotide-binding, nucleus; HET: ANP; 1.90A {Homo sapiens} PDB: 3hdm_A* 3hdn_A* Back     alignment and structure
>2y94_A 5'-AMP-activated protein kinase catalytic subunit; transferase, nucleotide-binding, staurosporine-binding, serine/threonine-protein kinase; HET: TPO STU AMP; 3.24A {Rattus norvegicus} Back     alignment and structure
>1tki_A Titin; serine kinase, muscle, autoinhibition; 2.00A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>2qr7_A Ribosomal protein S6 kinase alpha-3; kinase domain, RSK2, autoinhibitory, ATP-binding, nucleotide phosphorylation, serine/threonine-protein kinase; 2.00A {Mus musculus} PDB: 2qr8_A 4d9t_A* 4d9u_A* 3rny_A 2wnt_A Back     alignment and structure
>4ejn_A RAC-alpha serine/threonine-protein kinase; AKT1, autoinhibition, allosteric inhibitor, kinase inhibitor hydrophobic collapase, ATPase; HET: 0R4; 2.19A {Homo sapiens} PDB: 3o96_A* Back     alignment and structure
>3c0i_A Peripheral plasma membrane protein CASK; neurexin, Ca2+/calmodulin dependent protein kinase, Mg synaptic plasticity, pseudokinase, maguk; HET: 3AM; 1.85A {Homo sapiens} PDB: 3c0h_A* 3c0g_A* 3mfr_A* 3mfs_A* 3mft_A 3mfu_A* 3tac_A Back     alignment and structure
>3gni_B Strad alpha; kinase fold, pseudokinase, alpha helical repeat protein, ADA protein, ATP-binding, cell cycle, kinase, nucleotide-bindin nucleus; HET: ATP CIT; 2.35A {Homo sapiens} PDB: 2wtk_B* Back     alignment and structure
>3uc3_A Serine/threonine-protein kinase SRK2I; SNRK2, ABA signaling, transferase; 1.90A {Arabidopsis thaliana} PDB: 3zut_A 3zuu_A 3uc4_A 3ujg_A 3udb_A Back     alignment and structure
>4aw2_A Serine/threonine-protein kinase MRCK alpha; transferase, CDC42BPA; HET: 22E; 1.70A {Rattus norvegicus} PDB: 3tku_A* 3qfv_A* Back     alignment and structure
>2acx_A G protein-coupled receptor kinase 6; GRK, G transferase; HET: ANP; 2.60A {Homo sapiens} PDB: 3nyn_A* 3nyo_A* Back     alignment and structure
>2owb_A Serine/threonine-protein kinase PLK1; catalytic domain, POLO-like kinase1, transfera; HET: 626; 2.10A {Homo sapiens} PDB: 2ou7_A* 3fc2_A* 3thb_A* Back     alignment and structure
>2vgo_A Serine/threonine-protein kinase 12-A; nucleotide-binding, serine/threonine-protein kinase, ATP-binding, transferase, coiled coil, cell division, kinase; HET: TPO AD5; 1.7A {Xenopus laevis} PDB: 2bfx_A* 2vgp_A* 3ztx_A* 2vrx_A* 2bfy_A* 4af3_A* 3dj6_A* 3d15_A* 3d2i_A* 3d2k_A* 3d14_A* 3dj5_A* 3dj7_A* 3daj_A* 1ol5_A* 1ol7_A* 2x6d_A* 2x6e_A* 2xng_A* 2dwb_A* ... Back     alignment and structure
>2rku_A Serine/threonine-protein kinase PLK1; structure of PLK1, selectivity residues, POLO-like K structure based drug design, ATP-binding; HET: R78 TLA SRT TAR; 1.95A {Homo sapiens} PDB: 2v5q_A 2yac_A* 4a4l_A* 4a4o_A* 3kb7_A* 3d5w_A* 3d5u_A* 3d5v_A 3db8_A* 3dbc_A* 3dbd_A* 3d5x_A* 3db6_A* 3dbe_A* 3dbf_A* Back     alignment and structure
>3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} Back     alignment and structure
>3pfq_A PKC-B, PKC-beta, protein kinase C beta type; phosphorylation, transferase; HET: TPO SEP ANP; 4.00A {Rattus norvegicus} PDB: 1tbn_A 1tbo_A 2e73_A Back     alignment and structure
>2x4f_A Myosin light chain kinase family member 4; LUNG, breast cancer, transferase, serine/threonine-protein kinase, nucleotide-binding; HET: 16X 1PE; 2.67A {Homo sapiens} Back     alignment and structure
>1kob_A Twitchin; kinase, intrasteric regulation; 2.30A {Aplysia californica} SCOP: d.144.1.7 Back     alignment and structure
>3fdn_A Serine/threonine-protein kinase 6; aurora kinase inhibitors, virtual screening, X-RAY CO- crystal analysis, structure-based drug design (SBDD); HET: MMH; 1.90A {Homo sapiens} SCOP: d.144.1.7 PDB: 3k5u_A* 3m11_A* 2c6e_A* 1muo_A* 2bmc_A* 2j4z_A* 1ol6_A* 3up2_A* 3unz_A* 3uo5_A* 3uo6_A* 3uod_A* 3uoh_A* 3uoj_A* 3uok_A* 3uo4_A* 3uol_A* 3up7_A* 4dea_A* 4deb_A* ... Back     alignment and structure
>2vd5_A DMPK protein; serine/threonine-protein kinase, kinase, transferase, ATP-BI nucleotide-binding, cardiac contractility, muscle different; HET: BI8; 2.80A {Homo sapiens} Back     alignment and structure
>3kn6_A Ribosomal protein S6 kinase alpha-5; AMP-PNP, MSK1, MSK, ATP-binding, metal-binding, NUCL binding, serine/threonine-protein kinase, transferase; 2.00A {Homo sapiens} PDB: 3kn5_A Back     alignment and structure
>3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* Back     alignment and structure
>3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* Back     alignment and structure
>3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* Back     alignment and structure
>2pmi_A Negative RE, cyclin-dependent protein kinase PHO85; cyclin-dependent kinase, signaling protein,transfera cycle complex; HET: MES AGS; 2.90A {Saccharomyces cerevisiae} PDB: 2pk9_A* Back     alignment and structure
>3c4z_A Rhodopsin kinase; Ser/Thr kinase, RGS homology domain, G protein coupled recep kinase, GRK, GRK1, P-loop, autophosphoryl ADP, ATP-binding; HET: ADP; 1.84A {Bos taurus} PDB: 3c4x_A* 3c4y_A 3c4w_A* 3c50_A* 3c51_A* 3qc9_A* 2i94_B Back     alignment and structure
>2a2a_A Death-associated protein kinase 2; autoinhibition, transferase; 1.47A {Homo sapiens} PDB: 2cke_A* 1wmk_A 1z9x_A 2a27_A 2x0g_A 2xuu_A* 2w4k_A* 2xzs_A Back     alignment and structure
>2w4o_A Calcium/calmodulin-dependent protein kinase type IV; calmodulin-binding, nucleotide-binding, serine/threonine-protein kinase, ATP-binding; HET: DKI; 2.17A {Homo sapiens} Back     alignment and structure
>3f3z_A Calcium/calmodulin-dependent protein kinase with domain and 4 calmodulin like EF...; calcium dependent protein kinase; HET: SEP DRK; 1.84A {Cryptosporidium parvum iowa II} PDB: 2qg5_A* Back     alignment and structure
>3hmm_A TGF-beta receptor type-1; ALK5, kinase, inhibitor, quinazoline, aortic aneurysm, ATP-binding, craniosynostosis, disease mutation, disulfide bond; HET: 855; 1.70A {Homo sapiens} PDB: 1vjy_A* 3gxl_A* 3tzm_A* 2wot_A* 2wou_A* 1py5_A* 1rw8_A* Back     alignment and structure
>2zv2_A Calcium/calmodulin-dependent protein kinase kinas; beta, camkk2, E.C.2.7.11.17, phosphorylation, AMPKK, metabolism, binding, calmodulin-binding; HET: 609; 2.40A {Homo sapiens} Back     alignment and structure
>3kk8_A Calcium/calmodulin dependent protein kinase II; ATP-binding, nucleotide-binding, serine/threonine-protein kinase, transferase; HET: TPO; 1.72A {Caenorhabditis elegans} PDB: 3kk9_A* 3kl8_A 2vn9_A* 3bhh_A* Back     alignment and structure
>3niz_A Rhodanese family protein; structural genomics, structural genomics consortium, SGC, phosphotransferase, cyclin dependent kinase; HET: ADP; 2.40A {Cryptosporidium parvum} SCOP: d.144.1.7 PDB: 2qkr_A* Back     alignment and structure
>2ac3_A MAP kinase-interacting serine/threonine kinase 2; DFD motif, transferase; 2.10A {Homo sapiens} PDB: 2hw7_A* 2ac5_A* 2hw6_A Back     alignment and structure
>1ob3_A PFPK5, cell division control protein 2 homolog; transferase, serine/threonine-protein kinase, ATP-binding, phosphorylation, CDK; 1.9A {Plasmodium falciparum} SCOP: d.144.1.7 PDB: 1v0p_A* 1v0o_A* 1v0b_A Back     alignment and structure
>3o0g_A Cell division protein kinase 5; kinase activator complex, kinase inhibitor complex, transferase-transferase activator complex; HET: 3O0; 1.95A {Homo sapiens} SCOP: d.144.1.7 PDB: 1unh_A* 1ung_A* 1unl_A* 1h4l_A Back     alignment and structure
>2h6d_A 5'-AMP-activated protein kinase catalytic subunit alpha-2; ATP-binding, cholesterol biosynthesis, fatty acid biosynthesis;kinase, lipid synthesis; 1.85A {Homo sapiens} PDB: 3aqv_A* 2yza_A* Back     alignment and structure
>2c30_A Serine/threonine-protein kinase PAK 6; CRIB domain, ATP-binding, transferase, nucleotide-binding; HET: SEP; 1.6A {Homo sapiens} PDB: 2f57_A* 2j0i_A* 2cdz_A* 2q0n_A* 2x4z_A* 2bva_A* Back     alignment and structure
>3tki_A Serine/threonine-protein kinase CHK1; cell checkpoint, transferase-transferase inhib complex; HET: S25; 1.60A {Homo sapiens} PDB: 2qhm_A* 2r0u_A* 3tkh_A* 2qhn_A* 2hy0_A* 2hog_A* 2hxq_A* 2hxl_A* 3f9n_A* Back     alignment and structure
>2jam_A Calcium/calmodulin-dependent protein kinase type 1G; transferase, kinase, membrane, ATP-binding, prenylation, serine/threonine-protein kinase, alternative splicing; HET: J60; 1.7A {Homo sapiens} PDB: 2jc6_A* 1a06_A Back     alignment and structure
>3cok_A Serine/threonine-protein kinase PLK4; POLO-like kinase 4, SAK, STK18, PSI, structural genomics, protein structure initiative; HET: ANP; 2.25A {Homo sapiens} Back     alignment and structure
>3gbz_A Kinase, CMGC CDK; ssgcid, ATP-binding, nucleotide-binding, serine/threonine-protein kinase, transferase; 1.85A {Giardia lamblia} PDB: 3gc0_A* Back     alignment and structure
>1nxk_A MAP kinase-activated protein kinase 2; MK2, phosphorylation, staurosporine, transfe; HET: STU; 2.70A {Homo sapiens} SCOP: d.144.1.7 PDB: 1kwp_A* 1ny3_A* 2onl_C Back     alignment and structure
>3is5_A Calcium-dependent protein kinase; CDPK, structural genomics, parasitology, structural genomics consortium, SGC, ATP-binding, nucleotide-binding; HET: ANP; 2.55A {Toxoplasma gondii} Back     alignment and structure
>3hko_A Calcium/calmodulin-dependent protein kinase with domain and 2 calmodulin-like EF...; structural genomics, protist parasite; HET: ANP; 1.80A {Cryptosporidium parvum iowa II} Back     alignment and structure
>3oz6_A Mitogen-activated protein kinase 1, serine/threon protein kinase; structural genomics consortium, SGC, transferase; 2.37A {Cryptosporidium parvum iowa II} Back     alignment and structure
>1u5q_A Serine/threonine protein kinase TAO2; transferase; HET: SEP; 2.10A {Rattus norvegicus} SCOP: d.144.1.7 PDB: 1u5r_A* 2gcd_A* Back     alignment and structure
>2y7j_A Phosphorylase B kinase gamma catalytic chain, testis/liver isoform; transferase; HET: B49; 2.50A {Homo sapiens} PDB: 1h0t_A 1lp1_B 1q2n_A 2spz_A 3mzw_B* 1ss1_A 2jwd_A 1bdc_A 1bdd_A 1fc2_C* 2b87_A 2b88_A 1h0t_B 1lp1_A 2b87_B 2b89_A 3s1k_A Back     alignment and structure
>3mtl_A Cell division protein kinase 16; pctaire1, indirubin, structural genomics, structural consortium, SGC, transferase; HET: FEF; 2.40A {Homo sapiens} Back     alignment and structure
>1t4h_A Serine/threonine-protein kinase WNK1; protein serine/threonine kinase, transferase; 1.80A {Rattus norvegicus} PDB: 3fpq_A Back     alignment and structure
>3ttj_A Mitogen-activated protein kinase 10; JNK3, protein kinase in transferase-transferase inhibitor complex; HET: JBI; 2.10A {Homo sapiens} PDB: 3tti_A* 1jnk_A* Back     alignment and structure
>3dls_A PAS domain-containing serine/threonine-protein KI; PAS kinase, PASK, protein kinase, drug discovery, ATP-bindin kinase, nucleotide-binding; HET: ADP; 2.30A {Homo sapiens} Back     alignment and structure
>3llt_A Serine/threonine kinase-1, pflammer; lammer kinase, malaria, structural GE structural genomics consortium, SGC, transferase; HET: ANP; 2.50A {Plasmodium falciparum 3D7} Back     alignment and structure
>3bhy_A Death-associated protein kinase 3; death associated kinase, DAPK3, ZIP kinase, ZIPK, DAP kinase like kinase, DLK, structural genomics consortium; HET: 7CP; 1.24A {Homo sapiens} PDB: 3bqr_A* 2j90_A* 1yrp_A* 2yak_A* 2y4p_A* 3f5u_A* 1jks_A 1jkk_A* 1ig1_A* 1jkl_A 1jkt_A 3eh9_A* 3eha_A* 3f5g_A* 1p4f_A* 1wvw_A 1wvx_A* 1wvy_A* 2w4j_A* 3dgk_A ... Back     alignment and structure
>4agu_A Cyclin-dependent kinase-like 1; transferase, phospho-mimetic; HET: D15; 2.40A {Homo sapiens} Back     alignment and structure
>2wtk_C Serine/threonine-protein kinase 11; transferase-metal-binding protein complex, transferase metal protein complex, nucleus; HET: ANP; 2.65A {Homo sapiens} Back     alignment and structure
>3eqc_A Dual specificity mitogen-activated protein kinase; MEK1 kinase, ATP-binding, disease mutation, nucleoti binding, phosphoprotein; HET: 3BM AGS; 1.80A {Homo sapiens} PDB: 3eqd_A* 3eqf_A* 3eqg_A* 3eqh_A* 3eqi_A* 2y4i_C* 3eqb_A* 2p55_A* 1s9j_A* 3dy7_A* 3e8n_A* 3v01_A* 3v04_A* 3dv3_A* 3mbl_A* 3pp1_A* 3orn_A* 3os3_A* 3sls_A* 1s9i_A* ... Back     alignment and structure
>3g33_A Cell division protein kinase 4; Ser/Thr protein kinase, cell cycle, phosphorylation, ATP-BIN cell division, disease mutation, kinase; 3.00A {Homo sapiens} Back     alignment and structure
>1ua2_A CAK, cell division protein kinase 7; cell cycle, phosphorylation, protein-protein interaction, PR kinase, cell cycle, transferase; HET: TPO ATP; 3.02A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>3p86_A Serine/threonine-protein kinase CTR1; ETR1, ERS1, ETR2, phosphorylation, transferase; HET: STU; 2.50A {Arabidopsis thaliana} PDB: 3ppz_A* Back     alignment and structure
>4e7w_A Glycogen synthase kinase 3; GSK3, PTyr195, transferase; HET: PTR; 3.30A {Ustilago maydis} Back     alignment and structure
>1cm8_A Phosphorylated MAP kinase P38-gamma; phosphorylation, transferase; HET: TPO PTR ANP; 2.40A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>3lm5_A Serine/threonine-protein kinase 17B; STK17B, serine/threonine kinase 17B, DRAK2, DAP kinase relat apoptosis-inducing protein kinase 2; HET: QUE; 2.29A {Homo sapiens} PDB: 3lm0_A* Back     alignment and structure
>1vzo_A Ribosomal protein S6 kinase alpha 5; protein kinase, transferase, phosphorylation, serine/threonine protein kinase; 1.8A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>2w5a_A Serine/threonine-protein kinase NEK2; Ser/Thr protein kinase, nucleus, meiosis, mitosis, cytoplasm, metal-binding, phosphoprotein; HET: ADP; 1.55A {Homo sapiens} PDB: 2wqo_A* 2xk3_A* 2xk4_A* 2xk6_A* 2xk7_A* 2xk8_A* 2xkc_A* 2xkd_A* 2xke_A* 2xkf_A* 2xnm_A* 2xnn_A* 2xno_A* 2xnp_A* 4afe_A* 2jav_A* 2w5b_A* 2w5h_A 4a4x_A* Back     alignment and structure
>2j7t_A Serine/threonine-protein kinase 10; transferase, ATP-binding, cell cycle progression, phosphorylation, disease mutation, nucleotide- binding; HET: 274; 2.0A {Homo sapiens} PDB: 4aot_A* 3zz2_A* 2j51_A* 2jfl_A* 2jfm_A* 2uv2_A* Back     alignment and structure
>4aaa_A Cyclin-dependent kinase-like 2; transferase, phospho-mimetic; HET: DKI; 1.53A {Homo sapiens} PDB: 4bbm_A* Back     alignment and structure
>3i6u_A CDS1, serine/threonine-protein kinase CHK2; Ser/Thr protein kinase, FHA domain, ATP-binding, cell cycle, mutation, LI-fraumeni syndrome, magnesium; 3.00A {Homo sapiens} PDB: 3i6w_A Back     alignment and structure
>2pml_X PFPK7, Ser/Thr protein kinase; phosphorylati transferase, transferase; HET: ANP; 2.60A {Plasmodium falciparum} PDB: 2pmn_X* 2pmo_X* Back     alignment and structure
>1phk_A Phosphorylase kinase; glycogen metabolism, transferase, serine/threonine-protein, ATP-binding, calmodulin-binding; HET: ATP; 2.20A {Oryctolagus cuniculus} SCOP: d.144.1.7 PDB: 1ql6_A* 2phk_A* Back     alignment and structure
>3ork_A Serine/threonine protein kinase; structural genomics, TB structural genomics consortium, TBSG domain, signal transduction; HET: AGS; 1.60A {Mycobacterium tuberculosis} PDB: 3ori_A* 3orl_A* 3oro_A* 3orp_A* 3ort_A* 3f61_A* 1mru_A* 3f69_A* 3orm_A* 1o6y_A* 2fum_A* Back     alignment and structure
>1x8b_A WEE1HU, WEE1-like protein kinase; cell cycle, transferase; HET: 824; 1.81A {Homo sapiens} PDB: 3bi6_A* 3biz_A* 3cqe_A* 3cr0_A* 2in6_A* 2io6_A* 2z2w_A* Back     alignment and structure
>3rp9_A Mitogen-activated protein kinase; structural genomics, structural genomics consortium, SGC, TR; 2.40A {Toxoplasma gondii} Back     alignment and structure
>3eb0_A Putative uncharacterized protein; kinase cryptosporidium parvum, ATP-binding, kinase, nucleoti binding; HET: PTR DRK; 2.65A {Cryptosporidium parvum iowa II} Back     alignment and structure
>2wei_A Calmodulin-domain protein kinase 1, putative; nucleotide-binding, serine/threonine-protein kinase, CGD3_920, transferase; HET: VGG; 1.65A {Cryptosporidium parvum iowa II} PDB: 3dfa_A 3ma6_A* Back     alignment and structure
>3qd2_B Eukaryotic translation initiation factor 2-alpha; EIF2A kinase, phosphoryalation, gene regulation; HET: TPO; 2.81A {Mus musculus} Back     alignment and structure
>2clq_A Mitogen-activated protein kinase kinase kinase 5; transferase, metal-binding, apoptosis; HET: STU; 2.3A {Homo sapiens} Back     alignment and structure
>3mi9_A Cell division protein kinase 9; P-TEFB, HIV-1, protein binding; HET: TPO; 2.10A {Homo sapiens} PDB: 3mia_A* 4ec9_A* 4ec8_A* 3blh_A* 3blq_A* 3blr_A* 3lq5_A* 3my1_A* 3tn8_A* 3tnh_A* 3tni_A* 4bch_A* 4bci_A* 4bcj_A* 4bcf_A* Back     alignment and structure
>2yex_A Serine/threonine-protein kinase CHK1; transferase, cell cycle; HET: YEX; 1.30A {Homo sapiens} PDB: 2x8e_A* 2ydk_A* 2ydj_A* 2yer_A* 2ydi_A* 1nvq_A* 1nvr_A* 1nvs_A* 2wmq_A* 2wmr_A* 2wms_A* 2wmt_A* 2wmu_A* 2wmv_A* 2wmw_A* 2wmx_A* 2x8d_A* 2x8i_A* 2xey_A* 2xez_A* ... Back     alignment and structure
>1j1b_A Glycogen synthase kinase-3 beta; complex, TAU, AMPPNP, transferase; HET: ANP; 1.80A {Homo sapiens} SCOP: d.144.1.7 PDB: 1i09_A* 1j1c_A* 2jld_A* 3m1s_A* 3pup_A* 3du8_A* 1pyx_A* 1q41_A* 1q3w_A* 1q3d_A* 1q4l_A* 3q3b_A* 1q5k_A* 3i4b_A* 3l1s_A* 1r0e_A* 3zrk_A* 3zrl_A* 3zrm_A* 4dit_A* ... Back     alignment and structure
>3kvw_A DYRK2, dual specificity tyrosine-phosphorylation-regulat 2; KI-(Y)-phosphorylation REG kinase 2, PSK-H2, kinase, structural genomics consortium; HET: SEP PTR IRB; 2.28A {Homo sapiens} PDB: 3k2l_A* 4azf_A* Back     alignment and structure
>3com_A Serine/threonine-protein kinase 4; MST1, STE20-like kinase, PSI, structural genomics, protein structure initiative; HET: TPO; 2.20A {Homo sapiens} Back     alignment and structure
>2vwi_A Serine/threonine-protein kinase OSR1; STE kinase, hypertension, transferase; HET: ANP; 2.15A {Homo sapiens} PDB: 3dak_A* Back     alignment and structure
>3l9p_A Anaplastic lymphoma kinase; kinase domain, ATP-binding, glycoprotein, membrane, nucleotide-binding, phosphoprotein, proto-oncogene; 1.80A {Homo sapiens} Back     alignment and structure
>2xrw_A Mitogen-activated protein kinase 8; transcription, MAPK signaling pathways, linear binding motif; HET: ANP; 1.33A {Homo sapiens} PDB: 1ukh_A 1uki_A* 2xs0_A* 3elj_A* 2h96_A* 2gmx_A* 2g01_A* 2no3_A* 3o2m_A* 3o17_A* 3pze_A* 3g9l_X* 2p33_A* 3cgf_A* 3cgo_A* 3g90_X* 2ok1_A* 3g9n_A* 1pmn_A* 1pmq_A* ... Back     alignment and structure
>3rgf_A Cyclin-dependent kinase 8; protein kinase complex, transferase,transcription; HET: BAX; 2.20A {Homo sapiens} Back     alignment and structure
>3n9x_A Phosphotransferase; malaria kinase, structural genomics, structural genomics CON SGC; 2.05A {Plasmodium berghei} PDB: 3nie_A* Back     alignment and structure
>2fst_X Mitogen-activated protein kinase 14; active mutants, lipids, MAP kinase insertion, autophosphorylation, transferase; HET: BOG; 1.45A {Homo sapiens} PDB: 2fso_X* 2fsl_X* 2fsm_X* 2npq_A* 2bal_A* 2baj_A* 2bak_A* 2baq_A* 2qd9_A* 1ian_A* 2rg5_A* 2rg6_A* 3bv2_A* 3bv3_A* 3bx5_A* 3c5u_A* 3cg2_A* 3l8x_A* 3mvl_A* 3mvm_A* ... Back     alignment and structure
>2x7f_A TRAF2 and NCK-interacting protein kinase; serine/threonine-protein kinase, phosphoprotein; HET: 824; 2.80A {Homo sapiens} Back     alignment and structure
>4eqm_A Protein kinase; transferase; HET: ANP; 3.00A {Staphylococcus aureus subsp} Back     alignment and structure
>4hcu_A Tyrosine-protein kinase ITK/TSK; transferase-transferase inhibitor complex; HET: 13L; 1.43A {Homo sapiens} PDB: 4hct_A* 4hcv_A* 3t9t_A* 1sm2_A* 1snu_A* 1snx_A 3v5l_A* 3v5j_A* 3v8t_A* 3v8w_A* 3qgw_A* 3qgy_A* 3miy_A* 3mj1_A* 3mj2_A* Back     alignment and structure
>3a7i_A MST3 kinase, serine/threonine kinase 24 (STE20 homolog, yeast); two-LOBE protein kinase fold, ATP-binding, nucleotid binding, transferase; HET: TPO ADE; 1.45A {Homo sapiens} PDB: 3a7g_A* 3a7h_A* 3a7f_A* 3a7j_A* 3ckw_A 3ckx_A* 3ggf_A* 2xik_A* Back     alignment and structure
>2ycf_A Serine/threonine-protein kinase CHK2; transferase, anticancer, anticancer drug design; HET: YCF; 1.77A {Homo sapiens} PDB: 2yiq_A* 2w7x_A* 2ycq_A* 2ycs_A* 2w0j_A* 2yir_A* 2yit_A* 2wtj_A* 2cn8_A* 2wtc_A* 2wtd_A* 2wti_A* 2cn5_A* 2xbj_A* 2xm8_A* 2xm9_A* 2xk9_A* 2ycr_A* Back     alignment and structure
>3p23_A Serine/threonine-protein kinase/endoribonuclease; kinase domain, kinase and RNAse function, ATP binding ssRNA dephosphorylated, hydrolase; HET: ADP; 2.70A {Homo sapiens} Back     alignment and structure
>2zmd_A Dual specificity protein kinase TTK; MPS1, T686A, ATP-binding, nucleotide-bindi phosphoprotein, serine/threonine-protein kinase; HET: 537 7PE; 2.88A {Homo sapiens} PDB: 2zmc_A* Back     alignment and structure
>3qyz_A Mitogen-activated protein kinase 1; transferase, serine/threonine-protein kinase, ATP-binding CE phosphorylation; HET: CME Z8B SO4; 1.46A {Rattus norvegicus} PDB: 2fys_B 1erk_A* 3qyi_A* 3erk_A* 3qyw_A* 4erk_A* 4gsb_A* 4gt3_A* 4gva_A* 2z7l_A* 2erk_A* 1gol_A* 2gph_A 3zu7_A 3zuv_A* 3o71_A 3r63_A 3c9w_A* 2y9q_A* 4fmq_A* ... Back     alignment and structure
>2psq_A Fibroblast growth factor receptor 2; kinase domain fold consisting of N- and C-lobes, transferase; 2.40A {Homo sapiens} SCOP: d.144.1.7 PDB: 1xr0_A Back     alignment and structure
>3dbq_A Dual specificity protein kinase TTK; MPS1 structure, kinase activation, phosphorylation, ATP- binding, nucleotide-binding, phosphoprotein; 2.70A {Homo sapiens} Back     alignment and structure
>1blx_A Cyclin-dependent kinase 6; inhibitor protein, cyclin-dependent kinase, cell cycle control, alpha/beta, complex (inhibitor protein/kinase); 1.90A {Homo sapiens} SCOP: d.144.1.7 PDB: 1bi7_A 1bi8_A 1g3n_A 2f2c_B* 1jow_B* 2euf_B* 1xo2_B* 3nup_A* 3nux_A* 2w9z_B 2w99_B 2w96_B 2w9f_B Back     alignment and structure
>4fvq_A Tyrosine-protein kinase JAK2; janus protein kinase, pseudokinase, ATP binding, phosphoryla transferase; HET: ATP; 1.75A {Homo sapiens} PDB: 4fvp_A* 4fvr_A* Back     alignment and structure
>3pg1_A Mitogen-activated protein kinase, putative (MAP K protein); EPK Ser/Thr protein kinase fold, Ser/Thr protein kinase, TRA; 1.95A {Leishmania major} PDB: 3uib_A* Back     alignment and structure
>3kmu_A ILK, integrin-linked kinase; cell adhesion, ANK repeat, ATP-binding, cell junction, cell membrane, integrin-binding protein, membrane, nucleotide- binding; 1.80A {Homo sapiens} SCOP: d.144.1.0 PDB: 3kmw_A* 3rep_A* Back     alignment and structure
>1z57_A Dual specificity protein kinase CLK1; protein tyrosine kinase, splicing, human, 10Z-hymendialdisine, structural genomics; HET: DBQ; 1.70A {Homo sapiens} PDB: 2vag_A* Back     alignment and structure
>3qup_A Tyrosine-protein kinase receptor TYRO3; protein kinase inhibitor, receptor tyrosine kinase, spirocyc kinase domain, phosphotransfer, GAS6 ligand; HET: LUN; 1.90A {Mus musculus} Back     alignment and structure
>1luf_A Muscle-specific tyrosine kinase receptor MUSK; phosphorylation, signal transduction, MASS spectrometry, transferase; 2.05A {Rattus norvegicus} SCOP: d.144.1.7 Back     alignment and structure
>4exu_A Mitogen-activated protein kinase 13; P38 kinase, transferase; 1.70A {Homo sapiens} PDB: 4eyj_A* 4eym_A* 3coi_A Back     alignment and structure
>3kul_A Ephrin type-A receptor 8; ATP-binding, kinase, nucleotide-binding, transfera phosphorylation, transmembrane, tyrosine-protein kinase; HET: PTR; 2.15A {Homo sapiens} Back     alignment and structure
>2b9h_A MAP kinase FUS3, mitogen-activated protein kinase FUS3; transferase; HET: ADP; 1.55A {Saccharomyces cerevisiae} PDB: 2b9i_A* 2b9j_A* 2f49_A 2fa2_A 2b9f_A* 2f9g_A* Back     alignment and structure
>3nsz_A CK II alpha, casein kinase II subunit alpha; inhibitor, transferase-transferase inhibitor CO; HET: ANP; 1.30A {Homo sapiens} SCOP: d.144.1.7 PDB: 2r7i_A 3pe1_A* 1jwh_A* 3pe2_A* 3r0t_A* 3h30_A* 3q9w_A* 3q9x_A* 3q9y_A* 3q9z_A* 3qa0_A 3bqc_A* 2rkp_A* 3c13_A* 3fwq_A 3rps_A* 3u9c_A* 4fbx_A* 3mb7_A* 3mb6_A* ... Back     alignment and structure
>4euu_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: SEP BX7; 1.80A {Homo sapiens} Back     alignment and structure
>3e3p_A Protein kinase, putative glycogen synthase kinase; leishmaniasis, transferase; 2.00A {Leishmania major} Back     alignment and structure
>3p1a_A MYT1 kinase, membrane-associated tyrosine- and threonine-speci inhibitory kinase; structural genomics, structural genomics consortium, SGC; 1.70A {Homo sapiens} Back     alignment and structure
>3gen_A Tyrosine-protein kinase BTK; bruton'S tyrosine kinase, 4-amino-5-(4-phenoxyphenyl)-5H- pyrrolo[3, 2-D]pyrimidin-7-YL-cyclopentane, TEC-family; HET: B43; 1.60A {Homo sapiens} PDB: 3k54_A* 3pj2_A* 3piy_A* 3piz_A* 3pj1_A* 3pix_A* 3pj3_A* 3p08_A 3ocs_A* 3oct_A* 1k2p_A Back     alignment and structure
>3q60_A ROP5B; pseudokinase, transferase; HET: ATP; 1.72A {Toxoplasma gondii} PDB: 3q5z_A* Back     alignment and structure
>2i6l_A Mitogen-activated protein kinase 6; MAPK6, ERK3, extracellular signal regulated kinase 3, serine phosphorylation, threonine phosphorylation; 2.25A {Homo sapiens} Back     alignment and structure
>3byv_A Rhoptry kinase; malaria, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} PDB: 2w1z_A Back     alignment and structure
>2yfx_A Tyrosine-protein kinase receptor; nucleotide-binding, transferase; HET: VGH; 1.70A {Homo sapiens} PDB: 2xp2_A* 3aox_A* 2yhv_A 3lcs_A* 3lct_A* 4dce_A* 2xba_A* 2xb7_A* Back     alignment and structure
>2rio_A Serine/threonine-protein kinase/endoribonuclease IRE1; protein-nucleotide complex, ATP-binding, endoplasmic reticulum, glycoprotein; HET: ADP; 2.40A {Saccharomyces cerevisiae} PDB: 3lj0_A* 3lj1_A* 3lj2_A* 3fbv_A* 3sdm_A* 3sdj_A* Back     alignment and structure
>3fme_A Dual specificity mitogen-activated protein kinase; active mutant, structural genomics consortium, SCG, binding, nucleotide-binding, phosphoprotein; HET: STU; 2.26A {Homo sapiens} PDB: 3enm_A Back     alignment and structure
>3cbl_A C-FES, proto-oncogene tyrosine-protein kinase FES/FPS; V-FES, fujinami, avian sarcoma, viral, feline virus, SGC; HET: STU; 1.75A {Homo sapiens} PDB: 3bkb_A* 3cd3_A* 4e93_A* Back     alignment and structure
>2eu9_A Dual specificity protein kinase CLK3; kinase domain, transferase; 1.53A {Homo sapiens} PDB: 2wu6_A* 2wu7_A* 3raw_A* 2exe_A 3nr9_A* Back     alignment and structure
>3t9t_A Tyrosine-protein kinase ITK/TSK; kinase domain, alpha/beta, ATP binding, phosphorylation, intracellular, transferase-transferase inhibitor complex; HET: IAQ; 1.65A {Homo sapiens} PDB: 3v5l_A* 3v5j_A* 3v8t_A* 3v8w_A* 1sm2_A* 1snu_A* 1snx_A 3qgw_A* 3qgy_A* 3miy_A* 3mj1_A* 3mj2_A* Back     alignment and structure
>3tt0_A Basic fibroblast growth factor receptor 1; kinase domain, transferase, transferase-transferase inhibito; HET: 07J; 2.80A {Homo sapiens} Back     alignment and structure
>3sxs_A Cytoplasmic tyrosine-protein kinase BMX; transferase-transferase inhibitor complex; HET: PP2; 1.89A {Homo sapiens} SCOP: d.144.1.7 PDB: 3sxr_A* Back     alignment and structure
>2ivs_A Proto-oncogene tyrosine-protein kinase receptor RET; nucleotide-binding, hirschsprung disease, phosphorylation, disease mutation; HET: ACK; 2.00A {Homo sapiens} PDB: 2ivt_A* 2ivu_A* 2x2k_A* 2x2l_A* 2x2m_A* 2ivv_A* Back     alignment and structure
>1mp8_A Focal adhesion kinase 1; tyrosine protein kinase, transferase; HET: ADP; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 2ijm_A* 2etm_A* 3pxk_A* 2jkq_A* 2j0m_B* 2jkm_A* 2j0l_A* 3bz3_A* 2jko_A* 2jkk_A* Back     alignment and structure
>3dtc_A Mitogen-activated protein kinase kinase kinase 9; mixed-lineage kinase, MLK family, MLK1 and MLK3 subtype selective inhibitors; HET: VIN; 2.60A {Homo sapiens} SCOP: d.144.1.0 Back     alignment and structure
>1k9a_A Carboxyl-terminal SRC kinase; COOH-terminal SRC kinase, CSK, SFK, signal transduction, SH2, SH3, SRC homology, tyrosine kinase; 2.50A {Rattus norvegicus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1jeg_A Back     alignment and structure
>3fhr_A MAP kinase-activated protein kinase 3; kinase-inhibitor complex, ATP-binding, cytoplasm, nucleotide-binding, nucleus, phosphoprotein, polymorphism; HET: P4O; 1.90A {Homo sapiens} PDB: 3fxw_A* 3r1n_A* 3she_A* 2oza_A 3fyk_X* 3fyj_X* 2p3g_X* 3ka0_A* 3fpm_A* 2pzy_A* 3a2c_A* 3kc3_A* 3gok_A* 2jbo_A* 2jbp_A* 3r2y_A* 3r30_A* 3r2b_A* Back     alignment and structure
>3kfa_A Tyrosine-protein kinase ABL1; CML, drug resistance, inhibitor, ATP-binding, nucleotide-binding, oncogene, TRAN; HET: B91; 1.22A {Mus musculus} SCOP: d.144.1.7 PDB: 2qoh_A* 3kf4_A* 3k5v_A* 1fpu_A* 1m52_A* 1iep_A* 2hzn_A* 1opj_A* 3ms9_A* 3mss_A* 3ik3_A* 2z60_A* 2e2b_A* 3pyy_A* 3oxz_A* 2g1t_A* 3ue4_A* 3oy3_A* 2hiw_A* 2v7a_A* ... Back     alignment and structure
>3coi_A Mitogen-activated protein kinase 13; P38D, P38delta, ERK, MAP kinase, PMK, STK26, stress-activated protein kinase, structural genomics, PSI; 2.09A {Homo sapiens} Back     alignment and structure
>2qol_A Ephrin receptor; receptor tyrosine kinase, juxtamembrane segment, structural genomics, mutant, structural genomics consortium, SGC, ATP- binding; 1.07A {Homo sapiens} PDB: 2qok_A 2qoi_A 2qoo_A 2qof_A 2qod_A 2qo9_A* 2gsf_A 2qo7_A* 2qo2_A* 2qoq_A* 2qon_A* 3fxx_A* 3fy2_A 2qoc_A* 2qob_A* 3dzq_A* 2r2p_A 2hel_A 2rei_A 3dko_A* ... Back     alignment and structure
>3kex_A Receptor tyrosine-protein kinase ERBB-3; kinase domain, inactive kinase, HER3, ATP-binding, cell membrane, membrane, nucleotide-binding; HET: ANP; 2.80A {Homo sapiens} PDB: 3lmg_A* Back     alignment and structure
>1zy4_A Serine/threonine-protein kinase GCN2; translation regulator, signal transduction, acid starvation, starvation stress response; 1.95A {Saccharomyces cerevisiae} PDB: 1zy5_A* 1zyd_A* 1zyc_A* 1zxe_A Back     alignment and structure
>3s95_A LIMK-1, LIM domain kinase 1; structural genomics, structural genomics consortium, SGC, PR kinase, transferase-antibiotic complex; HET: STU GOL; 1.65A {Homo sapiens} Back     alignment and structure
>1qcf_A Haematopoetic cell kinase (HCK); tyrosine kinase-inhibitor complex, DOWN-regulated kinase, ordered activation loop; HET: PTR PP1; 2.00A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 2c0i_A* 2c0o_A* 2c0t_A* 1ad5_A* 2hck_A* 3nhn_A 3hck_A 1bu1_A 3rea_B 3rbb_B Back     alignment and structure
>1wak_A Serine/threonine-protein kinase SPRK1; SRPK, transferase, alternative splicing, ATP-binding, chromosome partition, differentiation, mRNA processing; 1.73A {Homo sapiens} PDB: 1wbp_A* 3beg_A* 2x7g_A* Back     alignment and structure
>2vx3_A Dual specificity tyrosine-phosphorylation- regula kinase 1A; serine/threonine-protein kinase, minibrain homolog, nucleotide-binding, transferase; HET: PTR D15 P6G; 2.40A {Homo sapiens} PDB: 2wo6_A* 3anq_A* 3anr_A* Back     alignment and structure
>1fvr_A Tyrosine-protein kinase TIE-2; tyrosine kinase, transferase; 2.20A {Homo sapiens} SCOP: d.144.1.7 PDB: 2oo8_X* 2osc_A* 2p4i_A* 3l8p_A* 2wqb_A* Back     alignment and structure
>1p4o_A Insulin-like growth factor I receptor protein; IGF-1R, kinase domain, hormone-growth factor complex; 1.50A {Homo sapiens} SCOP: d.144.1.7 PDB: 1m7n_A 3lvp_A* 3lw0_A* 1jqh_A* 2zm3_A* 3f5p_A* 3i81_A* 2oj9_A* 3nw5_A* 3nw6_A* 3nw7_A* 3o23_A* 3qqu_A* 3d94_A* 1k3a_A* 2z8c_A* 1ir3_A* 1gag_A* 1irk_A 3bu3_A* ... Back     alignment and structure
>2h34_A Serine/threonine-protein kinase PKNE; apoenzyme, transferase; 2.80A {Mycobacterium tuberculosis} Back     alignment and structure
>1mqb_A Ephrin type-A receptor 2; tyrosine protein kinase, transferase; HET: ANP; 2.30A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>1opk_A P150, C-ABL, proto-oncogene tyrosine-protein kinase ABL1; transferase; HET: MYR P16; 1.80A {Mus musculus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1opl_A* 2fo0_A* 2abl_A Back     alignment and structure
>3vhe_A Vascular endothelial growth factor receptor 2; kinase domain, kinase, transferase-transferase inhibitor COM; HET: 42Q; 1.55A {Homo sapiens} PDB: 1y6a_A* 1y6b_A* 3vhk_A* 3vid_A* 3hng_A* Back     alignment and structure
>1q8y_A SR protein kinase; transferase; HET: ADP ADE; 2.05A {Saccharomyces cerevisiae} SCOP: d.144.1.7 PDB: 1q8z_A 1q97_A* 1q99_A* 1how_A 2jd5_A Back     alignment and structure
>1fmk_A C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyrosine kinase, phosphorylation, SH2, SH3, phosphotyrosine, proto-oncogene, phosphotransferase; HET: PTR; 1.50A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1y57_A* 2src_A* 1ksw_A* 2ptk_A* 1yol_A* 2oiq_A* 3d7t_B* 3dqx_A* 3el7_A* 3el8_A* 3en4_A* 3en5_A* 3en6_A* 3en7_A* 3f6x_A* 3g6g_A* 3uqf_A* 3uqg_A* 4agw_A* 3oez_A* ... Back     alignment and structure
>1rjb_A FL cytokine receptor; kinase, structure, autoinhibition, juxtamembrane domain, transferase; 2.10A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>3poz_A Epidermal growth factor receptor; kinase domain, anti-oncogene, ATP-binding, cell cycle, disea mutation, glycoprotein, membrane, nucleotide-binding; HET: 03P; 1.50A {Homo sapiens} SCOP: d.144.1.7 PDB: 2itx_A* 2ity_A* 2j5f_A* 2j6m_A* 2itw_A* 1m14_A 1m17_A* 3vjo_A* 2gs6_A* 2gs2_A* 2rf9_A 4g5j_A* 1xkk_A* 2eb2_A 3gop_A 2eb3_A* 2itn_A* 2ito_A* 2itp_A* 2itq_A* ... Back     alignment and structure
>2izr_A Casein kinase I isoform gamma-3; serine/threonine-protein kinase, transferase, ATP- binding, phosphorylation, nucleotide-binding; HET: BRK; 1.3A {Homo sapiens} PDB: 2izs_A* 2izt_A* 2izu_A* 2chl_A* 2c47_A* 2cmw_A* Back     alignment and structure
>3a99_A Proto-oncogene serine/threonine-protein kinase PI; PIM-1, P27KIP1, peptide drug, prostate cancer, transferase; HET: ANP; 1.60A {Homo sapiens} PDB: 3bgq_A* 3bgp_A* 2obj_A* 3bgz_A* 3t9i_A* 3dcv_A* 1xws_A* 2xj1_A* 2xix_A* 2xiz_A* 2xj0_A* 2xiy_A* 2xj2_A* 3f2a_A* 1xr1_A* 1xqz_A* 3cy2_A* 3cxw_A* 3cy3_A* 2bik_B* ... Back     alignment and structure
>1t46_A HOMO sapiens V-KIT hardy-zuckerman 4 feline sarcoma viral oncogene homolog; kinase, structure, inhibitor, STI-571, gleevec, transferase activator; HET: STI; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1pkg_A* 1t45_A 3g0e_A* 3g0f_A* Back     alignment and structure
>2eva_A TAK1 kinase - TAB1 chimera fusion protein; transferase/transferase activator complex; HET: ADN; 2.00A {Homo sapiens} Back     alignment and structure
>1u59_A Tyrosine-protein kinase ZAP-70; transferase; HET: STU; 2.30A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>1byg_A CSK, protein (C-terminal SRC kinase); protein kinase, phosphorylation, staurosporine, transferase; HET: STU; 2.40A {Homo sapiens} SCOP: d.144.1.7 PDB: 3d7u_A 3d7t_A* Back     alignment and structure
>2iwi_A Serine/threonine-protein kinase PIM-2; nucleotide-binding, cancer, leukemia, transferase, ATP-binding, proto- oncogene, phosphorylation; HET: HB1; 2.80A {Homo sapiens} Back     alignment and structure
>4fl3_A Tyrosine-protein kinase SYK; transferase; HET: ANP; 1.90A {Homo sapiens} PDB: 4fl2_A* 1a81_A* 1csy_A* 1csz_A* Back     alignment and structure
>2v62_A Serine/threonine-protein kinase VRK2; transferase, ATP-binding, membrane, nucleotide-binding, TRAN; 1.7A {Homo sapiens} Back     alignment and structure
>4f0f_A Serine/threonine-protein kinase ROCO4; LRRK2, ATP-binding, nucleotide serine/threonine-protein kinase, transferase, signaling Pro; HET: ACP; 1.80A {Dictyostelium discoideum} PDB: 4f0g_A 4f1t_A* 4f1m_A* 4f1o_A* Back     alignment and structure
>2pvf_A Fibroblast growth factor receptor 2; kinase domain fold consisting of N- and C-lobes, transferase; HET: PTR ACP; 1.80A {Homo sapiens} PDB: 3cly_A* 2pzr_A* 2pzp_A* 2pvy_A* 2pz5_A* 2q0b_A* 2pwl_A* 2py3_A* 3ri1_A* 1gjo_A 1oec_A* 3b2t_A* 3gql_A* 3gqi_A* 1fgk_A 1fgi_A* 1agw_A 2fgi_A* 3js2_A* 3ky2_A ... Back     alignment and structure
>3cc6_A Protein tyrosine kinase 2 beta; focal adhesion kinase, structural genomics, structural genom consortium, SGC, ATP-binding, membrane; 1.60A {Homo sapiens} PDB: 3fzs_A* 3et7_A 3fzo_A* 3fzr_A* 3fzp_A* 3fzt_A* 3h3c_A* Back     alignment and structure
>1xbb_A Tyrosine-protein kinase SYK; gleevec, STI-571, imatinib, spleen typrosine kinase, active conformation, structural genomics, structural genomix; HET: STI; 1.57A {Homo sapiens} SCOP: d.144.1.7 PDB: 1xba_A* 1xbc_A* 3fqe_A* 3fqh_A* 3fqs_A* 3emg_A* 3srv_A* 4dfl_A* 4dfn_A* 3vf8_A* 3vf9_A* Back     alignment and structure
>3f66_A Hepatocyte growth factor receptor; C-Met, protein kinase, quinoxaline, alternative splicing, ATP-binding, chromosomal rearrangement; HET: IHX; 1.40A {Homo sapiens} PDB: 3i5n_A* 3u6h_A* 3u6i_A* 4deg_A* 4deh_A* 4dei_A* 3ccn_A* 2rfn_A* 2rfs_A* 3cd8_A* 3efj_A* 3efk_A* 3lq8_A* 3zxz_A* 2wkm_A* 2wgj_A* 3zze_A* 4aoi_A* 4ap7_A* 3q6w_A* ... Back     alignment and structure
>3c1x_A Hepatocyte growth factor receptor; receptor tyrosine kinase, signal transduction, GRB2, SHC, ATP-binding, glycoprotein, membrane; HET: CKK; 2.17A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>2dyl_A Dual specificity mitogen-activated protein kinase kinase 7; MKK7, activated mutant, ATP-binding, structural genomics, NPPSFA; 2.45A {Homo sapiens} Back     alignment and structure
>3lzb_A Epidermal growth factor receptor; epidermal growth factor kinase domain, multitargeted small M kinase inhibitor; HET: ITI; 2.70A {Homo sapiens} Back     alignment and structure
>2i1m_A Macrophage colony-stimulating factor 1 receptor; kinase domain, kinase inhibitor complex, transferase; HET: 5CN; 1.80A {Homo sapiens} PDB: 3bea_A* 3lcd_A* 2i0y_A* 2i0v_A* 3dpk_A* 3krj_A* 3krl_A* 2ogv_A 3lco_A* Back     alignment and structure
>3soc_A Activin receptor type-2A; structural genomics consortium, SGC, transferase, protein KI; HET: GVD; 1.95A {Homo sapiens} PDB: 3q4t_A* 4asx_A* 2qlu_A* Back     alignment and structure
>2ozo_A Tyrosine-protein kinase ZAP-70; inactive ZAP-70, tandem SH2, autoinhibition, ITAM, hydrogen bonding network, TCR signaling, transferase; HET: ANP; 2.60A {Homo sapiens} Back     alignment and structure
>1qpc_A LCK kinase; alpha beta fold, transferase; HET: PTR ANP; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1qpe_A* 1qpj_A* 2pl0_A* 3kxz_A* 3ac1_A* 2zm4_A* 2zyb_A* 2zm1_A* 3ac2_A* 3ac3_A* 3ac4_A* 3ac5_A* 3ac8_A* 3acj_A* 3ack_A* 3ad4_A* 3ad5_A* 3ad6_A* 3kmm_A* 1qpd_A* ... Back     alignment and structure
>1csn_A Casein kinase-1; phosphotransferase; HET: ATP; 2.00A {Schizosaccharomyces pombe} SCOP: d.144.1.7 PDB: 1eh4_A* 2csn_A* Back     alignment and structure
>3pls_A Macrophage-stimulating protein receptor; protein kinase, CIS autophosphorylation conformation, recept tyrosine kinase, AMP-PNP, unphosphorylated; HET: ANP; 2.24A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>3cek_A Dual specificity protein kinase TTK; HMPS1, PYT, ESK, phosphotyros picked threonine kinase, SGC, structural genomics consortiu binding; HET: 7PE; 2.30A {Homo sapiens} PDB: 3gfw_A* 3h9f_A* 2x9e_A* 3hmp_A* 3hmn_A* 3hmo_A* Back     alignment and structure
>2h8h_A Proto-oncogene tyrosine-protein kinase SRC; SRC kinase, transferase; HET: PTR H8H; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 Back     alignment and structure
>3brb_A Proto-oncogene tyrosine-protein kinase MER; ATP-binding, disease mutation, glycoprotein, nucleot binding, phosphorylation, receptor; HET: ADP; 1.90A {Homo sapiens} PDB: 3bpr_A* 2p0c_A* Back     alignment and structure
>2wqm_A Serine/threonine-protein kinase NEK7; ATP-binding, polymorphism, metal-binding, cell cycle kinase, mitosis, cytoplasm, magnesium, transferase; 2.10A {Homo sapiens} PDB: 2wqn_A* Back     alignment and structure
>3ugc_A Tyrosine-protein kinase JAK2; small molecule inhibitor, ATP binding, transferase-transfera inhibitor complex; HET: 046; 1.34A {} PDB: 3krr_A* 3lpb_A* 4aqc_A* 4e4m_A* 4f08_A* 4f09_A* 3q32_A* 3rvg_A* 4hge_A* 3tjc_A* 3tjd_A* 4bbe_A* 4bbf_A* 2b7a_A* 3fup_A* 3e64_A* 3e62_A* 3e63_A* 2xa4_A* 3iok_A* ... Back     alignment and structure
>2a19_B Interferon-induced, double-stranded RNA-activated kinase; transferase, protein biosynthesis, protein synthesis transferase complex; HET: TPO ANP; 2.50A {Homo sapiens} PDB: 2a1a_B* Back     alignment and structure
>2qkw_B Protein kinase; three-helix bundle motif, AVRPTO-PTO duplex, layered beta- sheets, transferas; HET: SEP TPO; 3.20A {Solanum pimpinellifolium} PDB: 3hgk_A* Back     alignment and structure
>2xir_A Vascular endothelial growth factor receptor 2; angiogenesis, nucleotide-binding, inhibitor, phosphorylation receptor, transferase, transmembrane; HET: 00J; 1.50A {Homo sapiens} PDB: 1vr2_A* 1ywn_A* 3vnt_A* 3c7q_A* 2oh4_A* 3u6j_A* 3efl_A* 2p2i_A* 3cjf_A* 3cjg_A* 3ewh_A* 2qu5_A* 2qu6_A* 2rl5_A* 3b8q_A* 3b8r_A* 2p2h_A* 3cp9_A* 3cpb_A* 3cpc_A* ... Back     alignment and structure
>3op5_A Serine/threonine-protein kinase VRK1; adenosine triphosphate, amino acid sequence, binding sites, domain, models, molecular; HET: REB; 2.40A {Homo sapiens} PDB: 2lav_A 2kty_A 2kul_A Back     alignment and structure
>1u46_A ACK-1, activated CDC42 kinase 1; tyrosine kinase, transferase; 2.00A {Homo sapiens} SCOP: d.144.1.7 PDB: 1u4d_A* 1u54_A* 3eqr_A* 3eqp_B* Back     alignment and structure
>2nru_A Interleukin-1 receptor-associated kinase 4; inhibitor, IRAK, transferase; HET: TPO SEP T12; 2.00A {Homo sapiens} PDB: 2nry_A* 2oib_A* 2oic_A* 2oid_A* 2o8y_A* Back     alignment and structure
>3og7_A AKAP9-BRAF fusion protein; proto-oncogene, V600E, kinase, transferase; HET: 032; 2.45A {Homo sapiens} SCOP: d.144.1.7 PDB: 4fk3_A* 3c4c_A* 3c4d_A* 3idp_A* 4g9r_A* 3ii5_A* 4e26_A* 3ppj_A* 3ppk_A* 3prf_A* 3pri_A* 3psb_A* 3psd_A* 3q4c_A* 3skc_A* 3tv4_A* 3tv6_A* 3d4q_A* 4e4x_A* 4g9c_A* ... Back     alignment and structure
>3aln_A Dual specificity mitogen-activated protein kinase; protein AMP-PNP complex, transferase; HET: ANP; 2.30A {Homo sapiens} PDB: 3alo_A* Back     alignment and structure
>2y4i_B KSR2, HKSR2, kinase suppressor of RAS 2; transferase, KSR1; HET: ATP; 3.46A {Homo sapiens} Back     alignment and structure
>3qa8_A MGC80376 protein; kinase ubiquitin-like domain, phosphorylation, kinase domain ubiquitin-like domain, kinase, substrate binding; 3.60A {Xenopus laevis} PDB: 3qad_A* 3rzf_A* Back     alignment and structure
>2j0j_A Focal adhesion kinase 1; cell migration, FERM, transferase, integrin signaling; HET: 4ST; 2.80A {Gallus gallus} PDB: 2j0k_A* Back     alignment and structure
>3lxp_A Non-receptor tyrosine-protein kinase TYK2; JAK3, inflammation, cancer, PAN inhibitor, ATP-binding nucleotide-binding, phosphoprotein, SH2 domain; HET: PTR IZA; 1.65A {Homo sapiens} PDB: 3lxn_A* 3nz0_A* 3nyx_A* 4e20_A* 4e1z_A* Back     alignment and structure
>3uim_A Brassinosteroid insensitive 1-associated receptor; kinase, protein kinase, transferase; HET: SEP TPO ANP; 2.20A {Arabidopsis thaliana} PDB: 3ulz_A* 3tl8_A* Back     alignment and structure
>3lxl_A Tyrosine-protein kinase JAK3; TYK2, inflammation, cancer, PAN inhibitor, ATP-binding mutation, membrane, nucleotide-binding, phosphoprot SCID; HET: IZA; 1.74A {Homo sapiens} PDB: 3lxk_A* 4hvd_A* 4hvg_A* 4hvh_A* 4hvi_A* 3pjc_A* 1yvj_A* Back     alignment and structure
>2jii_A Serine/threonine-protein kinase VRK3 molecule: VA related kinase 3; transferase, pseudo kinase domain, vaccinia related kinase, ATP-binding; 2.00A {Homo sapiens} Back     alignment and structure
>2buj_A Serine/threonine-protein kinase 16; transferase, ATP-binding, lipoprotein, myristate, PA phosphorylation; HET: STU; 2.6A {Homo sapiens} Back     alignment and structure
>4eut_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: BX7; 2.60A {Homo sapiens} Back     alignment and structure
>3uzp_A CKI-delta, CKID, casein kinase I isoform delta; CK1D, inhibitor, PF670462, transferase-transferase I complex; HET: 0CK; 1.94A {Homo sapiens} PDB: 3uys_A* 3uyt_A* 1cki_A 1ckj_A Back     alignment and structure
>3m2w_A MAP kinase-activated protein kinase 2; small molecule inhibitor, spiroazetidine-tetracycle, ATP-SIT inhibitor, novartis compound NVP-BXS169; HET: L8I; 2.41A {Homo sapiens} PDB: 3kga_A* 3m42_A* Back     alignment and structure
>4e5w_A Tyrosine-protein kinase JAK1; kinase domain, transferase-transferase inhibit complex; HET: PTR 0NT; 1.86A {Homo sapiens} PDB: 4e4l_A* 4e4n_A* 4ehz_A* 4ei4_A* 4fk6_A* 3eyg_A* 3eyh_A* Back     alignment and structure
>4hgt_A Casein kinase I isoform delta; CK1D, inhibitor, transferase-transferase inhibitor C; HET: 15G; 1.80A {Homo sapiens} PDB: 3uys_A* 3uyt_A* 3uzp_A* 4hnf_A* 1cki_A 1ckj_A 4hni_A* 4hok_A Back     alignment and structure
>3q4u_A Activin receptor type-1; structural genomics consortium, SGC, protein kinase, transfe; HET: LDN FLC; 1.82A {Homo sapiens} PDB: 3mtf_A* 3oom_A* 4dym_A* 3h9r_A* 3my0_A* Back     alignment and structure
>3ll6_A Cyclin G-associated kinase; transferase, protein kinase, serine/threonine kinase, cyclin clathrine, membrane trafficking, structural genomics; 2.10A {Homo sapiens} Back     alignment and structure
>3mdy_A Bone morphogenetic protein receptor type-1B; complex (isomerase-protein kinase), receptor serine/threonin structural genomics consortium, SGC; HET: LDN; 2.05A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>2w1i_A JAK2; chromosomal rearrangement, nucleotide-binding, tyrosine-protein kinase, proto-oncogene, phosphoprotein, disease mutation, SH2 domain; HET: PTR L0I; 2.60A {Homo sapiens} Back     alignment and structure
>3g2f_A Bone morphogenetic protein receptor type-2; kinase, structural genomics, structural genomics consortium, ATP-binding, disease mutation; HET: ADP; 2.35A {Homo sapiens} Back     alignment and structure
>1b6c_B TGF-B superfamily receptor type I; complex (isomerase/protein kinase), receptor serine/threonine kinase; 2.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1ias_A 2x7o_A* 3faa_A* 3kcf_A* Back     alignment and structure
>3e7e_A HBUB1, BUB1A, mitotic checkpoint serine/threonine-protein kinas; spindle assembly checkpoint, mitosis, kinase, activation, KE CDC20, ATP-binding; HET: ATP; 2.31A {Homo sapiens} Back     alignment and structure
>3uqc_A Probable conserved transmembrane protein; structural genomics, TB structural genomics consortium, TBSG fold, FHAA, transferase; 2.26A {Mycobacterium tuberculosis} PDB: 3oun_B* 3otv_A 3ouk_A Back     alignment and structure
>3sv0_A Casein kinase I-like; typical kinase domain fold, cytosol, transferase; 2.00A {Oryza sativa japonica group} Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>2vuw_A Serine/threonine-protein kinase haspin; cell cycle, transferase, CAsp8, nucleotide binding; HET: MSE 5ID MPD; 1.80A {Homo sapiens} PDB: 3f2n_A* 3e7v_A* 3dlz_A* 3fmd_A* 3iq7_A* 2wb8_A Back     alignment and structure
>3dzo_A Rhoptry kinase domain; parasitic disease, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} Back     alignment and structure
>4azs_A Methyltransferase WBDD; kinase; HET: AMP SAM; 2.15A {Escherichia coli} PDB: 4azt_A* 4azv_A* 4azw_A* Back     alignment and structure
>3en9_A Glycoprotease, O-sialoglycoprotein endopeptidase/protein kinase; endopeptidase activity, protein kinase activity; HET: TBR; 2.67A {Methanocaldococcus jannaschii} PDB: 3enh_A* 2vwb_A* Back     alignment and structure
>4aw0_A HPDK1, 3-phosphoinositide-dependent protein kinase 1; transferase, allosteric regulation, allosteric site, phosphorylation, AGC protein kinase; HET: SEP ATP MJF; 1.43A {Homo sapiens} PDB: 3hrc_A* 3hrf_A* 4a06_A* 4a07_A* 3rcj_A* 4aw1_A* 3rwq_A* 3sc1_A* 3qd0_A* 2r7b_A* 3ion_A* 3qcq_A* 3qcs_A* 3qcx_A* 3qcy_A* 3iop_A* 3qd3_A* 3qd4_A* 3h9o_A* 1uu3_A* ... Back     alignment and structure
>4fih_A Serine/threonine-protein kinase PAK 4; kinase domain, protein ATP binding, phosphorylation, transferase; HET: SEP; 1.97A {Homo sapiens} PDB: 4fig_A* 4fif_A* 4fii_A* 4fij_A* Back     alignment and structure
>3hyh_A Carbon catabolite-derepressing protein kinase; kinase domain, transferase, ATP-binding, carbohydrate metabo kinase, membrane; 2.20A {Saccharomyces cerevisiae} PDB: 3dae_A 2fh9_A 3mn3_A Back     alignment and structure
>3ubd_A Ribosomal protein S6 kinase alpha-3; kinase-inhibitor complex, induced FIT, transferase-transfera inhibitor complex; HET: SL0; 1.53A {Mus musculus} PDB: 4el9_A* 3g51_A* 2z7q_A* 2z7r_A* 2z7s_A* Back     alignment and structure
>4g3f_A NF-kappa-beta-inducing kinase; non-RD kinase, protein serine/threonine kinase, S based drug design, MAP3K14, transferase; HET: 0WB; 1.64A {Mus musculus} PDB: 4g3g_A* 4g3c_A 4dn5_A* Back     alignment and structure
>4fie_A Serine/threonine-protein kinase PAK 4; kinase domain, protein ATP binding, phosphorylation, transferase; HET: SEP ANP; 3.11A {Homo sapiens} Back     alignment and structure
>3omv_A RAF proto-oncogene serine/threonine-protein kinas; serine/threonine-protein kinase, transferase; HET: SM5; 4.00A {Homo sapiens} Back     alignment and structure
>4b9d_A Serine/threonine-protein kinase NEK1; transferase, inhibitor; HET: CK7; 1.90A {Homo sapiens} PDB: 4apc_A* Back     alignment and structure
>3v5w_A G-protein coupled receptor kinase 2; inhibitor complex, protein kinase, beta propeller, RGS homol domain; HET: 8PR; 2.07A {Homo sapiens} PDB: 3cik_A* 3krw_A* 3krx_A* 1omw_A 1ym7_A 2bcj_A* 3uzs_A 3uzt_A 3pvu_A* 3psc_A* 3pvw_A* 1bak_A Back     alignment and structure
>4g31_A Eukaryotic translation initiation factor 2-alpha; deletion mutant, catalytic domain, synthetic inhibitor, TRAN transferase inhibitor complex; HET: 0WH; 2.28A {Homo sapiens} PDB: 4g34_A* Back     alignment and structure
>4b99_A Mitogen-activated protein kinase 7; transferase, inhibitor; HET: R4L; 2.80A {Homo sapiens} Back     alignment and structure
>3fpq_A Serine/threonine-protein kinase WNK1; protein serine/threonine kinase, transferase, ATP-BIND kinase, nucleotide-binding, phosphoprotein; 1.80A {Rattus norvegicus} Back     alignment and structure
>4f9c_A Cell division cycle 7-related protein kinase; Ser/Thr protein kinase, transferase, phosphorylation, cell C cell division, mitosis, S phase; HET: 0SX; 2.08A {Homo sapiens} PDB: 4f99_A* 4f9b_A* 4f9a_A* Back     alignment and structure
>4ase_A Vascular endothelial growth factor receptor 2; transferase, angiogenesis, signaling protein, phosphorylatio receptor, inhibitor; HET: AV9; 1.83A {Homo sapiens} PDB: 4agd_A* 4asd_A* 4agc_A* Back     alignment and structure
>4asz_A BDNF/NT-3 growth factors receptor; transferase, TRKA, TRKB; 1.70A {Homo sapiens} PDB: 4at3_A* 4at4_A* 4at5_A* 3v5q_A* Back     alignment and structure
>4gt4_A Tyrosine-protein kinase transmembrane receptor RO; ATP binding, phosphorylation, transferase; 2.41A {Homo sapiens} PDB: 3zzw_A Back     alignment and structure
>4aoj_A High affinity nerve growth factor receptor; transferase, inhibitor; HET: V4Z; 2.75A {Homo sapiens} Back     alignment and structure
>4azs_A Methyltransferase WBDD; kinase; HET: AMP SAM; 2.15A {Escherichia coli} PDB: 4azt_A* 4azv_A* 4azw_A* Back     alignment and structure
>3hmm_A TGF-beta receptor type-1; ALK5, kinase, inhibitor, quinazoline, aortic aneurysm, ATP-binding, craniosynostosis, disease mutation, disulfide bond; HET: 855; 1.70A {Homo sapiens} PDB: 1vjy_A* 3gxl_A* 3tzm_A* 2wot_A* 2wou_A* 1py5_A* 1rw8_A* Back     alignment and structure
>3uto_A Twitchin; kinase, muscle sarcomere, transferase; HET: FLC P33; 2.40A {Caenorhabditis elegans} PDB: 1koa_A Back     alignment and structure
>4aw2_A Serine/threonine-protein kinase MRCK alpha; transferase, CDC42BPA; HET: 22E; 1.70A {Rattus norvegicus} PDB: 3tku_A* 3qfv_A* Back     alignment and structure
>2vd5_A DMPK protein; serine/threonine-protein kinase, kinase, transferase, ATP-BI nucleotide-binding, cardiac contractility, muscle different; HET: BI8; 2.80A {Homo sapiens} Back     alignment and structure
>3txo_A PKC-L, NPKC-ETA, protein kinase C ETA type; phosphotransferase, transferase-transferase inhibito; HET: TPO 07U; 2.05A {Homo sapiens} Back     alignment and structure
>4dc2_A Protein kinase C IOTA type; kinase, substrate, cell polarity, atypical PKC, trans transferase substrate complex; HET: TPO ADE; 2.40A {Mus musculus} Back     alignment and structure
>3rp9_A Mitogen-activated protein kinase; structural genomics, structural genomics consortium, SGC, TR; 2.40A {Toxoplasma gondii} Back     alignment and structure
>2vuw_A Serine/threonine-protein kinase haspin; cell cycle, transferase, CAsp8, nucleotide binding; HET: MSE 5ID MPD; 1.80A {Homo sapiens} PDB: 3f2n_A* 3e7v_A* 3dlz_A* 3fmd_A* 3iq7_A* 2wb8_A Back     alignment and structure
>3kex_A Receptor tyrosine-protein kinase ERBB-3; kinase domain, inactive kinase, HER3, ATP-binding, cell membrane, membrane, nucleotide-binding; HET: ANP; 2.80A {Homo sapiens} PDB: 3lmg_A* Back     alignment and structure
>3v8s_A RHO-associated protein kinase 1; dimerization, myosin, transferase, inhibitor, transf transferase inhibitor complex; HET: 0HD; 2.29A {Homo sapiens} PDB: 3twj_A* 3tv7_A* 2etr_A* 2esm_A* 2eto_A* 2etk_A* 3d9v_A* 3ncz_A* 3ndm_A* 2v55_A* 2f2u_A* 2h9v_A* Back     alignment and structure
>1o6l_A RAC-beta serine/threonine protein kinase; protein kinase, transferase, serine/threonine-protein kinase; HET: TPO ANP; 1.6A {Homo sapiens} SCOP: d.144.1.7 PDB: 2jdo_A* 2jdr_A* 2uw9_A* 2x37_A* 2x39_A* 2xh5_A* 3d0e_A* 3e87_A* 3e88_A* 3e8d_A* 1o6k_A* 1mrv_A 1mry_A 1gzn_A 1gzk_A 1gzo_A 3qkl_A* 3ocb_A* 3ow4_A* 3qkk_A* ... Back     alignment and structure
>2i0e_A Protein kinase C-beta II; serine/threonine protein kinase, transferase; HET: TPO SEP PDS; 2.60A {Homo sapiens} PDB: 3iw4_A* Back     alignment and structure
>3op5_A Serine/threonine-protein kinase VRK1; adenosine triphosphate, amino acid sequence, binding sites, domain, models, molecular; HET: REB; 2.40A {Homo sapiens} PDB: 2lav_A 2kty_A 2kul_A Back     alignment and structure
>4fr4_A YANK1, serine/threonine-protein kinase 32A; structural genomics, structural genomics consortium, SGC, TR; HET: STU; 2.29A {Homo sapiens} Back     alignment and structure
>1xjd_A Protein kinase C, theta type; PKC-theta, ATP, AMP,, transferase; HET: TPO SEP STU; 2.00A {Homo sapiens} SCOP: d.144.1.7 PDB: 2jed_A* Back     alignment and structure
>3e7e_A HBUB1, BUB1A, mitotic checkpoint serine/threonine-protein kinas; spindle assembly checkpoint, mitosis, kinase, activation, KE CDC20, ATP-binding; HET: ATP; 2.31A {Homo sapiens} Back     alignment and structure
>3fe3_A MAP/microtubule affinity-regulating kinase 3; serine/threonine protein kinase, MARK;PAR-1, UBA domai TAK1;P78;MARK3, ATP-binding; 1.90A {Homo sapiens} PDB: 2qnj_A 1y8g_A* 1zmw_A 1zmu_A 1zmv_A 2wzj_A 2r0i_A 2hak_A 3iec_A Back     alignment and structure
>3o0g_A Cell division protein kinase 5; kinase activator complex, kinase inhibitor complex, transferase-transferase activator complex; HET: 3O0; 1.95A {Homo sapiens} SCOP: d.144.1.7 PDB: 1unh_A* 1ung_A* 1unl_A* 1h4l_A Back     alignment and structure
>3a8x_A Protein kinase C IOTA type; transferase; HET: TPO; 2.00A {Homo sapiens} PDB: 3a8w_A* 1zrz_A* Back     alignment and structure
>2r5t_A Serine/threonine-protein kinase SGK1; AGC protein kinase, apoptosis, ATP-binding, cytoplasm, endoplasmic reticulum, nucleotide-binding, nucleus; HET: ANP; 1.90A {Homo sapiens} PDB: 3hdm_A* 3hdn_A* Back     alignment and structure
>3n9x_A Phosphotransferase; malaria kinase, structural genomics, structural genomics CON SGC; 2.05A {Plasmodium berghei} PDB: 3nie_A* Back     alignment and structure
>3oz6_A Mitogen-activated protein kinase 1, serine/threon protein kinase; structural genomics consortium, SGC, transferase; 2.37A {Cryptosporidium parvum iowa II} Back     alignment and structure
>1fot_A TPK1 delta, CAMP-dependent protein kinase type 1; open conformation, transferase; HET: TPO; 2.80A {Saccharomyces cerevisiae} SCOP: d.144.1.7 Back     alignment and structure
>1rdq_E PKA C-alpha, CAMP-dependent protein kinase, alpha-catalytic SU; CAMP-dependent protein kinase,catalytic mechanism, ATP hydro two nucleotide states; HET: TPO SEP ADP ATP; 1.26A {Mus musculus} SCOP: d.144.1.7 PDB: 2erz_E* 3fjq_E* 1bkx_A* 1atp_E* 1fmo_E* 1j3h_A* 1jlu_E* 1bx6_A* 1re8_A* 1rej_A* 1rek_A* 2cpk_E* 2qcs_A* 2qvs_E* 1l3r_E* 3idb_A* 3idc_A* 3o7l_D* 3ow3_A* 3tnp_C* ... Back     alignment and structure
>3pfq_A PKC-B, PKC-beta, protein kinase C beta type; phosphorylation, transferase; HET: TPO SEP ANP; 4.00A {Rattus norvegicus} PDB: 1tbn_A 1tbo_A 2e73_A Back     alignment and structure
>3niz_A Rhodanese family protein; structural genomics, structural genomics consortium, SGC, phosphotransferase, cyclin dependent kinase; HET: ADP; 2.40A {Cryptosporidium parvum} SCOP: d.144.1.7 PDB: 2qkr_A* Back     alignment and structure
>3poz_A Epidermal growth factor receptor; kinase domain, anti-oncogene, ATP-binding, cell cycle, disea mutation, glycoprotein, membrane, nucleotide-binding; HET: 03P; 1.50A {Homo sapiens} SCOP: d.144.1.7 PDB: 2itx_A* 2ity_A* 2j5f_A* 2j6m_A* 2itw_A* 1m14_A 1m17_A* 3vjo_A* 2gs6_A* 2gs2_A* 2rf9_A 4g5j_A* 1xkk_A* 2eb2_A 3gop_A 2eb3_A* 2itn_A* 2ito_A* 2itp_A* 2itq_A* ... Back     alignment and structure
>3p1a_A MYT1 kinase, membrane-associated tyrosine- and threonine-speci inhibitory kinase; structural genomics, structural genomics consortium, SGC; 1.70A {Homo sapiens} Back     alignment and structure
>1tki_A Titin; serine kinase, muscle, autoinhibition; 2.00A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>4e7w_A Glycogen synthase kinase 3; GSK3, PTyr195, transferase; HET: PTR; 3.30A {Ustilago maydis} Back     alignment and structure
>1j1b_A Glycogen synthase kinase-3 beta; complex, TAU, AMPPNP, transferase; HET: ANP; 1.80A {Homo sapiens} SCOP: d.144.1.7 PDB: 1i09_A* 1j1c_A* 2jld_A* 3m1s_A* 3pup_A* 3du8_A* 1pyx_A* 1q41_A* 1q3w_A* 1q3d_A* 1q4l_A* 3q3b_A* 1q5k_A* 3i4b_A* 3l1s_A* 1r0e_A* 3zrk_A* 3zrl_A* 3zrm_A* 4dit_A* ... Back     alignment and structure
>3ttj_A Mitogen-activated protein kinase 10; JNK3, protein kinase in transferase-transferase inhibitor complex; HET: JBI; 2.10A {Homo sapiens} PDB: 3tti_A* 1jnk_A* Back     alignment and structure
>3fxz_A Serine/threonine-protein kinase PAK 1; transferase, ATP-binding, phosphorylation, allosteric enzyme, alternative splicing, apoptosis, cell junction; HET: TPO FLL; 1.64A {Homo sapiens} SCOP: d.144.1.7 PDB: 3fy0_A* 4daw_A* 3q52_A* 3q53_A* 1yhw_A 1f3m_C 1yhv_A 2hy8_1* 3q4z_A* Back     alignment and structure
>3dzo_A Rhoptry kinase domain; parasitic disease, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} Back     alignment and structure
>2zv2_A Calcium/calmodulin-dependent protein kinase kinas; beta, camkk2, E.C.2.7.11.17, phosphorylation, AMPKK, metabolism, binding, calmodulin-binding; HET: 609; 2.40A {Homo sapiens} Back     alignment and structure
>3h4j_B AMPK kdaid, SNF1-like protein kinase SSP2; ATP-binding, nucleotide-binding, phosphoprotei serine/threonine-protein kinase, transferase; 2.80A {Schizosaccharomyces pombe} Back     alignment and structure
>3c4z_A Rhodopsin kinase; Ser/Thr kinase, RGS homology domain, G protein coupled recep kinase, GRK, GRK1, P-loop, autophosphoryl ADP, ATP-binding; HET: ADP; 1.84A {Bos taurus} PDB: 3c4x_A* 3c4y_A 3c4w_A* 3c50_A* 3c51_A* 3qc9_A* 2i94_B Back     alignment and structure
>3lzb_A Epidermal growth factor receptor; epidermal growth factor kinase domain, multitargeted small M kinase inhibitor; HET: ITI; 2.70A {Homo sapiens} Back     alignment and structure
>3g33_A Cell division protein kinase 4; Ser/Thr protein kinase, cell cycle, phosphorylation, ATP-BIN cell division, disease mutation, kinase; 3.00A {Homo sapiens} Back     alignment and structure
>2psq_A Fibroblast growth factor receptor 2; kinase domain fold consisting of N- and C-lobes, transferase; 2.40A {Homo sapiens} SCOP: d.144.1.7 PDB: 1xr0_A Back     alignment and structure
>3kul_A Ephrin type-A receptor 8; ATP-binding, kinase, nucleotide-binding, transfera phosphorylation, transmembrane, tyrosine-protein kinase; HET: PTR; 2.15A {Homo sapiens} Back     alignment and structure
>3s95_A LIMK-1, LIM domain kinase 1; structural genomics, structural genomics consortium, SGC, PR kinase, transferase-antibiotic complex; HET: STU GOL; 1.65A {Homo sapiens} Back     alignment and structure
>2izr_A Casein kinase I isoform gamma-3; serine/threonine-protein kinase, transferase, ATP- binding, phosphorylation, nucleotide-binding; HET: BRK; 1.3A {Homo sapiens} PDB: 2izs_A* 2izt_A* 2izu_A* 2chl_A* 2c47_A* 2cmw_A* Back     alignment and structure
>3mi9_A Cell division protein kinase 9; P-TEFB, HIV-1, protein binding; HET: TPO; 2.10A {Homo sapiens} PDB: 3mia_A* 4ec9_A* 4ec8_A* 3blh_A* 3blq_A* 3blr_A* 3lq5_A* 3my1_A* 3tn8_A* 3tnh_A* 3tni_A* 4bch_A* 4bci_A* 4bcj_A* 4bcf_A* Back     alignment and structure
>3tki_A Serine/threonine-protein kinase CHK1; cell checkpoint, transferase-transferase inhib complex; HET: S25; 1.60A {Homo sapiens} PDB: 2qhm_A* 2r0u_A* 3tkh_A* 2qhn_A* 2hy0_A* 2hog_A* 2hxq_A* 2hxl_A* 3f9n_A* Back     alignment and structure
>3a62_A Ribosomal protein S6 kinase beta-1; kinase domain, inactive, active, ribosomal S6 kinase, activation, alternative initiation, ATP-binding; HET: TPO STU; 2.35A {Homo sapiens} PDB: 3a61_A* 3a60_A* Back     alignment and structure
>1cm8_A Phosphorylated MAP kinase P38-gamma; phosphorylation, transferase; HET: TPO PTR ANP; 2.40A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>4hgt_A Casein kinase I isoform delta; CK1D, inhibitor, transferase-transferase inhibitor C; HET: 15G; 1.80A {Homo sapiens} PDB: 3uys_A* 3uyt_A* 3uzp_A* 4hnf_A* 1cki_A 1ckj_A 4hni_A* 4hok_A Back     alignment and structure
>1csn_A Casein kinase-1; phosphotransferase; HET: ATP; 2.00A {Schizosaccharomyces pombe} SCOP: d.144.1.7 PDB: 1eh4_A* 2csn_A* Back     alignment and structure
>3ugc_A Tyrosine-protein kinase JAK2; small molecule inhibitor, ATP binding, transferase-transfera inhibitor complex; HET: 046; 1.34A {} PDB: 3krr_A* 3lpb_A* 4aqc_A* 4e4m_A* 4f08_A* 4f09_A* 3q32_A* 3rvg_A* 4hge_A* 3tjc_A* 3tjd_A* 4bbe_A* 4bbf_A* 2b7a_A* 3fup_A* 3e64_A* 3e62_A* 3e63_A* 2xa4_A* 3iok_A* ... Back     alignment and structure
>3eb0_A Putative uncharacterized protein; kinase cryptosporidium parvum, ATP-binding, kinase, nucleoti binding; HET: PTR DRK; 2.65A {Cryptosporidium parvum iowa II} Back     alignment and structure
>4eqm_A Protein kinase; transferase; HET: ANP; 3.00A {Staphylococcus aureus subsp} Back     alignment and structure
>2v62_A Serine/threonine-protein kinase VRK2; transferase, ATP-binding, membrane, nucleotide-binding, TRAN; 1.7A {Homo sapiens} Back     alignment and structure
>1vzo_A Ribosomal protein S6 kinase alpha 5; protein kinase, transferase, phosphorylation, serine/threonine protein kinase; 1.8A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>1ob3_A PFPK5, cell division control protein 2 homolog; transferase, serine/threonine-protein kinase, ATP-binding, phosphorylation, CDK; 1.9A {Plasmodium falciparum} SCOP: d.144.1.7 PDB: 1v0p_A* 1v0o_A* 1v0b_A Back     alignment and structure
>3cbl_A C-FES, proto-oncogene tyrosine-protein kinase FES/FPS; V-FES, fujinami, avian sarcoma, viral, feline virus, SGC; HET: STU; 1.75A {Homo sapiens} PDB: 3bkb_A* 3cd3_A* 4e93_A* Back     alignment and structure
>3dls_A PAS domain-containing serine/threonine-protein KI; PAS kinase, PASK, protein kinase, drug discovery, ATP-bindin kinase, nucleotide-binding; HET: ADP; 2.30A {Homo sapiens} Back     alignment and structure
>4ejn_A RAC-alpha serine/threonine-protein kinase; AKT1, autoinhibition, allosteric inhibitor, kinase inhibitor hydrophobic collapase, ATPase; HET: 0R4; 2.19A {Homo sapiens} PDB: 3o96_A* Back     alignment and structure
>3pls_A Macrophage-stimulating protein receptor; protein kinase, CIS autophosphorylation conformation, recept tyrosine kinase, AMP-PNP, unphosphorylated; HET: ANP; 2.24A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>2pmi_A Negative RE, cyclin-dependent protein kinase PHO85; cyclin-dependent kinase, signaling protein,transfera cycle complex; HET: MES AGS; 2.90A {Saccharomyces cerevisiae} PDB: 2pk9_A* Back     alignment and structure
>3byv_A Rhoptry kinase; malaria, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} PDB: 2w1z_A Back     alignment and structure
>1nxk_A MAP kinase-activated protein kinase 2; MK2, phosphorylation, staurosporine, transfe; HET: STU; 2.70A {Homo sapiens} SCOP: d.144.1.7 PDB: 1kwp_A* 1ny3_A* 2onl_C Back     alignment and structure
>2acx_A G protein-coupled receptor kinase 6; GRK, G transferase; HET: ANP; 2.60A {Homo sapiens} PDB: 3nyn_A* 3nyo_A* Back     alignment and structure
>2yab_A Death-associated protein kinase 2; apoptosis, transferase; HET: AMP; 1.90A {Mus musculus} PDB: 2yaa_A* 2ya9_A* Back     alignment and structure
>3q60_A ROP5B; pseudokinase, transferase; HET: ATP; 1.72A {Toxoplasma gondii} PDB: 3q5z_A* Back     alignment and structure
>3f66_A Hepatocyte growth factor receptor; C-Met, protein kinase, quinoxaline, alternative splicing, ATP-binding, chromosomal rearrangement; HET: IHX; 1.40A {Homo sapiens} PDB: 3i5n_A* 3u6h_A* 3u6i_A* 4deg_A* 4deh_A* 4dei_A* 3ccn_A* 2rfn_A* 2rfs_A* 3cd8_A* 3efj_A* 3efk_A* 3lq8_A* 3zxz_A* 2wkm_A* 2wgj_A* 3zze_A* 4aoi_A* 4ap7_A* 3q6w_A* ... Back     alignment and structure
>3tt0_A Basic fibroblast growth factor receptor 1; kinase domain, transferase, transferase-transferase inhibito; HET: 07J; 2.80A {Homo sapiens} Back     alignment and structure
>1mp8_A Focal adhesion kinase 1; tyrosine protein kinase, transferase; HET: ADP; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 2ijm_A* 2etm_A* 3pxk_A* 2jkq_A* 2j0m_B* 2jkm_A* 2j0l_A* 3bz3_A* 2jko_A* 2jkk_A* Back     alignment and structure
>3qup_A Tyrosine-protein kinase receptor TYRO3; protein kinase inhibitor, receptor tyrosine kinase, spirocyc kinase domain, phosphotransfer, GAS6 ligand; HET: LUN; 1.90A {Mus musculus} Back     alignment and structure
>2y94_A 5'-AMP-activated protein kinase catalytic subunit; transferase, nucleotide-binding, staurosporine-binding, serine/threonine-protein kinase; HET: TPO STU AMP; 3.24A {Rattus norvegicus} Back     alignment and structure
>3q4u_A Activin receptor type-1; structural genomics consortium, SGC, protein kinase, transfe; HET: LDN FLC; 1.82A {Homo sapiens} PDB: 3mtf_A* 3oom_A* 4dym_A* 3h9r_A* 3my0_A* Back     alignment and structure
>1ua2_A CAK, cell division protein kinase 7; cell cycle, phosphorylation, protein-protein interaction, PR kinase, cell cycle, transferase; HET: TPO ATP; 3.02A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>3c1x_A Hepatocyte growth factor receptor; receptor tyrosine kinase, signal transduction, GRB2, SHC, ATP-binding, glycoprotein, membrane; HET: CKK; 2.17A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>3sxs_A Cytoplasmic tyrosine-protein kinase BMX; transferase-transferase inhibitor complex; HET: PP2; 1.89A {Homo sapiens} SCOP: d.144.1.7 PDB: 3sxr_A* Back     alignment and structure
>1kob_A Twitchin; kinase, intrasteric regulation; 2.30A {Aplysia californica} SCOP: d.144.1.7 Back     alignment and structure
>3ork_A Serine/threonine protein kinase; structural genomics, TB structural genomics consortium, TBSG domain, signal transduction; HET: AGS; 1.60A {Mycobacterium tuberculosis} PDB: 3ori_A* 3orl_A* 3oro_A* 3orp_A* 3ort_A* 3f61_A* 1mru_A* 3f69_A* 3orm_A* 1o6y_A* 2fum_A* Back     alignment and structure
>3qd2_B Eukaryotic translation initiation factor 2-alpha; EIF2A kinase, phosphoryalation, gene regulation; HET: TPO; 2.81A {Mus musculus} Back     alignment and structure
>2fst_X Mitogen-activated protein kinase 14; active mutants, lipids, MAP kinase insertion, autophosphorylation, transferase; HET: BOG; 1.45A {Homo sapiens} PDB: 2fso_X* 2fsl_X* 2fsm_X* 2npq_A* 2bal_A* 2baj_A* 2bak_A* 2baq_A* 2qd9_A* 1ian_A* 2rg5_A* 2rg6_A* 3bv2_A* 3bv3_A* 3bx5_A* 3c5u_A* 3cg2_A* 3l8x_A* 3mvl_A* 3mvm_A* ... Back     alignment and structure
>4e5w_A Tyrosine-protein kinase JAK1; kinase domain, transferase-transferase inhibit complex; HET: PTR 0NT; 1.86A {Homo sapiens} PDB: 4e4l_A* 4e4n_A* 4ehz_A* 4ei4_A* 4fk6_A* 3eyg_A* 3eyh_A* Back     alignment and structure
>3soa_A Calcium/calmodulin-dependent protein kinase type alpha with A beta 7 linker; phosphorylation, cytosolic, transferase-transferase inhibitor complex; HET: DB8; 3.55A {Homo sapiens} Back     alignment and structure
>3sv0_A Casein kinase I-like; typical kinase domain fold, cytosol, transferase; 2.00A {Oryza sativa japonica group} Back     alignment and structure
>3mtl_A Cell division protein kinase 16; pctaire1, indirubin, structural genomics, structural consortium, SGC, transferase; HET: FEF; 2.40A {Homo sapiens} Back     alignment and structure
>2y0a_A Death-associated protein kinase 1; transferase, calmodulin, esprit; HET: MES; 2.60A {Homo sapiens} Back     alignment and structure
>3brb_A Proto-oncogene tyrosine-protein kinase MER; ATP-binding, disease mutation, glycoprotein, nucleot binding, phosphorylation, receptor; HET: ADP; 1.90A {Homo sapiens} PDB: 3bpr_A* 2p0c_A* Back     alignment and structure
>3qyz_A Mitogen-activated protein kinase 1; transferase, serine/threonine-protein kinase, ATP-binding CE phosphorylation; HET: CME Z8B SO4; 1.46A {Rattus norvegicus} PDB: 2fys_B 1erk_A* 3qyi_A* 3erk_A* 3qyw_A* 4erk_A* 4gsb_A* 4gt3_A* 4gva_A* 2z7l_A* 2erk_A* 1gol_A* 2gph_A 3zu7_A 3zuv_A* 3o71_A 3r63_A 3c9w_A* 2y9q_A* 4fmq_A* ... Back     alignment and structure
>2qol_A Ephrin receptor; receptor tyrosine kinase, juxtamembrane segment, structural genomics, mutant, structural genomics consortium, SGC, ATP- binding; 1.07A {Homo sapiens} PDB: 2qok_A 2qoi_A 2qoo_A 2qof_A 2qod_A 2qo9_A* 2gsf_A 2qo7_A* 2qo2_A* 2qoq_A* 2qon_A* 3fxx_A* 3fy2_A 2qoc_A* 2qob_A* 3dzq_A* 2r2p_A 2hel_A 2rei_A 3dko_A* ... Back     alignment and structure
>2c30_A Serine/threonine-protein kinase PAK 6; CRIB domain, ATP-binding, transferase, nucleotide-binding; HET: SEP; 1.6A {Homo sapiens} PDB: 2f57_A* 2j0i_A* 2cdz_A* 2q0n_A* 2x4z_A* 2bva_A* Back     alignment and structure
>3vhe_A Vascular endothelial growth factor receptor 2; kinase domain, kinase, transferase-transferase inhibitor COM; HET: 42Q; 1.55A {Homo sapiens} PDB: 1y6a_A* 1y6b_A* 3vhk_A* 3vid_A* 3hng_A* Back     alignment and structure
>1u5q_A Serine/threonine protein kinase TAO2; transferase; HET: SEP; 2.10A {Rattus norvegicus} SCOP: d.144.1.7 PDB: 1u5r_A* 2gcd_A* Back     alignment and structure
>2x4f_A Myosin light chain kinase family member 4; LUNG, breast cancer, transferase, serine/threonine-protein kinase, nucleotide-binding; HET: 16X 1PE; 2.67A {Homo sapiens} Back     alignment and structure
>3uzp_A CKI-delta, CKID, casein kinase I isoform delta; CK1D, inhibitor, PF670462, transferase-transferase I complex; HET: 0CK; 1.94A {Homo sapiens} PDB: 3uys_A* 3uyt_A* 1cki_A 1ckj_A Back     alignment and structure
>1zar_A RIO2 kinase; serine kinase, winged-helix, RIO domain, ADP-Mn complex, rRNA processing, transferase; HET: ADP; 1.75A {Archaeoglobus fulgidus} SCOP: a.4.5.56 d.144.1.9 PDB: 1tqi_A* 1tqp_A* 1tqm_A* 1zao_A* Back     alignment and structure
>2ivs_A Proto-oncogene tyrosine-protein kinase receptor RET; nucleotide-binding, hirschsprung disease, phosphorylation, disease mutation; HET: ACK; 2.00A {Homo sapiens} PDB: 2ivt_A* 2ivu_A* 2x2k_A* 2x2l_A* 2x2m_A* 2ivv_A* Back     alignment and structure
>3gen_A Tyrosine-protein kinase BTK; bruton'S tyrosine kinase, 4-amino-5-(4-phenoxyphenyl)-5H- pyrrolo[3, 2-D]pyrimidin-7-YL-cyclopentane, TEC-family; HET: B43; 1.60A {Homo sapiens} PDB: 3k54_A* 3pj2_A* 3piy_A* 3piz_A* 3pj1_A* 3pix_A* 3pj3_A* 3p08_A 3ocs_A* 3oct_A* 1k2p_A Back     alignment and structure
>2qkw_B Protein kinase; three-helix bundle motif, AVRPTO-PTO duplex, layered beta- sheets, transferas; HET: SEP TPO; 3.20A {Solanum pimpinellifolium} PDB: 3hgk_A* Back     alignment and structure
>3c0i_A Peripheral plasma membrane protein CASK; neurexin, Ca2+/calmodulin dependent protein kinase, Mg synaptic plasticity, pseudokinase, maguk; HET: 3AM; 1.85A {Homo sapiens} PDB: 3c0h_A* 3c0g_A* 3mfr_A* 3mfs_A* 3mft_A 3mfu_A* 3tac_A Back     alignment and structure
>1u46_A ACK-1, activated CDC42 kinase 1; tyrosine kinase, transferase; 2.00A {Homo sapiens} SCOP: d.144.1.7 PDB: 1u4d_A* 1u54_A* 3eqr_A* 3eqp_B* Back     alignment and structure
>3gni_B Strad alpha; kinase fold, pseudokinase, alpha helical repeat protein, ADA protein, ATP-binding, cell cycle, kinase, nucleotide-bindin nucleus; HET: ATP CIT; 2.35A {Homo sapiens} PDB: 2wtk_B* Back     alignment and structure
>3rgf_A Cyclin-dependent kinase 8; protein kinase complex, transferase,transcription; HET: BAX; 2.20A {Homo sapiens} Back     alignment and structure
>3nsz_A CK II alpha, casein kinase II subunit alpha; inhibitor, transferase-transferase inhibitor CO; HET: ANP; 1.30A {Homo sapiens} SCOP: d.144.1.7 PDB: 2r7i_A 3pe1_A* 1jwh_A* 3pe2_A* 3r0t_A* 3h30_A* 3q9w_A* 3q9x_A* 3q9y_A* 3q9z_A* 3qa0_A 3bqc_A* 2rkp_A* 3c13_A* 3fwq_A 3rps_A* 3u9c_A* 4fbx_A* 3mb7_A* 3mb6_A* ... Back     alignment and structure
>3dbq_A Dual specificity protein kinase TTK; MPS1 structure, kinase activation, phosphorylation, ATP- binding, nucleotide-binding, phosphoprotein; 2.70A {Homo sapiens} Back     alignment and structure
>2jii_A Serine/threonine-protein kinase VRK3 molecule: VA related kinase 3; transferase, pseudo kinase domain, vaccinia related kinase, ATP-binding; 2.00A {Homo sapiens} Back     alignment and structure
>4euu_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: SEP BX7; 1.80A {Homo sapiens} Back     alignment and structure
>3kn6_A Ribosomal protein S6 kinase alpha-5; AMP-PNP, MSK1, MSK, ATP-binding, metal-binding, NUCL binding, serine/threonine-protein kinase, transferase; 2.00A {Homo sapiens} PDB: 3kn5_A Back     alignment and structure
>3lxl_A Tyrosine-protein kinase JAK3; TYK2, inflammation, cancer, PAN inhibitor, ATP-binding mutation, membrane, nucleotide-binding, phosphoprot SCID; HET: IZA; 1.74A {Homo sapiens} PDB: 3lxk_A* 4hvd_A* 4hvg_A* 4hvh_A* 4hvi_A* 3pjc_A* 1yvj_A* Back     alignment and structure
>4hcu_A Tyrosine-protein kinase ITK/TSK; transferase-transferase inhibitor complex; HET: 13L; 1.43A {Homo sapiens} PDB: 4hct_A* 4hcv_A* 3t9t_A* 1sm2_A* 1snu_A* 1snx_A 3v5l_A* 3v5j_A* 3v8t_A* 3v8w_A* 3qgw_A* 3qgy_A* 3miy_A* 3mj1_A* 3mj2_A* Back     alignment and structure
>3soc_A Activin receptor type-2A; structural genomics consortium, SGC, transferase, protein KI; HET: GVD; 1.95A {Homo sapiens} PDB: 3q4t_A* 4asx_A* 2qlu_A* Back     alignment and structure
>1zar_A RIO2 kinase; serine kinase, winged-helix, RIO domain, ADP-Mn complex, rRNA processing, transferase; HET: ADP; 1.75A {Archaeoglobus fulgidus} SCOP: a.4.5.56 d.144.1.9 PDB: 1tqi_A* 1tqp_A* 1tqm_A* 1zao_A* Back     alignment and structure
>2owb_A Serine/threonine-protein kinase PLK1; catalytic domain, POLO-like kinase1, transfera; HET: 626; 2.10A {Homo sapiens} PDB: 2ou7_A* 3fc2_A* 3thb_A* Back     alignment and structure
>3fme_A Dual specificity mitogen-activated protein kinase; active mutant, structural genomics consortium, SCG, binding, nucleotide-binding, phosphoprotein; HET: STU; 2.26A {Homo sapiens} PDB: 3enm_A Back     alignment and structure
>3llt_A Serine/threonine kinase-1, pflammer; lammer kinase, malaria, structural GE structural genomics consortium, SGC, transferase; HET: ANP; 2.50A {Plasmodium falciparum 3D7} Back     alignment and structure
>3m2w_A MAP kinase-activated protein kinase 2; small molecule inhibitor, spiroazetidine-tetracycle, ATP-SIT inhibitor, novartis compound NVP-BXS169; HET: L8I; 2.41A {Homo sapiens} PDB: 3kga_A* 3m42_A* Back     alignment and structure
>3uc3_A Serine/threonine-protein kinase SRK2I; SNRK2, ABA signaling, transferase; 1.90A {Arabidopsis thaliana} PDB: 3zut_A 3zuu_A 3uc4_A 3ujg_A 3udb_A Back     alignment and structure
>3pg1_A Mitogen-activated protein kinase, putative (MAP K protein); EPK Ser/Thr protein kinase fold, Ser/Thr protein kinase, TRA; 1.95A {Leishmania major} PDB: 3uib_A* Back     alignment and structure
>1rjb_A FL cytokine receptor; kinase, structure, autoinhibition, juxtamembrane domain, transferase; 2.10A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>4agu_A Cyclin-dependent kinase-like 1; transferase, phospho-mimetic; HET: D15; 2.40A {Homo sapiens} Back     alignment and structure
>3og7_A AKAP9-BRAF fusion protein; proto-oncogene, V600E, kinase, transferase; HET: 032; 2.45A {Homo sapiens} SCOP: d.144.1.7 PDB: 4fk3_A* 3c4c_A* 3c4d_A* 3idp_A* 4g9r_A* 3ii5_A* 4e26_A* 3ppj_A* 3ppk_A* 3prf_A* 3pri_A* 3psb_A* 3psd_A* 3q4c_A* 3skc_A* 3tv4_A* 3tv6_A* 3d4q_A* 4e4x_A* 4g9c_A* ... Back     alignment and structure
>3cc6_A Protein tyrosine kinase 2 beta; focal adhesion kinase, structural genomics, structural genom consortium, SGC, ATP-binding, membrane; 1.60A {Homo sapiens} PDB: 3fzs_A* 3et7_A 3fzo_A* 3fzr_A* 3fzp_A* 3fzt_A* 3h3c_A* Back     alignment and structure
>2bdw_A Hypothetical protein K11E8.1D; kinase, calmodulin activated, transferase; 1.80A {Caenorhabditis elegans} PDB: 2wel_A* 2v7o_A* 2vz6_A* 1cdm_B 1cm1_B 1cm4_B Back     alignment and structure
>2ozo_A Tyrosine-protein kinase ZAP-70; inactive ZAP-70, tandem SH2, autoinhibition, ITAM, hydrogen bonding network, TCR signaling, transferase; HET: ANP; 2.60A {Homo sapiens} Back     alignment and structure
>3mdy_A Bone morphogenetic protein receptor type-1B; complex (isomerase-protein kinase), receptor serine/threonin structural genomics consortium, SGC; HET: LDN; 2.05A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>3g2f_A Bone morphogenetic protein receptor type-2; kinase, structural genomics, structural genomics consortium, ATP-binding, disease mutation; HET: ADP; 2.35A {Homo sapiens} Back     alignment and structure
>2b9h_A MAP kinase FUS3, mitogen-activated protein kinase FUS3; transferase; HET: ADP; 1.55A {Saccharomyces cerevisiae} PDB: 2b9i_A* 2b9j_A* 2f49_A 2fa2_A 2b9f_A* 2f9g_A* Back     alignment and structure
>2rku_A Serine/threonine-protein kinase PLK1; structure of PLK1, selectivity residues, POLO-like K structure based drug design, ATP-binding; HET: R78 TLA SRT TAR; 1.95A {Homo sapiens} PDB: 2v5q_A 2yac_A* 4a4l_A* 4a4o_A* 3kb7_A* 3d5w_A* 3d5u_A* 3d5v_A 3db8_A* 3dbc_A* 3dbd_A* 3d5x_A* 3db6_A* 3dbe_A* 3dbf_A* Back     alignment and structure
>1u59_A Tyrosine-protein kinase ZAP-70; transferase; HET: STU; 2.30A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>2xrw_A Mitogen-activated protein kinase 8; transcription, MAPK signaling pathways, linear binding motif; HET: ANP; 1.33A {Homo sapiens} PDB: 1ukh_A 1uki_A* 2xs0_A* 3elj_A* 2h96_A* 2gmx_A* 2g01_A* 2no3_A* 3o2m_A* 3o17_A* 3pze_A* 3g9l_X* 2p33_A* 3cgf_A* 3cgo_A* 3g90_X* 2ok1_A* 3g9n_A* 1pmn_A* 1pmq_A* ... Back     alignment and structure
>2a19_B Interferon-induced, double-stranded RNA-activated kinase; transferase, protein biosynthesis, protein synthesis transferase complex; HET: TPO ANP; 2.50A {Homo sapiens} PDB: 2a1a_B* Back     alignment and structure
>1luf_A Muscle-specific tyrosine kinase receptor MUSK; phosphorylation, signal transduction, MASS spectrometry, transferase; 2.05A {Rattus norvegicus} SCOP: d.144.1.7 Back     alignment and structure
>2y7j_A Phosphorylase B kinase gamma catalytic chain, testis/liver isoform; transferase; HET: B49; 2.50A {Homo sapiens} PDB: 1h0t_A 1lp1_B 1q2n_A 2spz_A 3mzw_B* 1ss1_A 2jwd_A 1bdc_A 1bdd_A 1fc2_C* 2b87_A 2b88_A 1h0t_B 1lp1_A 2b87_B 2b89_A 3s1k_A Back     alignment and structure
>1t46_A HOMO sapiens V-KIT hardy-zuckerman 4 feline sarcoma viral oncogene homolog; kinase, structure, inhibitor, STI-571, gleevec, transferase activator; HET: STI; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1pkg_A* 1t45_A 3g0e_A* 3g0f_A* Back     alignment and structure
>2zmd_A Dual specificity protein kinase TTK; MPS1, T686A, ATP-binding, nucleotide-bindi phosphoprotein, serine/threonine-protein kinase; HET: 537 7PE; 2.88A {Homo sapiens} PDB: 2zmc_A* Back     alignment and structure
>3cok_A Serine/threonine-protein kinase PLK4; POLO-like kinase 4, SAK, STK18, PSI, structural genomics, protein structure initiative; HET: ANP; 2.25A {Homo sapiens} Back     alignment and structure
>2qr7_A Ribosomal protein S6 kinase alpha-3; kinase domain, RSK2, autoinhibitory, ATP-binding, nucleotide phosphorylation, serine/threonine-protein kinase; 2.00A {Mus musculus} PDB: 2qr8_A 4d9t_A* 4d9u_A* 3rny_A 2wnt_A Back     alignment and structure
>3uim_A Brassinosteroid insensitive 1-associated receptor; kinase, protein kinase, transferase; HET: SEP TPO ANP; 2.20A {Arabidopsis thaliana} PDB: 3ulz_A* 3tl8_A* Back     alignment and structure
>3a99_A Proto-oncogene serine/threonine-protein kinase PI; PIM-1, P27KIP1, peptide drug, prostate cancer, transferase; HET: ANP; 1.60A {Homo sapiens} PDB: 3bgq_A* 3bgp_A* 2obj_A* 3bgz_A* 3t9i_A* 3dcv_A* 1xws_A* 2xj1_A* 2xix_A* 2xiz_A* 2xj0_A* 2xiy_A* 2xj2_A* 3f2a_A* 1xr1_A* 1xqz_A* 3cy2_A* 3cxw_A* 3cy3_A* 2bik_B* ... Back     alignment and structure
>3kvw_A DYRK2, dual specificity tyrosine-phosphorylation-regulat 2; KI-(Y)-phosphorylation REG kinase 2, PSK-H2, kinase, structural genomics consortium; HET: SEP PTR IRB; 2.28A {Homo sapiens} PDB: 3k2l_A* 4azf_A* Back     alignment and structure
>1mqb_A Ephrin type-A receptor 2; tyrosine protein kinase, transferase; HET: ANP; 2.30A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>2w1i_A JAK2; chromosomal rearrangement, nucleotide-binding, tyrosine-protein kinase, proto-oncogene, phosphoprotein, disease mutation, SH2 domain; HET: PTR L0I; 2.60A {Homo sapiens} Back     alignment and structure
>3l9p_A Anaplastic lymphoma kinase; kinase domain, ATP-binding, glycoprotein, membrane, nucleotide-binding, phosphoprotein, proto-oncogene; 1.80A {Homo sapiens} Back     alignment and structure
>1xbb_A Tyrosine-protein kinase SYK; gleevec, STI-571, imatinib, spleen typrosine kinase, active conformation, structural genomics, structural genomix; HET: STI; 1.57A {Homo sapiens} SCOP: d.144.1.7 PDB: 1xba_A* 1xbc_A* 3fqe_A* 3fqh_A* 3fqs_A* 3emg_A* 3srv_A* 4dfl_A* 4dfn_A* 3vf8_A* 3vf9_A* Back     alignment and structure
>3ll6_A Cyclin G-associated kinase; transferase, protein kinase, serine/threonine kinase, cyclin clathrine, membrane trafficking, structural genomics; 2.10A {Homo sapiens} Back     alignment and structure
>4fvq_A Tyrosine-protein kinase JAK2; janus protein kinase, pseudokinase, ATP binding, phosphoryla transferase; HET: ATP; 1.75A {Homo sapiens} PDB: 4fvp_A* 4fvr_A* Back     alignment and structure
>3f3z_A Calcium/calmodulin-dependent protein kinase with domain and 4 calmodulin like EF...; calcium dependent protein kinase; HET: SEP DRK; 1.84A {Cryptosporidium parvum iowa II} PDB: 2qg5_A* Back     alignment and structure
>1qcf_A Haematopoetic cell kinase (HCK); tyrosine kinase-inhibitor complex, DOWN-regulated kinase, ordered activation loop; HET: PTR PP1; 2.00A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 2c0i_A* 2c0o_A* 2c0t_A* 1ad5_A* 2hck_A* 3nhn_A 3hck_A 1bu1_A 3rea_B 3rbb_B Back     alignment and structure
>4aaa_A Cyclin-dependent kinase-like 2; transferase, phospho-mimetic; HET: DKI; 1.53A {Homo sapiens} PDB: 4bbm_A* Back     alignment and structure
>4eut_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: BX7; 2.60A {Homo sapiens} Back     alignment and structure
>4fl3_A Tyrosine-protein kinase SYK; transferase; HET: ANP; 1.90A {Homo sapiens} PDB: 4fl2_A* 1a81_A* 1csy_A* 1csz_A* Back     alignment and structure
>4f0f_A Serine/threonine-protein kinase ROCO4; LRRK2, ATP-binding, nucleotide serine/threonine-protein kinase, transferase, signaling Pro; HET: ACP; 1.80A {Dictyostelium discoideum} PDB: 4f0g_A 4f1t_A* 4f1m_A* 4f1o_A* Back     alignment and structure
>1qpc_A LCK kinase; alpha beta fold, transferase; HET: PTR ANP; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1qpe_A* 1qpj_A* 2pl0_A* 3kxz_A* 3ac1_A* 2zm4_A* 2zyb_A* 2zm1_A* 3ac2_A* 3ac3_A* 3ac4_A* 3ac5_A* 3ac8_A* 3acj_A* 3ack_A* 3ad4_A* 3ad5_A* 3ad6_A* 3kmm_A* 1qpd_A* ... Back     alignment and structure
>3i6u_A CDS1, serine/threonine-protein kinase CHK2; Ser/Thr protein kinase, FHA domain, ATP-binding, cell cycle, mutation, LI-fraumeni syndrome, magnesium; 3.00A {Homo sapiens} PDB: 3i6w_A Back     alignment and structure
>1x8b_A WEE1HU, WEE1-like protein kinase; cell cycle, transferase; HET: 824; 1.81A {Homo sapiens} PDB: 3bi6_A* 3biz_A* 3cqe_A* 3cr0_A* 2in6_A* 2io6_A* 2z2w_A* Back     alignment and structure
>3lxp_A Non-receptor tyrosine-protein kinase TYK2; JAK3, inflammation, cancer, PAN inhibitor, ATP-binding nucleotide-binding, phosphoprotein, SH2 domain; HET: PTR IZA; 1.65A {Homo sapiens} PDB: 3lxn_A* 3nz0_A* 3nyx_A* 4e20_A* 4e1z_A* Back     alignment and structure
>1p4o_A Insulin-like growth factor I receptor protein; IGF-1R, kinase domain, hormone-growth factor complex; 1.50A {Homo sapiens} SCOP: d.144.1.7 PDB: 1m7n_A 3lvp_A* 3lw0_A* 1jqh_A* 2zm3_A* 3f5p_A* 3i81_A* 2oj9_A* 3nw5_A* 3nw6_A* 3nw7_A* 3o23_A* 3qqu_A* 3d94_A* 1k3a_A* 2z8c_A* 1ir3_A* 1gag_A* 1irk_A 3bu3_A* ... Back     alignment and structure
>2buj_A Serine/threonine-protein kinase 16; transferase, ATP-binding, lipoprotein, myristate, PA phosphorylation; HET: STU; 2.6A {Homo sapiens} Back     alignment and structure
>2yex_A Serine/threonine-protein kinase CHK1; transferase, cell cycle; HET: YEX; 1.30A {Homo sapiens} PDB: 2x8e_A* 2ydk_A* 2ydj_A* 2yer_A* 2ydi_A* 1nvq_A* 1nvr_A* 1nvs_A* 2wmq_A* 2wmr_A* 2wms_A* 2wmt_A* 2wmu_A* 2wmv_A* 2wmw_A* 2wmx_A* 2x8d_A* 2x8i_A* 2xey_A* 2xez_A* ... Back     alignment and structure
>4exu_A Mitogen-activated protein kinase 13; P38 kinase, transferase; 1.70A {Homo sapiens} PDB: 4eyj_A* 4eym_A* 3coi_A Back     alignment and structure
>3fdn_A Serine/threonine-protein kinase 6; aurora kinase inhibitors, virtual screening, X-RAY CO- crystal analysis, structure-based drug design (SBDD); HET: MMH; 1.90A {Homo sapiens} SCOP: d.144.1.7 PDB: 3k5u_A* 3m11_A* 2c6e_A* 1muo_A* 2bmc_A* 2j4z_A* 1ol6_A* 3up2_A* 3unz_A* 3uo5_A* 3uo6_A* 3uod_A* 3uoh_A* 3uoj_A* 3uok_A* 3uo4_A* 3uol_A* 3up7_A* 4dea_A* 4deb_A* ... Back     alignment and structure
>2pvf_A Fibroblast growth factor receptor 2; kinase domain fold consisting of N- and C-lobes, transferase; HET: PTR ACP; 1.80A {Homo sapiens} PDB: 3cly_A* 2pzr_A* 2pzp_A* 2pvy_A* 2pz5_A* 2q0b_A* 2pwl_A* 2py3_A* 3ri1_A* 1gjo_A 1oec_A* 3b2t_A* 3gql_A* 3gqi_A* 1fgk_A 1fgi_A* 1agw_A 2fgi_A* 3js2_A* 3ky2_A ... Back     alignment and structure
>3lm5_A Serine/threonine-protein kinase 17B; STK17B, serine/threonine kinase 17B, DRAK2, DAP kinase relat apoptosis-inducing protein kinase 2; HET: QUE; 2.29A {Homo sapiens} PDB: 3lm0_A* Back     alignment and structure
>1blx_A Cyclin-dependent kinase 6; inhibitor protein, cyclin-dependent kinase, cell cycle control, alpha/beta, complex (inhibitor protein/kinase); 1.90A {Homo sapiens} SCOP: d.144.1.7 PDB: 1bi7_A 1bi8_A 1g3n_A 2f2c_B* 1jow_B* 2euf_B* 1xo2_B* 3nup_A* 3nux_A* 2w9z_B 2w99_B 2w96_B 2w9f_B Back     alignment and structure
>1opk_A P150, C-ABL, proto-oncogene tyrosine-protein kinase ABL1; transferase; HET: MYR P16; 1.80A {Mus musculus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1opl_A* 2fo0_A* 2abl_A Back     alignment and structure
>3is5_A Calcium-dependent protein kinase; CDPK, structural genomics, parasitology, structural genomics consortium, SGC, ATP-binding, nucleotide-binding; HET: ANP; 2.55A {Toxoplasma gondii} Back     alignment and structure
>3e3p_A Protein kinase, putative glycogen synthase kinase; leishmaniasis, transferase; 2.00A {Leishmania major} Back     alignment and structure
>2i1m_A Macrophage colony-stimulating factor 1 receptor; kinase domain, kinase inhibitor complex, transferase; HET: 5CN; 1.80A {Homo sapiens} PDB: 3bea_A* 3lcd_A* 2i0y_A* 2i0v_A* 3dpk_A* 3krj_A* 3krl_A* 2ogv_A 3lco_A* Back     alignment and structure
>2xir_A Vascular endothelial growth factor receptor 2; angiogenesis, nucleotide-binding, inhibitor, phosphorylation receptor, transferase, transmembrane; HET: 00J; 1.50A {Homo sapiens} PDB: 1vr2_A* 1ywn_A* 3vnt_A* 3c7q_A* 2oh4_A* 3u6j_A* 3efl_A* 2p2i_A* 3cjf_A* 3cjg_A* 3ewh_A* 2qu5_A* 2qu6_A* 2rl5_A* 3b8q_A* 3b8r_A* 2p2h_A* 3cp9_A* 3cpb_A* 3cpc_A* ... Back     alignment and structure
>2ac3_A MAP kinase-interacting serine/threonine kinase 2; DFD motif, transferase; 2.10A {Homo sapiens} PDB: 2hw7_A* 2ac5_A* 2hw6_A Back     alignment and structure
>1zy4_A Serine/threonine-protein kinase GCN2; translation regulator, signal transduction, acid starvation, starvation stress response; 1.95A {Saccharomyces cerevisiae} PDB: 1zy5_A* 1zyd_A* 1zyc_A* 1zxe_A Back     alignment and structure
>2nru_A Interleukin-1 receptor-associated kinase 4; inhibitor, IRAK, transferase; HET: TPO SEP T12; 2.00A {Homo sapiens} PDB: 2nry_A* 2oib_A* 2oic_A* 2oid_A* 2o8y_A* Back     alignment and structure
>3gbz_A Kinase, CMGC CDK; ssgcid, ATP-binding, nucleotide-binding, serine/threonine-protein kinase, transferase; 1.85A {Giardia lamblia} PDB: 3gc0_A* Back     alignment and structure
>3coi_A Mitogen-activated protein kinase 13; P38D, P38delta, ERK, MAP kinase, PMK, STK26, stress-activated protein kinase, structural genomics, PSI; 2.09A {Homo sapiens} Back     alignment and structure
>2vgo_A Serine/threonine-protein kinase 12-A; nucleotide-binding, serine/threonine-protein kinase, ATP-binding, transferase, coiled coil, cell division, kinase; HET: TPO AD5; 1.7A {Xenopus laevis} PDB: 2bfx_A* 2vgp_A* 3ztx_A* 2vrx_A* 2bfy_A* 4af3_A* 3dj6_A* 3d15_A* 3d2i_A* 3d2k_A* 3d14_A* 3dj5_A* 3dj7_A* 3daj_A* 1ol5_A* 1ol7_A* 2x6d_A* 2x6e_A* 2xng_A* 2dwb_A* ... Back     alignment and structure
>2eu9_A Dual specificity protein kinase CLK3; kinase domain, transferase; 1.53A {Homo sapiens} PDB: 2wu6_A* 2wu7_A* 3raw_A* 2exe_A 3nr9_A* Back     alignment and structure
>1fvr_A Tyrosine-protein kinase TIE-2; tyrosine kinase, transferase; 2.20A {Homo sapiens} SCOP: d.144.1.7 PDB: 2oo8_X* 2osc_A* 2p4i_A* 3l8p_A* 2wqb_A* Back     alignment and structure
>3p86_A Serine/threonine-protein kinase CTR1; ETR1, ERS1, ETR2, phosphorylation, transferase; HET: STU; 2.50A {Arabidopsis thaliana} PDB: 3ppz_A* Back     alignment and structure
>3t9t_A Tyrosine-protein kinase ITK/TSK; kinase domain, alpha/beta, ATP binding, phosphorylation, intracellular, transferase-transferase inhibitor complex; HET: IAQ; 1.65A {Homo sapiens} PDB: 3v5l_A* 3v5j_A* 3v8t_A* 3v8w_A* 1sm2_A* 1snu_A* 1snx_A 3qgw_A* 3qgy_A* 3miy_A* 3mj1_A* 3mj2_A* Back     alignment and structure
>2wtk_C Serine/threonine-protein kinase 11; transferase-metal-binding protein complex, transferase metal protein complex, nucleus; HET: ANP; 2.65A {Homo sapiens} Back     alignment and structure
>2w4o_A Calcium/calmodulin-dependent protein kinase type IV; calmodulin-binding, nucleotide-binding, serine/threonine-protein kinase, ATP-binding; HET: DKI; 2.17A {Homo sapiens} Back     alignment and structure
>1wak_A Serine/threonine-protein kinase SPRK1; SRPK, transferase, alternative splicing, ATP-binding, chromosome partition, differentiation, mRNA processing; 1.73A {Homo sapiens} PDB: 1wbp_A* 3beg_A* 2x7g_A* Back     alignment and structure
>1phk_A Phosphorylase kinase; glycogen metabolism, transferase, serine/threonine-protein, ATP-binding, calmodulin-binding; HET: ATP; 2.20A {Oryctolagus cuniculus} SCOP: d.144.1.7 PDB: 1ql6_A* 2phk_A* Back     alignment and structure
>1k9a_A Carboxyl-terminal SRC kinase; COOH-terminal SRC kinase, CSK, SFK, signal transduction, SH2, SH3, SRC homology, tyrosine kinase; 2.50A {Rattus norvegicus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1jeg_A Back     alignment and structure
>2a2a_A Death-associated protein kinase 2; autoinhibition, transferase; 1.47A {Homo sapiens} PDB: 2cke_A* 1wmk_A 1z9x_A 2a27_A 2x0g_A 2xuu_A* 2w4k_A* 2xzs_A Back     alignment and structure
>1z57_A Dual specificity protein kinase CLK1; protein tyrosine kinase, splicing, human, 10Z-hymendialdisine, structural genomics; HET: DBQ; 1.70A {Homo sapiens} PDB: 2vag_A* Back     alignment and structure
>1fmk_A C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyrosine kinase, phosphorylation, SH2, SH3, phosphotyrosine, proto-oncogene, phosphotransferase; HET: PTR; 1.50A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1y57_A* 2src_A* 1ksw_A* 2ptk_A* 1yol_A* 2oiq_A* 3d7t_B* 3dqx_A* 3el7_A* 3el8_A* 3en4_A* 3en5_A* 3en6_A* 3en7_A* 3f6x_A* 3g6g_A* 3uqf_A* 3uqg_A* 4agw_A* 3oez_A* ... Back     alignment and structure
>2iwi_A Serine/threonine-protein kinase PIM-2; nucleotide-binding, cancer, leukemia, transferase, ATP-binding, proto- oncogene, phosphorylation; HET: HB1; 2.80A {Homo sapiens} Back     alignment and structure
>3a7i_A MST3 kinase, serine/threonine kinase 24 (STE20 homolog, yeast); two-LOBE protein kinase fold, ATP-binding, nucleotid binding, transferase; HET: TPO ADE; 1.45A {Homo sapiens} PDB: 3a7g_A* 3a7h_A* 3a7f_A* 3a7j_A* 3ckw_A 3ckx_A* 3ggf_A* 2xik_A* Back     alignment and structure
>2ycf_A Serine/threonine-protein kinase CHK2; transferase, anticancer, anticancer drug design; HET: YCF; 1.77A {Homo sapiens} PDB: 2yiq_A* 2w7x_A* 2ycq_A* 2ycs_A* 2w0j_A* 2yir_A* 2yit_A* 2wtj_A* 2cn8_A* 2wtc_A* 2wtd_A* 2wti_A* 2cn5_A* 2xbj_A* 2xm8_A* 2xm9_A* 2xk9_A* 2ycr_A* Back     alignment and structure
>3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* Back     alignment and structure
>2vwi_A Serine/threonine-protein kinase OSR1; STE kinase, hypertension, transferase; HET: ANP; 2.15A {Homo sapiens} PDB: 3dak_A* Back     alignment and structure
>3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* Back     alignment and structure
>3kk8_A Calcium/calmodulin dependent protein kinase II; ATP-binding, nucleotide-binding, serine/threonine-protein kinase, transferase; HET: TPO; 1.72A {Caenorhabditis elegans} PDB: 3kk9_A* 3kl8_A 2vn9_A* 3bhh_A* Back     alignment and structure
>2i6l_A Mitogen-activated protein kinase 6; MAPK6, ERK3, extracellular signal regulated kinase 3, serine phosphorylation, threonine phosphorylation; 2.25A {Homo sapiens} Back     alignment and structure
>3kfa_A Tyrosine-protein kinase ABL1; CML, drug resistance, inhibitor, ATP-binding, nucleotide-binding, oncogene, TRAN; HET: B91; 1.22A {Mus musculus} SCOP: d.144.1.7 PDB: 2qoh_A* 3kf4_A* 3k5v_A* 1fpu_A* 1m52_A* 1iep_A* 2hzn_A* 1opj_A* 3ms9_A* 3mss_A* 3ik3_A* 2z60_A* 2e2b_A* 3pyy_A* 3oxz_A* 2g1t_A* 3ue4_A* 3oy3_A* 2hiw_A* 2v7a_A* ... Back     alignment and structure
>2j0j_A Focal adhesion kinase 1; cell migration, FERM, transferase, integrin signaling; HET: 4ST; 2.80A {Gallus gallus} PDB: 2j0k_A* Back     alignment and structure
>1zth_A RIO1 serine protein kinase; ribosome biogenesis, rRNA, ADP, manganese, transferase; HET: ADP; 1.89A {Archaeoglobus fulgidus} PDB: 1zp9_A* 1ztf_A* Back     alignment and structure
>3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* Back     alignment and structure
>2x7f_A TRAF2 and NCK-interacting protein kinase; serine/threonine-protein kinase, phosphoprotein; HET: 824; 2.80A {Homo sapiens} Back     alignment and structure
>3com_A Serine/threonine-protein kinase 4; MST1, STE20-like kinase, PSI, structural genomics, protein structure initiative; HET: TPO; 2.20A {Homo sapiens} Back     alignment and structure
>1byg_A CSK, protein (C-terminal SRC kinase); protein kinase, phosphorylation, staurosporine, transferase; HET: STU; 2.40A {Homo sapiens} SCOP: d.144.1.7 PDB: 3d7u_A 3d7t_A* Back     alignment and structure
>2wqm_A Serine/threonine-protein kinase NEK7; ATP-binding, polymorphism, metal-binding, cell cycle kinase, mitosis, cytoplasm, magnesium, transferase; 2.10A {Homo sapiens} PDB: 2wqn_A* Back     alignment and structure
>2r3i_A Cell division protein kinase 2; serine/threonine-protein kinase, cell cycle, inhibition, cyclin-dependent kinase, cancer, ATP-binding; HET: SCF; 1.28A {Homo sapiens} PDB: 2r3j_A* 2r3k_A* 2r3l_A* 2r3m_A* 2r3n_A* 2r3o_A* 2r3p_A* 2r3q_A* 1jvp_P* 1buh_A 1ckp_A* 1di8_A* 1dm2_A* 1f5q_A 1fin_A* 1fq1_B* 1fvt_A* 1fvv_A* 1g5s_A* 1gih_A* ... Back     alignment and structure
>3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} Back     alignment and structure
>2h34_A Serine/threonine-protein kinase PKNE; apoenzyme, transferase; 2.80A {Mycobacterium tuberculosis} Back     alignment and structure
>3fhr_A MAP kinase-activated protein kinase 3; kinase-inhibitor complex, ATP-binding, cytoplasm, nucleotide-binding, nucleus, phosphoprotein, polymorphism; HET: P4O; 1.90A {Homo sapiens} PDB: 3fxw_A* 3r1n_A* 3she_A* 2oza_A 3fyk_X* 3fyj_X* 2p3g_X* 3ka0_A* 3fpm_A* 2pzy_A* 3a2c_A* 3kc3_A* 3gok_A* 2jbo_A* 2jbp_A* 3r2y_A* 3r30_A* 3r2b_A* Back     alignment and structure
>2h6d_A 5'-AMP-activated protein kinase catalytic subunit alpha-2; ATP-binding, cholesterol biosynthesis, fatty acid biosynthesis;kinase, lipid synthesis; 1.85A {Homo sapiens} PDB: 3aqv_A* 2yza_A* Back     alignment and structure
>2h8h_A Proto-oncogene tyrosine-protein kinase SRC; SRC kinase, transferase; HET: PTR H8H; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 Back     alignment and structure
>1b6c_B TGF-B superfamily receptor type I; complex (isomerase/protein kinase), receptor serine/threonine kinase; 2.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1ias_A 2x7o_A* 3faa_A* 3kcf_A* Back     alignment and structure
>2y4i_B KSR2, HKSR2, kinase suppressor of RAS 2; transferase, KSR1; HET: ATP; 3.46A {Homo sapiens} Back     alignment and structure
>3bhy_A Death-associated protein kinase 3; death associated kinase, DAPK3, ZIP kinase, ZIPK, DAP kinase like kinase, DLK, structural genomics consortium; HET: 7CP; 1.24A {Homo sapiens} PDB: 3bqr_A* 2j90_A* 1yrp_A* 2yak_A* 2y4p_A* 3f5u_A* 1jks_A 1jkk_A* 1ig1_A* 1jkl_A 1jkt_A 3eh9_A* 3eha_A* 3f5g_A* 1p4f_A* 1wvw_A 1wvx_A* 1wvy_A* 2w4j_A* 3dgk_A ... Back     alignment and structure
>3hko_A Calcium/calmodulin-dependent protein kinase with domain and 2 calmodulin-like EF...; structural genomics, protist parasite; HET: ANP; 1.80A {Cryptosporidium parvum iowa II} Back     alignment and structure
>1q8y_A SR protein kinase; transferase; HET: ADP ADE; 2.05A {Saccharomyces cerevisiae} SCOP: d.144.1.7 PDB: 1q8z_A 1q97_A* 1q99_A* 1how_A 2jd5_A Back     alignment and structure
>3dtc_A Mitogen-activated protein kinase kinase kinase 9; mixed-lineage kinase, MLK family, MLK1 and MLK3 subtype selective inhibitors; HET: VIN; 2.60A {Homo sapiens} SCOP: d.144.1.0 Back     alignment and structure
>1t4h_A Serine/threonine-protein kinase WNK1; protein serine/threonine kinase, transferase; 1.80A {Rattus norvegicus} PDB: 3fpq_A Back     alignment and structure
>2pml_X PFPK7, Ser/Thr protein kinase; phosphorylati transferase, transferase; HET: ANP; 2.60A {Plasmodium falciparum} PDB: 2pmn_X* 2pmo_X* Back     alignment and structure
>3cek_A Dual specificity protein kinase TTK; HMPS1, PYT, ESK, phosphotyros picked threonine kinase, SGC, structural genomics consortiu binding; HET: 7PE; 2.30A {Homo sapiens} PDB: 3gfw_A* 3h9f_A* 2x9e_A* 3hmp_A* 3hmn_A* 3hmo_A* Back     alignment and structure
>3p23_A Serine/threonine-protein kinase/endoribonuclease; kinase domain, kinase and RNAse function, ATP binding ssRNA dephosphorylated, hydrolase; HET: ADP; 2.70A {Homo sapiens} Back     alignment and structure
>2j7t_A Serine/threonine-protein kinase 10; transferase, ATP-binding, cell cycle progression, phosphorylation, disease mutation, nucleotide- binding; HET: 274; 2.0A {Homo sapiens} PDB: 4aot_A* 3zz2_A* 2j51_A* 2jfl_A* 2jfm_A* 2uv2_A* Back     alignment and structure
>3aln_A Dual specificity mitogen-activated protein kinase; protein AMP-PNP complex, transferase; HET: ANP; 2.30A {Homo sapiens} PDB: 3alo_A* Back     alignment and structure
>2vx3_A Dual specificity tyrosine-phosphorylation- regula kinase 1A; serine/threonine-protein kinase, minibrain homolog, nucleotide-binding, transferase; HET: PTR D15 P6G; 2.40A {Homo sapiens} PDB: 2wo6_A* 3anq_A* 3anr_A* Back     alignment and structure
>2clq_A Mitogen-activated protein kinase kinase kinase 5; transferase, metal-binding, apoptosis; HET: STU; 2.3A {Homo sapiens} Back     alignment and structure
>2w5a_A Serine/threonine-protein kinase NEK2; Ser/Thr protein kinase, nucleus, meiosis, mitosis, cytoplasm, metal-binding, phosphoprotein; HET: ADP; 1.55A {Homo sapiens} PDB: 2wqo_A* 2xk3_A* 2xk4_A* 2xk6_A* 2xk7_A* 2xk8_A* 2xkc_A* 2xkd_A* 2xke_A* 2xkf_A* 2xnm_A* 2xnn_A* 2xno_A* 2xnp_A* 4afe_A* 2jav_A* 2w5b_A* 2w5h_A 4a4x_A* Back     alignment and structure
>2rio_A Serine/threonine-protein kinase/endoribonuclease IRE1; protein-nucleotide complex, ATP-binding, endoplasmic reticulum, glycoprotein; HET: ADP; 2.40A {Saccharomyces cerevisiae} PDB: 3lj0_A* 3lj1_A* 3lj2_A* 3fbv_A* 3sdm_A* 3sdj_A* Back     alignment and structure
>2dyl_A Dual specificity mitogen-activated protein kinase kinase 7; MKK7, activated mutant, ATP-binding, structural genomics, NPPSFA; 2.45A {Homo sapiens} Back     alignment and structure
>3en9_A Glycoprotease, O-sialoglycoprotein endopeptidase/protein kinase; endopeptidase activity, protein kinase activity; HET: TBR; 2.67A {Methanocaldococcus jannaschii} PDB: 3enh_A* 2vwb_A* Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>2jam_A Calcium/calmodulin-dependent protein kinase type 1G; transferase, kinase, membrane, ATP-binding, prenylation, serine/threonine-protein kinase, alternative splicing; HET: J60; 1.7A {Homo sapiens} PDB: 2jc6_A* 1a06_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 305
d2j4za1263 d.144.1.7 (A:126-388) Aurora-related kinase 1 (aur 7e-37
d2j4za1263 d.144.1.7 (A:126-388) Aurora-related kinase 1 (aur 3e-17
d1yhwa1293 d.144.1.7 (A:249-541) pak1 {Human (Homo sapiens) [ 2e-34
d1yhwa1 293 d.144.1.7 (A:249-541) pak1 {Human (Homo sapiens) [ 2e-14
d1a06a_307 d.144.1.7 (A:) Calmodulin-dependent protein kinase 3e-34
d1a06a_ 307 d.144.1.7 (A:) Calmodulin-dependent protein kinase 8e-09
d1koaa2350 d.144.1.7 (A:5915-6264) Twitchin, kinase domain {C 5e-34
d1koaa2 350 d.144.1.7 (A:5915-6264) Twitchin, kinase domain {C 1e-14
d1uu3a_288 d.144.1.7 (A:) 3-phosphoinositide dependent protei 8e-33
d1uu3a_ 288 d.144.1.7 (A:) 3-phosphoinositide dependent protei 1e-13
d1jksa_293 d.144.1.7 (A:) Death-associated protein kinase, Da 2e-32
d1jksa_ 293 d.144.1.7 (A:) Death-associated protein kinase, Da 7e-07
d1koba_352 d.144.1.7 (A:) Twitchin, kinase domain {California 3e-32
d1koba_ 352 d.144.1.7 (A:) Twitchin, kinase domain {California 5e-14
d1tkia_321 d.144.1.7 (A:) Titin, kinase domain {Human (Homo s 3e-31
d1tkia_ 321 d.144.1.7 (A:) Titin, kinase domain {Human (Homo s 5e-13
d1xjda_320 d.144.1.7 (A:) Protein kinase C, theta type {Human 2e-30
d1xjda_ 320 d.144.1.7 (A:) Protein kinase C, theta type {Human 2e-11
d1u5ra_309 d.144.1.7 (A:) Serine/threonine protein kinase TAO 2e-30
d1u5ra_ 309 d.144.1.7 (A:) Serine/threonine protein kinase TAO 2e-16
d1fota_316 d.144.1.7 (A:) cAMP-dependent PK, catalytic subuni 3e-29
d1fota_ 316 d.144.1.7 (A:) cAMP-dependent PK, catalytic subuni 4e-11
d2java1269 d.144.1.7 (A:3-271) Serine/threonine-protein kinas 5e-29
d2java1269 d.144.1.7 (A:3-271) Serine/threonine-protein kinas 7e-16
d1phka_277 d.144.1.7 (A:) gamma-subunit of glycogen phosphory 1e-28
d1phka_ 277 d.144.1.7 (A:) gamma-subunit of glycogen phosphory 2e-15
d1t4ha_270 d.144.1.7 (A:) Protein kinase wnk1 {Human (Homo sa 1e-28
d1t4ha_270 d.144.1.7 (A:) Protein kinase wnk1 {Human (Homo sa 6e-14
d1nvra_271 d.144.1.7 (A:) Cell cycle checkpoint kinase chk1 { 2e-28
d1nvra_ 271 d.144.1.7 (A:) Cell cycle checkpoint kinase chk1 { 2e-16
d1o6ya_277 d.144.1.7 (A:) Mycobacterial protein kinase PknB, 2e-28
d1o6ya_ 277 d.144.1.7 (A:) Mycobacterial protein kinase PknB, 1e-08
d1byga_262 d.144.1.7 (A:) Carboxyl-terminal src kinase (csk) 8e-28
d1byga_ 262 d.144.1.7 (A:) Carboxyl-terminal src kinase (csk) 1e-11
d2jfla1288 d.144.1.7 (A:21-308) STE20-like serine/threonine-p 1e-27
d2jfla1 288 d.144.1.7 (A:21-308) STE20-like serine/threonine-p 3e-19
d1s9ja_322 d.144.1.7 (A:) Dual specificity mitogen-activated 2e-27
d1s9ja_ 322 d.144.1.7 (A:) Dual specificity mitogen-activated 2e-15
d1uwha_276 d.144.1.7 (A:) B-Raf kinase {Human (Homo sapiens) 1e-26
d1uwha_ 276 d.144.1.7 (A:) B-Raf kinase {Human (Homo sapiens) 4e-16
d1xbba_277 d.144.1.7 (A:) Tyrosine-protein kinase SYK {Human 1e-25
d1xbba_ 277 d.144.1.7 (A:) Tyrosine-protein kinase SYK {Human 3e-11
d1xwsa_273 d.144.1.7 (A:) Proto-oncogene serine/threonine-pro 2e-25
d1xwsa_ 273 d.144.1.7 (A:) Proto-oncogene serine/threonine-pro 5e-11
d1sm2a_263 d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Hu 8e-25
d1sm2a_ 263 d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Hu 2e-10
d2ozaa1335 d.144.1.7 (A:51-385) MAP kinase activated protein 9e-25
d2ozaa1 335 d.144.1.7 (A:51-385) MAP kinase activated protein 3e-12
d1ua2a_299 d.144.1.7 (A:) Cell division protein kinase 7, CDK 1e-24
d1ua2a_ 299 d.144.1.7 (A:) Cell division protein kinase 7, CDK 3e-10
d1fmka3285 d.144.1.7 (A:249-533) c-src tyrosine kinase {Human 2e-24
d1fmka3 285 d.144.1.7 (A:249-533) c-src tyrosine kinase {Human 1e-12
d1k2pa_258 d.144.1.7 (A:) Bruton's tyrosine kinase (Btk) {Hum 5e-24
d1k2pa_258 d.144.1.7 (A:) Bruton's tyrosine kinase (Btk) {Hum 1e-10
d1o6la_337 d.144.1.7 (A:) Pkb kinase (Akt-2) {Human (Homo sap 9e-24
d1o6la_ 337 d.144.1.7 (A:) Pkb kinase (Akt-2) {Human (Homo sap 2e-12
d1u59a_285 d.144.1.7 (A:) Tyrosine-protein kinase ZAP-70 {Hum 6e-23
d1u59a_ 285 d.144.1.7 (A:) Tyrosine-protein kinase ZAP-70 {Hum 8e-13
d1fvra_309 d.144.1.7 (A:) Tie2 kinase {Human (Homo sapiens) [ 1e-22
d1fvra_ 309 d.144.1.7 (A:) Tie2 kinase {Human (Homo sapiens) [ 3e-12
d1u46a_273 d.144.1.7 (A:) Activated CDC42 kinase 1, ACK1 {Hum 1e-22
d1u46a_ 273 d.144.1.7 (A:) Activated CDC42 kinase 1, ACK1 {Hum 5e-12
d1qpca_272 d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Hom 5e-22
d1qpca_ 272 d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Hom 1e-12
d1omwa3364 d.144.1.7 (A:186-549) G-protein coupled receptor k 5e-22
d1omwa3 364 d.144.1.7 (A:186-549) G-protein coupled receptor k 7e-13
d1cm8a_346 d.144.1.7 (A:) MAP kinase p38-gamma {Human (Homo s 7e-22
d1cm8a_ 346 d.144.1.7 (A:) MAP kinase p38-gamma {Human (Homo s 3e-09
d2ogqa1124 d.223.1.2 (A:371-494) Serine/threonine-protein kin 9e-22
d1q5ka_350 d.144.1.7 (A:) Glycogen synthase kinase-3 beta (Gs 1e-21
d1q5ka_ 350 d.144.1.7 (A:) Glycogen synthase kinase-3 beta (Gs 4e-13
d1mp8a_273 d.144.1.7 (A:) Focal adhesion kinase 1 (fak) {Huma 2e-21
d1mp8a_ 273 d.144.1.7 (A:) Focal adhesion kinase 1 (fak) {Huma 7e-12
d1r0pa_311 d.144.1.7 (A:) Hepatocyte growth factor receptor, 3e-21
d1r0pa_ 311 d.144.1.7 (A:) Hepatocyte growth factor receptor, 3e-08
d1rjba_325 d.144.1.7 (A:) Fl cytokine receptor {Human (Homo s 3e-21
d1rjba_ 325 d.144.1.7 (A:) Fl cytokine receptor {Human (Homo s 5e-14
d1gz8a_298 d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {Human (H 5e-21
d1gz8a_ 298 d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {Human (H 1e-09
d1jpaa_299 d.144.1.7 (A:) ephb2 receptor tyrosine kinase {Mou 5e-21
d1jpaa_ 299 d.144.1.7 (A:) ephb2 receptor tyrosine kinase {Mou 2e-13
d1ob3a_286 d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {(Plasmod 2e-20
d1ob3a_ 286 d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {(Plasmod 2e-11
d1vzoa_322 d.144.1.7 (A:) Ribosomal protein S6 kinase alpha 5 2e-20
d1vzoa_ 322 d.144.1.7 (A:) Ribosomal protein S6 kinase alpha 5 1e-09
d1csna_293 d.144.1.7 (A:) Casein kinase-1, CK1 {Fission yeast 9e-20
d1csna_ 293 d.144.1.7 (A:) Casein kinase-1, CK1 {Fission yeast 6e-09
d1rdqe_350 d.144.1.7 (E:) cAMP-dependent PK, catalytic subuni 1e-19
d1rdqe_ 350 d.144.1.7 (E:) cAMP-dependent PK, catalytic subuni 6e-13
d1fgka_299 d.144.1.7 (A:) Fibroblast growth factor receptor 1 1e-19
d1fgka_ 299 d.144.1.7 (A:) Fibroblast growth factor receptor 1 5e-10
d1xkka_317 d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb- 1e-19
d1xkka_ 317 d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb- 2e-12
d1ckia_299 d.144.1.7 (A:) Casein kinase-1, CK1 {Rat (Rattus n 2e-19
d1ckia_ 299 d.144.1.7 (A:) Casein kinase-1, CK1 {Rat (Rattus n 2e-08
d1opja_287 d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mou 3e-19
d1opja_ 287 d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mou 8e-12
d1blxa_305 d.144.1.7 (A:) Cyclin-dependent PK, CDK6 {Human (H 3e-19
d1blxa_ 305 d.144.1.7 (A:) Cyclin-dependent PK, CDK6 {Human (H 5e-11
d1pmea_345 d.144.1.7 (A:) MAP kinase Erk2 {Human (Homo sapien 4e-19
d1pmea_ 345 d.144.1.7 (A:) MAP kinase Erk2 {Human (Homo sapien 5e-12
d2gfsa1348 d.144.1.7 (A:5-352) MAP kinase p38 {Human (Homo sa 8e-19
d2gfsa1 348 d.144.1.7 (A:5-352) MAP kinase p38 {Human (Homo sa 3e-07
d1mqba_283 d.144.1.7 (A:) epha2 receptor tyrosine kinase {Hum 9e-19
d1mqba_ 283 d.144.1.7 (A:) epha2 receptor tyrosine kinase {Hum 3e-11
d1t46a_311 d.144.1.7 (A:) c-KIT receptor {Human (Homo sapiens 1e-18
d1t46a_ 311 d.144.1.7 (A:) c-KIT receptor {Human (Homo sapiens 3e-12
d3blha1318 d.144.1.7 (A:8-325) Cell division protein kinase 9 2e-18
d3blha1 318 d.144.1.7 (A:8-325) Cell division protein kinase 9 1e-11
d1lufa_301 d.144.1.7 (A:) Musk tyrosine kinase {Rat (Rattus n 2e-18
d1lufa_ 301 d.144.1.7 (A:) Musk tyrosine kinase {Rat (Rattus n 3e-13
d1unla_292 d.144.1.7 (A:) Cyclin-dependent PK, CDK5 {Human (H 3e-18
d1unla_ 292 d.144.1.7 (A:) Cyclin-dependent PK, CDK5 {Human (H 2e-10
d1p4oa_308 d.144.1.7 (A:) Insulin-like growth factor 1 recept 3e-18
d1p4oa_ 308 d.144.1.7 (A:) Insulin-like growth factor 1 recept 3e-08
d2b1pa1355 d.144.1.7 (A:46-400) c-jun N-terminal kinase (jnk3 7e-17
d2b1pa1 355 d.144.1.7 (A:46-400) c-jun N-terminal kinase (jnk3 5e-08
d3bqca1328 d.144.1.7 (A:3-330) Protein kinase CK2, alpha subu 1e-15
d3bqca1 328 d.144.1.7 (A:3-330) Protein kinase CK2, alpha subu 4e-10
d1ywna1299 d.144.1.7 (A:818-1166) Vascular endothelial growth 2e-14
d1ywna1 299 d.144.1.7 (A:818-1166) Vascular endothelial growth 2e-12
d1vjya_303 d.144.1.7 (A:) Type I TGF-beta receptor R4 {Human 1e-13
d1vjya_ 303 d.144.1.7 (A:) Type I TGF-beta receptor R4 {Human 2e-10
d1q8ya_362 d.144.1.7 (A:) Sky1p {Baker's yeast (Saccharomyces 1e-10
d1q8ya_ 362 d.144.1.7 (A:) Sky1p {Baker's yeast (Saccharomyces 4e-04
d1zara2191 d.144.1.9 (A:91-281) Rio2 serine protein kinase C- 8e-10
>d2j4za1 d.144.1.7 (A:126-388) Aurora-related kinase 1 (aurora-2) {Human (Homo sapiens) [TaxId: 9606]} Length = 263 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Protein kinase-like (PK-like)
superfamily: Protein kinase-like (PK-like)
family: Protein kinases, catalytic subunit
domain: Aurora-related kinase 1 (aurora-2)
species: Human (Homo sapiens) [TaxId: 9606]
 Score =  130 bits (328), Expect = 7e-37
 Identities = 57/206 (27%), Positives = 102/206 (49%), Gaps = 11/206 (5%)

Query: 3   QEIAIHRSLKHRNVVGFHSFFEDSKFVYIILELCRKRSMMELYNSACDLEEMSDPAAQPV 62
           +E+ I   L+H N++  + +F D+  VY+ILE     ++          +E     A  +
Sbjct: 55  REVEIQSHLRHPNILRLYGYFHDATRVYLILEYAPLGTVYRELQKLSKFDE--QRTATYI 112

Query: 63  IWVSKWVDYSDKYGFGYQ-------LNDDSSGVMFND--LTRMIMLANKNTLCGTPNYIA 113
             ++  + Y       ++       L   +  +   D   +     + + TLCGT +Y+ 
Sbjct: 113 TELANALSYCHSKRVIHRDIKPENLLLGSAGELKIADFGWSVHAPSSRRTTLCGTLDYLP 172

Query: 114 PEILNKNGHSFEVDVWSIGCIMYTLLVGKPPFETSTLKETYSRIKKVEYKLPATLKKPAA 173
           PE++    H  +VD+WS+G + Y  LVGKPPFE +T +ETY RI +VE+  P  + + A 
Sbjct: 173 PEMIEGRMHDEKVDLWSLGVLCYEFLVGKPPFEANTYQETYKRISRVEFTFPDFVTEGAR 232

Query: 174 TMIKKMLLLDPVQRPPVAQLLHFEFF 199
            +I ++L  +P QRP + ++L   + 
Sbjct: 233 DLISRLLKHNPSQRPMLREVLEHPWI 258


>d2j4za1 d.144.1.7 (A:126-388) Aurora-related kinase 1 (aurora-2) {Human (Homo sapiens) [TaxId: 9606]} Length = 263 Back     information, alignment and structure
>d1yhwa1 d.144.1.7 (A:249-541) pak1 {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d1yhwa1 d.144.1.7 (A:249-541) pak1 {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d1a06a_ d.144.1.7 (A:) Calmodulin-dependent protein kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 307 Back     information, alignment and structure
>d1a06a_ d.144.1.7 (A:) Calmodulin-dependent protein kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 307 Back     information, alignment and structure
>d1koaa2 d.144.1.7 (A:5915-6264) Twitchin, kinase domain {Caenorhabditis elegans, pjk4 [TaxId: 6239]} Length = 350 Back     information, alignment and structure
>d1koaa2 d.144.1.7 (A:5915-6264) Twitchin, kinase domain {Caenorhabditis elegans, pjk4 [TaxId: 6239]} Length = 350 Back     information, alignment and structure
>d1uu3a_ d.144.1.7 (A:) 3-phosphoinositide dependent protein kinase-1 Pdk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure
>d1uu3a_ d.144.1.7 (A:) 3-phosphoinositide dependent protein kinase-1 Pdk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure
>d1jksa_ d.144.1.7 (A:) Death-associated protein kinase, Dap {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d1jksa_ d.144.1.7 (A:) Death-associated protein kinase, Dap {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d1koba_ d.144.1.7 (A:) Twitchin, kinase domain {California sea hare (Aplysia californica), twk43 [TaxId: 6500]} Length = 352 Back     information, alignment and structure
>d1koba_ d.144.1.7 (A:) Twitchin, kinase domain {California sea hare (Aplysia californica), twk43 [TaxId: 6500]} Length = 352 Back     information, alignment and structure
>d1tkia_ d.144.1.7 (A:) Titin, kinase domain {Human (Homo sapiens) [TaxId: 9606]} Length = 321 Back     information, alignment and structure
>d1tkia_ d.144.1.7 (A:) Titin, kinase domain {Human (Homo sapiens) [TaxId: 9606]} Length = 321 Back     information, alignment and structure
>d1xjda_ d.144.1.7 (A:) Protein kinase C, theta type {Human (Homo sapiens) [TaxId: 9606]} Length = 320 Back     information, alignment and structure
>d1xjda_ d.144.1.7 (A:) Protein kinase C, theta type {Human (Homo sapiens) [TaxId: 9606]} Length = 320 Back     information, alignment and structure
>d1u5ra_ d.144.1.7 (A:) Serine/threonine protein kinase TAO2 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 309 Back     information, alignment and structure
>d1u5ra_ d.144.1.7 (A:) Serine/threonine protein kinase TAO2 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 309 Back     information, alignment and structure
>d1fota_ d.144.1.7 (A:) cAMP-dependent PK, catalytic subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 316 Back     information, alignment and structure
>d1fota_ d.144.1.7 (A:) cAMP-dependent PK, catalytic subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 316 Back     information, alignment and structure
>d2java1 d.144.1.7 (A:3-271) Serine/threonine-protein kinase Nek2 {Human (Homo sapiens) [TaxId: 9606]} Length = 269 Back     information, alignment and structure
>d2java1 d.144.1.7 (A:3-271) Serine/threonine-protein kinase Nek2 {Human (Homo sapiens) [TaxId: 9606]} Length = 269 Back     information, alignment and structure
>d1phka_ d.144.1.7 (A:) gamma-subunit of glycogen phosphorylase kinase (Phk) {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Length = 277 Back     information, alignment and structure
>d1phka_ d.144.1.7 (A:) gamma-subunit of glycogen phosphorylase kinase (Phk) {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Length = 277 Back     information, alignment and structure
>d1t4ha_ d.144.1.7 (A:) Protein kinase wnk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 270 Back     information, alignment and structure
>d1t4ha_ d.144.1.7 (A:) Protein kinase wnk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 270 Back     information, alignment and structure
>d1nvra_ d.144.1.7 (A:) Cell cycle checkpoint kinase chk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 271 Back     information, alignment and structure
>d1nvra_ d.144.1.7 (A:) Cell cycle checkpoint kinase chk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 271 Back     information, alignment and structure
>d1o6ya_ d.144.1.7 (A:) Mycobacterial protein kinase PknB, catalytic domain {Mycobacterium tuberculosis [TaxId: 1773]} Length = 277 Back     information, alignment and structure
>d1o6ya_ d.144.1.7 (A:) Mycobacterial protein kinase PknB, catalytic domain {Mycobacterium tuberculosis [TaxId: 1773]} Length = 277 Back     information, alignment and structure
>d1byga_ d.144.1.7 (A:) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} Length = 262 Back     information, alignment and structure
>d1byga_ d.144.1.7 (A:) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} Length = 262 Back     information, alignment and structure
>d2jfla1 d.144.1.7 (A:21-308) STE20-like serine/threonine-protein kinase, SLK {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure
>d2jfla1 d.144.1.7 (A:21-308) STE20-like serine/threonine-protein kinase, SLK {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure
>d1s9ja_ d.144.1.7 (A:) Dual specificity mitogen-activated protein kinase kinase 1, Mek1 {Human (Homo sapiens) [TaxId: 9606]} Length = 322 Back     information, alignment and structure
>d1s9ja_ d.144.1.7 (A:) Dual specificity mitogen-activated protein kinase kinase 1, Mek1 {Human (Homo sapiens) [TaxId: 9606]} Length = 322 Back     information, alignment and structure
>d1uwha_ d.144.1.7 (A:) B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 276 Back     information, alignment and structure
>d1uwha_ d.144.1.7 (A:) B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 276 Back     information, alignment and structure
>d1xbba_ d.144.1.7 (A:) Tyrosine-protein kinase SYK {Human (Homo sapiens) [TaxId: 9606]} Length = 277 Back     information, alignment and structure
>d1xbba_ d.144.1.7 (A:) Tyrosine-protein kinase SYK {Human (Homo sapiens) [TaxId: 9606]} Length = 277 Back     information, alignment and structure
>d1xwsa_ d.144.1.7 (A:) Proto-oncogene serine/threonine-protein kinase Pim-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 273 Back     information, alignment and structure
>d1xwsa_ d.144.1.7 (A:) Proto-oncogene serine/threonine-protein kinase Pim-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 273 Back     information, alignment and structure
>d1sm2a_ d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Human (Homo sapiens) [TaxId: 9606]} Length = 263 Back     information, alignment and structure
>d1sm2a_ d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Human (Homo sapiens) [TaxId: 9606]} Length = 263 Back     information, alignment and structure
>d2ozaa1 d.144.1.7 (A:51-385) MAP kinase activated protein kinase 2, mapkap2 {Human (Homo sapiens) [TaxId: 9606]} Length = 335 Back     information, alignment and structure
>d2ozaa1 d.144.1.7 (A:51-385) MAP kinase activated protein kinase 2, mapkap2 {Human (Homo sapiens) [TaxId: 9606]} Length = 335 Back     information, alignment and structure
>d1ua2a_ d.144.1.7 (A:) Cell division protein kinase 7, CDK7 {Human (Homo sapiens) [TaxId: 9606]} Length = 299 Back     information, alignment and structure
>d1ua2a_ d.144.1.7 (A:) Cell division protein kinase 7, CDK7 {Human (Homo sapiens) [TaxId: 9606]} Length = 299 Back     information, alignment and structure
>d1fmka3 d.144.1.7 (A:249-533) c-src tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1fmka3 d.144.1.7 (A:249-533) c-src tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1k2pa_ d.144.1.7 (A:) Bruton's tyrosine kinase (Btk) {Human (Homo sapiens) [TaxId: 9606]} Length = 258 Back     information, alignment and structure
>d1k2pa_ d.144.1.7 (A:) Bruton's tyrosine kinase (Btk) {Human (Homo sapiens) [TaxId: 9606]} Length = 258 Back     information, alignment and structure
>d1o6la_ d.144.1.7 (A:) Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9606]} Length = 337 Back     information, alignment and structure
>d1o6la_ d.144.1.7 (A:) Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9606]} Length = 337 Back     information, alignment and structure
>d1u59a_ d.144.1.7 (A:) Tyrosine-protein kinase ZAP-70 {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1u59a_ d.144.1.7 (A:) Tyrosine-protein kinase ZAP-70 {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1fvra_ d.144.1.7 (A:) Tie2 kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 309 Back     information, alignment and structure
>d1fvra_ d.144.1.7 (A:) Tie2 kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 309 Back     information, alignment and structure
>d1u46a_ d.144.1.7 (A:) Activated CDC42 kinase 1, ACK1 {Human (Homo sapiens) [TaxId: 9606]} Length = 273 Back     information, alignment and structure
>d1u46a_ d.144.1.7 (A:) Activated CDC42 kinase 1, ACK1 {Human (Homo sapiens) [TaxId: 9606]} Length = 273 Back     information, alignment and structure
>d1qpca_ d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Homo sapiens) [TaxId: 9606]} Length = 272 Back     information, alignment and structure
>d1qpca_ d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Homo sapiens) [TaxId: 9606]} Length = 272 Back     information, alignment and structure
>d1omwa3 d.144.1.7 (A:186-549) G-protein coupled receptor kinase 2 {Cow (Bos taurus) [TaxId: 9913]} Length = 364 Back     information, alignment and structure
>d1omwa3 d.144.1.7 (A:186-549) G-protein coupled receptor kinase 2 {Cow (Bos taurus) [TaxId: 9913]} Length = 364 Back     information, alignment and structure
>d1cm8a_ d.144.1.7 (A:) MAP kinase p38-gamma {Human (Homo sapiens) [TaxId: 9606]} Length = 346 Back     information, alignment and structure
>d1cm8a_ d.144.1.7 (A:) MAP kinase p38-gamma {Human (Homo sapiens) [TaxId: 9606]} Length = 346 Back     information, alignment and structure
>d2ogqa1 d.223.1.2 (A:371-494) Serine/threonine-protein kinase plk C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 124 Back     information, alignment and structure
>d1q5ka_ d.144.1.7 (A:) Glycogen synthase kinase-3 beta (Gsk3b) {Human (Homo sapiens) [TaxId: 9606]} Length = 350 Back     information, alignment and structure
>d1q5ka_ d.144.1.7 (A:) Glycogen synthase kinase-3 beta (Gsk3b) {Human (Homo sapiens) [TaxId: 9606]} Length = 350 Back     information, alignment and structure
>d1mp8a_ d.144.1.7 (A:) Focal adhesion kinase 1 (fak) {Human (Homo sapiens) [TaxId: 9606]} Length = 273 Back     information, alignment and structure
>d1mp8a_ d.144.1.7 (A:) Focal adhesion kinase 1 (fak) {Human (Homo sapiens) [TaxId: 9606]} Length = 273 Back     information, alignment and structure
>d1r0pa_ d.144.1.7 (A:) Hepatocyte growth factor receptor, c-MET {Human (Homo sapiens) [TaxId: 9606]} Length = 311 Back     information, alignment and structure
>d1r0pa_ d.144.1.7 (A:) Hepatocyte growth factor receptor, c-MET {Human (Homo sapiens) [TaxId: 9606]} Length = 311 Back     information, alignment and structure
>d1rjba_ d.144.1.7 (A:) Fl cytokine receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 325 Back     information, alignment and structure
>d1rjba_ d.144.1.7 (A:) Fl cytokine receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 325 Back     information, alignment and structure
>d1gz8a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [TaxId: 9606]} Length = 298 Back     information, alignment and structure
>d1gz8a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [TaxId: 9606]} Length = 298 Back     information, alignment and structure
>d1jpaa_ d.144.1.7 (A:) ephb2 receptor tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} Length = 299 Back     information, alignment and structure
>d1jpaa_ d.144.1.7 (A:) ephb2 receptor tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} Length = 299 Back     information, alignment and structure
>d1ob3a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {(Plasmodium falciparum) [TaxId: 5833]} Length = 286 Back     information, alignment and structure
>d1ob3a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {(Plasmodium falciparum) [TaxId: 5833]} Length = 286 Back     information, alignment and structure
>d1vzoa_ d.144.1.7 (A:) Ribosomal protein S6 kinase alpha 5, Msk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 322 Back     information, alignment and structure
>d1vzoa_ d.144.1.7 (A:) Ribosomal protein S6 kinase alpha 5, Msk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 322 Back     information, alignment and structure
>d1csna_ d.144.1.7 (A:) Casein kinase-1, CK1 {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 293 Back     information, alignment and structure
>d1csna_ d.144.1.7 (A:) Casein kinase-1, CK1 {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 293 Back     information, alignment and structure
>d1rdqe_ d.144.1.7 (E:) cAMP-dependent PK, catalytic subunit {Mouse (Mus musculus) [TaxId: 10090]} Length = 350 Back     information, alignment and structure
>d1rdqe_ d.144.1.7 (E:) cAMP-dependent PK, catalytic subunit {Mouse (Mus musculus) [TaxId: 10090]} Length = 350 Back     information, alignment and structure
>d1fgka_ d.144.1.7 (A:) Fibroblast growth factor receptor 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 299 Back     information, alignment and structure
>d1fgka_ d.144.1.7 (A:) Fibroblast growth factor receptor 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 299 Back     information, alignment and structure
>d1xkka_ d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 317 Back     information, alignment and structure
>d1xkka_ d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 317 Back     information, alignment and structure
>d1ckia_ d.144.1.7 (A:) Casein kinase-1, CK1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 299 Back     information, alignment and structure
>d1ckia_ d.144.1.7 (A:) Casein kinase-1, CK1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 299 Back     information, alignment and structure
>d1opja_ d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mouse (Mus musculus) [TaxId: 10090]} Length = 287 Back     information, alignment and structure
>d1opja_ d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mouse (Mus musculus) [TaxId: 10090]} Length = 287 Back     information, alignment and structure
>d1blxa_ d.144.1.7 (A:) Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [TaxId: 9606]} Length = 305 Back     information, alignment and structure
>d1blxa_ d.144.1.7 (A:) Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [TaxId: 9606]} Length = 305 Back     information, alignment and structure
>d1pmea_ d.144.1.7 (A:) MAP kinase Erk2 {Human (Homo sapiens) [TaxId: 9606]} Length = 345 Back     information, alignment and structure
>d1pmea_ d.144.1.7 (A:) MAP kinase Erk2 {Human (Homo sapiens) [TaxId: 9606]} Length = 345 Back     information, alignment and structure
>d2gfsa1 d.144.1.7 (A:5-352) MAP kinase p38 {Human (Homo sapiens) [TaxId: 9606]} Length = 348 Back     information, alignment and structure
>d2gfsa1 d.144.1.7 (A:5-352) MAP kinase p38 {Human (Homo sapiens) [TaxId: 9606]} Length = 348 Back     information, alignment and structure
>d1mqba_ d.144.1.7 (A:) epha2 receptor tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 283 Back     information, alignment and structure
>d1mqba_ d.144.1.7 (A:) epha2 receptor tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 283 Back     information, alignment and structure
>d1t46a_ d.144.1.7 (A:) c-KIT receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 311 Back     information, alignment and structure
>d1t46a_ d.144.1.7 (A:) c-KIT receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 311 Back     information, alignment and structure
>d3blha1 d.144.1.7 (A:8-325) Cell division protein kinase 9, CDK9 {Human (Homo sapiens) [TaxId: 9606]} Length = 318 Back     information, alignment and structure
>d3blha1 d.144.1.7 (A:8-325) Cell division protein kinase 9, CDK9 {Human (Homo sapiens) [TaxId: 9606]} Length = 318 Back     information, alignment and structure
>d1lufa_ d.144.1.7 (A:) Musk tyrosine kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 301 Back     information, alignment and structure
>d1lufa_ d.144.1.7 (A:) Musk tyrosine kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 301 Back     information, alignment and structure
>d1unla_ d.144.1.7 (A:) Cyclin-dependent PK, CDK5 {Human (Homo sapiens) [TaxId: 9606]} Length = 292 Back     information, alignment and structure
>d1unla_ d.144.1.7 (A:) Cyclin-dependent PK, CDK5 {Human (Homo sapiens) [TaxId: 9606]} Length = 292 Back     information, alignment and structure
>d1p4oa_ d.144.1.7 (A:) Insulin-like growth factor 1 receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 308 Back     information, alignment and structure
>d1p4oa_ d.144.1.7 (A:) Insulin-like growth factor 1 receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 308 Back     information, alignment and structure
>d2b1pa1 d.144.1.7 (A:46-400) c-jun N-terminal kinase (jnk3s) {Human (Homo sapiens) [TaxId: 9606]} Length = 355 Back     information, alignment and structure
>d2b1pa1 d.144.1.7 (A:46-400) c-jun N-terminal kinase (jnk3s) {Human (Homo sapiens) [TaxId: 9606]} Length = 355 Back     information, alignment and structure
>d3bqca1 d.144.1.7 (A:3-330) Protein kinase CK2, alpha subunit {Rattus norvegicus [TaxId: 10116]} Length = 328 Back     information, alignment and structure
>d3bqca1 d.144.1.7 (A:3-330) Protein kinase CK2, alpha subunit {Rattus norvegicus [TaxId: 10116]} Length = 328 Back     information, alignment and structure
>d1ywna1 d.144.1.7 (A:818-1166) Vascular endothelial growth factor receptor 2 (kdr) {Human (Homo sapiens) [TaxId: 9606]} Length = 299 Back     information, alignment and structure
>d1ywna1 d.144.1.7 (A:818-1166) Vascular endothelial growth factor receptor 2 (kdr) {Human (Homo sapiens) [TaxId: 9606]} Length = 299 Back     information, alignment and structure
>d1vjya_ d.144.1.7 (A:) Type I TGF-beta receptor R4 {Human (Homo sapiens) [TaxId: 9606]} Length = 303 Back     information, alignment and structure
>d1vjya_ d.144.1.7 (A:) Type I TGF-beta receptor R4 {Human (Homo sapiens) [TaxId: 9606]} Length = 303 Back     information, alignment and structure
>d1q8ya_ d.144.1.7 (A:) Sky1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 362 Back     information, alignment and structure
>d1q8ya_ d.144.1.7 (A:) Sky1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 362 Back     information, alignment and structure
>d1zara2 d.144.1.9 (A:91-281) Rio2 serine protein kinase C-terminal domain {Archaeoglobus fulgidus [TaxId: 2234]} Length = 191 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query305
d2j4za1263 Aurora-related kinase 1 (aurora-2) {Human (Homo sa 100.0
d1uu3a_288 3-phosphoinositide dependent protein kinase-1 Pdk1 100.0
d1a06a_307 Calmodulin-dependent protein kinase {Rat (Rattus n 100.0
d1yhwa1293 pak1 {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1o6la_337 Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9 100.0
d2java1269 Serine/threonine-protein kinase Nek2 {Human (Homo 100.0
d1fota_316 cAMP-dependent PK, catalytic subunit {Baker's yeas 100.0
d1nvra_271 Cell cycle checkpoint kinase chk1 {Human (Homo sap 100.0
d2jfla1288 STE20-like serine/threonine-protein kinase, SLK {H 100.0
d1t4ha_270 Protein kinase wnk1 {Human (Homo sapiens) [TaxId: 100.0
d1jksa_293 Death-associated protein kinase, Dap {Human (Homo 100.0
d1u5ra_309 Serine/threonine protein kinase TAO2 {Rat (Rattus 100.0
d1koaa2350 Twitchin, kinase domain {Caenorhabditis elegans, p 100.0
d1koba_352 Twitchin, kinase domain {California sea hare (Aply 100.0
d1s9ja_322 Dual specificity mitogen-activated protein kinase 100.0
d1xjda_320 Protein kinase C, theta type {Human (Homo sapiens) 100.0
d1rdqe_350 cAMP-dependent PK, catalytic subunit {Mouse (Mus m 100.0
d1phka_277 gamma-subunit of glycogen phosphorylase kinase (Ph 100.0
d1tkia_321 Titin, kinase domain {Human (Homo sapiens) [TaxId: 100.0
d1omwa3364 G-protein coupled receptor kinase 2 {Cow (Bos taur 100.0
d1ua2a_299 Cell division protein kinase 7, CDK7 {Human (Homo 100.0
d2ozaa1335 MAP kinase activated protein kinase 2, mapkap2 {Hu 100.0
d1xwsa_273 Proto-oncogene serine/threonine-protein kinase Pim 100.0
d1xbba_277 Tyrosine-protein kinase SYK {Human (Homo sapiens) 100.0
d1jpaa_299 ephb2 receptor tyrosine kinase {Mouse (Mus musculu 100.0
d1sm2a_263 Tyrosine-protein kinase Itk/Tsk {Human (Homo sapie 100.0
d1gz8a_298 Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [T 100.0
d1u59a_285 Tyrosine-protein kinase ZAP-70 {Human (Homo sapien 100.0
d1rjba_325 Fl cytokine receptor {Human (Homo sapiens) [TaxId: 100.0
d1blxa_305 Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [T 100.0
d1o6ya_277 Mycobacterial protein kinase PknB, catalytic domai 100.0
d1k2pa_258 Bruton's tyrosine kinase (Btk) {Human (Homo sapien 100.0
d1opja_287 Abelsone tyrosine kinase (abl) {Mouse (Mus musculu 100.0
d1uwha_276 B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1mp8a_273 Focal adhesion kinase 1 (fak) {Human (Homo sapiens 100.0
d1qpca_272 Lymphocyte kinase (lck) {Human (Homo sapiens) [Tax 100.0
d1ob3a_286 Cyclin-dependent PK, CDK2 {(Plasmodium falciparum) 100.0
d1byga_262 Carboxyl-terminal src kinase (csk) {Human (Homo sa 100.0
d1fmka3285 c-src tyrosine kinase {Human (Homo sapiens) [TaxId 100.0
d1q5ka_350 Glycogen synthase kinase-3 beta (Gsk3b) {Human (Ho 100.0
d1vzoa_322 Ribosomal protein S6 kinase alpha 5, Msk1 {Human ( 100.0
d1cm8a_346 MAP kinase p38-gamma {Human (Homo sapiens) [TaxId: 100.0
d1mqba_283 epha2 receptor tyrosine kinase {Human (Homo sapien 100.0
d1fvra_309 Tie2 kinase {Human (Homo sapiens) [TaxId: 9606]} 100.0
d3blha1318 Cell division protein kinase 9, CDK9 {Human (Homo 100.0
d1xkka_317 EGF receptor tyrosine kinase, Erbb-1 {Human (Homo 100.0
d1u46a_273 Activated CDC42 kinase 1, ACK1 {Human (Homo sapien 100.0
d1lufa_301 Musk tyrosine kinase {Rat (Rattus norvegicus) [Tax 100.0
d1fgka_299 Fibroblast growth factor receptor 1 {Human (Homo s 100.0
d1pmea_345 MAP kinase Erk2 {Human (Homo sapiens) [TaxId: 9606 100.0
d2b1pa1355 c-jun N-terminal kinase (jnk3s) {Human (Homo sapie 100.0
d2gfsa1348 MAP kinase p38 {Human (Homo sapiens) [TaxId: 9606] 100.0
d1unla_292 Cyclin-dependent PK, CDK5 {Human (Homo sapiens) [T 100.0
d1r0pa_311 Hepatocyte growth factor receptor, c-MET {Human (H 100.0
d1p4oa_308 Insulin-like growth factor 1 receptor {Human (Homo 100.0
d3bqca1328 Protein kinase CK2, alpha subunit {Rattus norvegic 100.0
d1t46a_311 c-KIT receptor {Human (Homo sapiens) [TaxId: 9606] 100.0
d1ywna1299 Vascular endothelial growth factor receptor 2 (kdr 100.0
d1vjya_303 Type I TGF-beta receptor R4 {Human (Homo sapiens) 99.97
d1ckia_299 Casein kinase-1, CK1 {Rat (Rattus norvegicus) [Tax 99.96
d1csna_293 Casein kinase-1, CK1 {Fission yeast (Schizosacchar 99.96
d1q8ya_362 Sky1p {Baker's yeast (Saccharomyces cerevisiae) [T 99.95
d1nvra_ 271 Cell cycle checkpoint kinase chk1 {Human (Homo sap 99.29
d1yhwa1 293 pak1 {Human (Homo sapiens) [TaxId: 9606]} 99.27
d1o6la_ 337 Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9 99.25
d2jfla1 288 STE20-like serine/threonine-protein kinase, SLK {H 99.24
d2j4za1263 Aurora-related kinase 1 (aurora-2) {Human (Homo sa 99.23
d1uwha_ 276 B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]} 99.22
d1rdqe_ 350 cAMP-dependent PK, catalytic subunit {Mouse (Mus m 99.22
d1koba_ 352 Twitchin, kinase domain {California sea hare (Aply 99.22
d1ywna1 299 Vascular endothelial growth factor receptor 2 (kdr 99.2
d1u5ra_ 309 Serine/threonine protein kinase TAO2 {Rat (Rattus 99.2
d1uu3a_ 288 3-phosphoinositide dependent protein kinase-1 Pdk1 99.19
d1jpaa_ 299 ephb2 receptor tyrosine kinase {Mouse (Mus musculu 99.19
d1omwa3 364 G-protein coupled receptor kinase 2 {Cow (Bos taur 99.18
d1phka_ 277 gamma-subunit of glycogen phosphorylase kinase (Ph 99.17
d1fota_ 316 cAMP-dependent PK, catalytic subunit {Baker's yeas 99.16
d1opja_ 287 Abelsone tyrosine kinase (abl) {Mouse (Mus musculu 99.16
d1u59a_ 285 Tyrosine-protein kinase ZAP-70 {Human (Homo sapien 99.16
d1koaa2 350 Twitchin, kinase domain {Caenorhabditis elegans, p 99.15
d1ua2a_ 299 Cell division protein kinase 7, CDK7 {Human (Homo 99.15
d1rjba_ 325 Fl cytokine receptor {Human (Homo sapiens) [TaxId: 99.15
d1mqba_ 283 epha2 receptor tyrosine kinase {Human (Homo sapien 99.15
d1q5ka_ 350 Glycogen synthase kinase-3 beta (Gsk3b) {Human (Ho 99.14
d1s9ja_ 322 Dual specificity mitogen-activated protein kinase 99.14
d1qpca_ 272 Lymphocyte kinase (lck) {Human (Homo sapiens) [Tax 99.14
d2java1269 Serine/threonine-protein kinase Nek2 {Human (Homo 99.13
d1xwsa_ 273 Proto-oncogene serine/threonine-protein kinase Pim 99.13
d1xbba_ 277 Tyrosine-protein kinase SYK {Human (Homo sapiens) 99.11
d1sm2a_ 263 Tyrosine-protein kinase Itk/Tsk {Human (Homo sapie 99.11
d1xkka_ 317 EGF receptor tyrosine kinase, Erbb-1 {Human (Homo 99.11
d1gz8a_ 298 Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [T 99.1
d1pmea_ 345 MAP kinase Erk2 {Human (Homo sapiens) [TaxId: 9606 99.1
d1u46a_ 273 Activated CDC42 kinase 1, ACK1 {Human (Homo sapien 99.1
d1mp8a_ 273 Focal adhesion kinase 1 (fak) {Human (Homo sapiens 99.09
d1tkia_ 321 Titin, kinase domain {Human (Homo sapiens) [TaxId: 99.08
d1t4ha_270 Protein kinase wnk1 {Human (Homo sapiens) [TaxId: 99.08
d1ob3a_ 286 Cyclin-dependent PK, CDK2 {(Plasmodium falciparum) 99.08
d3bqca1 328 Protein kinase CK2, alpha subunit {Rattus norvegic 99.06
d1xjda_ 320 Protein kinase C, theta type {Human (Homo sapiens) 99.05
d2ozaa1 335 MAP kinase activated protein kinase 2, mapkap2 {Hu 99.04
d1a06a_ 307 Calmodulin-dependent protein kinase {Rat (Rattus n 99.04
d1lufa_ 301 Musk tyrosine kinase {Rat (Rattus norvegicus) [Tax 99.02
d1unla_ 292 Cyclin-dependent PK, CDK5 {Human (Homo sapiens) [T 99.02
d1cm8a_ 346 MAP kinase p38-gamma {Human (Homo sapiens) [TaxId: 99.01
d1fmka3 285 c-src tyrosine kinase {Human (Homo sapiens) [TaxId 99.0
d1k2pa_258 Bruton's tyrosine kinase (Btk) {Human (Homo sapien 99.0
d3blha1 318 Cell division protein kinase 9, CDK9 {Human (Homo 99.0
d1blxa_ 305 Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [T 98.99
d1ckia_ 299 Casein kinase-1, CK1 {Rat (Rattus norvegicus) [Tax 98.99
d1jksa_ 293 Death-associated protein kinase, Dap {Human (Homo 98.97
d1fgka_ 299 Fibroblast growth factor receptor 1 {Human (Homo s 98.97
d1vzoa_ 322 Ribosomal protein S6 kinase alpha 5, Msk1 {Human ( 98.96
d1r0pa_ 311 Hepatocyte growth factor receptor, c-MET {Human (H 98.94
d1csna_ 293 Casein kinase-1, CK1 {Fission yeast (Schizosacchar 98.94
d1o6ya_ 277 Mycobacterial protein kinase PknB, catalytic domai 98.93
d2gfsa1 348 MAP kinase p38 {Human (Homo sapiens) [TaxId: 9606] 98.92
d1t46a_ 311 c-KIT receptor {Human (Homo sapiens) [TaxId: 9606] 98.9
d1zara2191 Rio2 serine protein kinase C-terminal domain {Arch 98.89
d1p4oa_ 308 Insulin-like growth factor 1 receptor {Human (Homo 98.89
d1fvra_ 309 Tie2 kinase {Human (Homo sapiens) [TaxId: 9606]} 98.86
d1vjya_ 303 Type I TGF-beta receptor R4 {Human (Homo sapiens) 98.8
d1byga_ 262 Carboxyl-terminal src kinase (csk) {Human (Homo sa 98.74
d2b1pa1 355 c-jun N-terminal kinase (jnk3s) {Human (Homo sapie 98.72
d1q8ya_ 362 Sky1p {Baker's yeast (Saccharomyces cerevisiae) [T 98.51
d1zara2191 Rio2 serine protein kinase C-terminal domain {Arch 98.09
d2ppqa1316 Homoserine kinase ThrB {Agrobacterium tumefaciens 82.9
>d2j4za1 d.144.1.7 (A:126-388) Aurora-related kinase 1 (aurora-2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Protein kinase-like (PK-like)
superfamily: Protein kinase-like (PK-like)
family: Protein kinases, catalytic subunit
domain: Aurora-related kinase 1 (aurora-2)
species: Human (Homo sapiens) [TaxId: 9606]
Probab=100.00  E-value=1.8e-47  Score=318.79  Aligned_cols=197  Identities=28%  Similarity=0.562  Sum_probs=169.1

Q ss_pred             hhHHHHHhcCCCCCccceeEEEEcCCeEEEEEeccCCCCHHHHHHHhcCCCCCCCcCch-hHHHHHHHHHHhhhhCCcee
Q psy6191           2 SQEIAIHRSLKHRNVVGFHSFFEDSKFVYIILELCRKRSMMELYNSACDLEEMSDPAAQ-PVIWVSKWVDYSDKYGFGYQ   80 (305)
Q Consensus         2 ~~Ei~il~~l~HpnIV~l~~~~~~~~~~ylVmEy~~~g~L~~~~~~~~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~   80 (305)
                      .+|+++|++++|||||++++++++++.+|||||||+||+|.+++.....+.   +..+. .+.++..++.|+|+.++.|+
T Consensus        54 ~~E~~il~~l~hpnIv~~~~~~~~~~~~~ivmEy~~~g~L~~~l~~~~~l~---e~~~~~i~~qi~~al~~lH~~~ivHr  130 (263)
T d2j4za1          54 RREVEIQSHLRHPNILRLYGYFHDATRVYLILEYAPLGTVYRELQKLSKFD---EQRTATYITELANALSYCHSKRVIHR  130 (263)
T ss_dssp             HHHHHHHHTCCCTTBCCEEEEEECSSEEEEEEECCTTCBHHHHHHHHSSCC---HHHHHHHHHHHHHHHHHHHHTTCCCC
T ss_pred             HHHHHHHHhcCCCCCCeEEEEEEECCEEEEEEeecCCCcHHHHHhhcCCCC---HHHHHHHHHHHHHHHHHHHHCCeeee
Confidence            479999999999999999999999999999999999999999998765542   22222 33456788999998876553


Q ss_pred             -------ecCCCCCeeEcchhHHHHhcC--CcccccCCCcccccccccCCCCccchHHHHHHHHHHHHhCCCCCCCCCHH
Q psy6191          81 -------LNDDSSGVMFNDLTRMIMLAN--KNTLCGTPNYIAPEILNKNGHSFEVDVWSIGCIMYTLLVGKPPFETSTLK  151 (305)
Q Consensus        81 -------~~~~~~~v~~~d~~~~~~~~~--~~~~~Gt~~y~aPE~~~~~~~~~~~DiwSlGvilye~l~g~~Pf~~~~~~  151 (305)
                             +.+..+.+++.||+.+.....  ....+||+.|||||++.+..|+.++||||+||++|||++|++||.+.+..
T Consensus       131 DiKp~Nill~~~~~~kl~DFG~a~~~~~~~~~~~~Gt~~Y~APE~~~~~~~~~~~DiwSlGvilyell~G~~Pf~~~~~~  210 (263)
T d2j4za1         131 DIKPENLLLGSAGELKIADFGWSVHAPSSRRTTLCGTLDYLPPEMIEGRMHDEKVDLWSLGVLCYEFLVGKPPFEANTYQ  210 (263)
T ss_dssp             CCCGGGEEECTTSCEEECCCCSCSCCCCCCCEETTEEGGGCCHHHHTTCCCCTTHHHHHHHHHHHHHHHSSCTTCCSSHH
T ss_pred             eeccccceecCCCCEeecccceeeecCCCcccccCCCCcccCHHHHcCCCCCchhhhhhHhHHHHHHhcCCCCCCCCCHH
Confidence                   333446788888876543322  34568999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHhccccCCCCCCCHHHHHHHHHHhhcCCCCCCCHhhhhcCccccc
Q psy6191         152 ETYSRIKKVEYKLPATLKKPAATMIKKMLLLDPVQRPPVAQLLHFEFFND  201 (305)
Q Consensus       152 ~~~~~i~~~~~~~~~~~~~~~~~li~~~l~~dp~~R~~~~~~l~~~~~~~  201 (305)
                      +.+..+.+..+.+|..+++++++||.+||+.||.+|||++|+++||||+.
T Consensus       211 ~~~~~i~~~~~~~p~~~s~~~~~li~~~L~~dp~~R~t~~eil~hp~~~~  260 (263)
T d2j4za1         211 ETYKRISRVEFTFPDFVTEGARDLISRLLKHNPSQRPMLREVLEHPWITA  260 (263)
T ss_dssp             HHHHHHHTTCCCCCTTSCHHHHHHHHHHTCSSGGGSCCHHHHHTCHHHHH
T ss_pred             HHHHHHHcCCCCCCccCCHHHHHHHHHHccCCHhHCcCHHHHHcCcCcCC
Confidence            99999999999999999999999999999999999999999999999974



>d1uu3a_ d.144.1.7 (A:) 3-phosphoinositide dependent protein kinase-1 Pdk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a06a_ d.144.1.7 (A:) Calmodulin-dependent protein kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1yhwa1 d.144.1.7 (A:249-541) pak1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1o6la_ d.144.1.7 (A:) Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2java1 d.144.1.7 (A:3-271) Serine/threonine-protein kinase Nek2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fota_ d.144.1.7 (A:) cAMP-dependent PK, catalytic subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nvra_ d.144.1.7 (A:) Cell cycle checkpoint kinase chk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2jfla1 d.144.1.7 (A:21-308) STE20-like serine/threonine-protein kinase, SLK {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t4ha_ d.144.1.7 (A:) Protein kinase wnk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jksa_ d.144.1.7 (A:) Death-associated protein kinase, Dap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u5ra_ d.144.1.7 (A:) Serine/threonine protein kinase TAO2 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1koaa2 d.144.1.7 (A:5915-6264) Twitchin, kinase domain {Caenorhabditis elegans, pjk4 [TaxId: 6239]} Back     information, alignment and structure
>d1koba_ d.144.1.7 (A:) Twitchin, kinase domain {California sea hare (Aplysia californica), twk43 [TaxId: 6500]} Back     information, alignment and structure
>d1s9ja_ d.144.1.7 (A:) Dual specificity mitogen-activated protein kinase kinase 1, Mek1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xjda_ d.144.1.7 (A:) Protein kinase C, theta type {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rdqe_ d.144.1.7 (E:) cAMP-dependent PK, catalytic subunit {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1phka_ d.144.1.7 (A:) gamma-subunit of glycogen phosphorylase kinase (Phk) {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1tkia_ d.144.1.7 (A:) Titin, kinase domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1omwa3 d.144.1.7 (A:186-549) G-protein coupled receptor kinase 2 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ua2a_ d.144.1.7 (A:) Cell division protein kinase 7, CDK7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ozaa1 d.144.1.7 (A:51-385) MAP kinase activated protein kinase 2, mapkap2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwsa_ d.144.1.7 (A:) Proto-oncogene serine/threonine-protein kinase Pim-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xbba_ d.144.1.7 (A:) Tyrosine-protein kinase SYK {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jpaa_ d.144.1.7 (A:) ephb2 receptor tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1sm2a_ d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gz8a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u59a_ d.144.1.7 (A:) Tyrosine-protein kinase ZAP-70 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rjba_ d.144.1.7 (A:) Fl cytokine receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1blxa_ d.144.1.7 (A:) Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1o6ya_ d.144.1.7 (A:) Mycobacterial protein kinase PknB, catalytic domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1k2pa_ d.144.1.7 (A:) Bruton's tyrosine kinase (Btk) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1opja_ d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1uwha_ d.144.1.7 (A:) B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mp8a_ d.144.1.7 (A:) Focal adhesion kinase 1 (fak) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qpca_ d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ob3a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {(Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1byga_ d.144.1.7 (A:) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fmka3 d.144.1.7 (A:249-533) c-src tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q5ka_ d.144.1.7 (A:) Glycogen synthase kinase-3 beta (Gsk3b) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vzoa_ d.144.1.7 (A:) Ribosomal protein S6 kinase alpha 5, Msk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cm8a_ d.144.1.7 (A:) MAP kinase p38-gamma {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mqba_ d.144.1.7 (A:) epha2 receptor tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fvra_ d.144.1.7 (A:) Tie2 kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3blha1 d.144.1.7 (A:8-325) Cell division protein kinase 9, CDK9 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkka_ d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u46a_ d.144.1.7 (A:) Activated CDC42 kinase 1, ACK1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lufa_ d.144.1.7 (A:) Musk tyrosine kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1fgka_ d.144.1.7 (A:) Fibroblast growth factor receptor 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pmea_ d.144.1.7 (A:) MAP kinase Erk2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b1pa1 d.144.1.7 (A:46-400) c-jun N-terminal kinase (jnk3s) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gfsa1 d.144.1.7 (A:5-352) MAP kinase p38 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1unla_ d.144.1.7 (A:) Cyclin-dependent PK, CDK5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r0pa_ d.144.1.7 (A:) Hepatocyte growth factor receptor, c-MET {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p4oa_ d.144.1.7 (A:) Insulin-like growth factor 1 receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3bqca1 d.144.1.7 (A:3-330) Protein kinase CK2, alpha subunit {Rattus norvegicus [TaxId: 10116]} Back     information, alignment and structure
>d1t46a_ d.144.1.7 (A:) c-KIT receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ywna1 d.144.1.7 (A:818-1166) Vascular endothelial growth factor receptor 2 (kdr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vjya_ d.144.1.7 (A:) Type I TGF-beta receptor R4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ckia_ d.144.1.7 (A:) Casein kinase-1, CK1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1csna_ d.144.1.7 (A:) Casein kinase-1, CK1 {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1q8ya_ d.144.1.7 (A:) Sky1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nvra_ d.144.1.7 (A:) Cell cycle checkpoint kinase chk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yhwa1 d.144.1.7 (A:249-541) pak1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1o6la_ d.144.1.7 (A:) Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2jfla1 d.144.1.7 (A:21-308) STE20-like serine/threonine-protein kinase, SLK {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2j4za1 d.144.1.7 (A:126-388) Aurora-related kinase 1 (aurora-2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uwha_ d.144.1.7 (A:) B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rdqe_ d.144.1.7 (E:) cAMP-dependent PK, catalytic subunit {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1koba_ d.144.1.7 (A:) Twitchin, kinase domain {California sea hare (Aplysia californica), twk43 [TaxId: 6500]} Back     information, alignment and structure
>d1ywna1 d.144.1.7 (A:818-1166) Vascular endothelial growth factor receptor 2 (kdr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u5ra_ d.144.1.7 (A:) Serine/threonine protein kinase TAO2 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1uu3a_ d.144.1.7 (A:) 3-phosphoinositide dependent protein kinase-1 Pdk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jpaa_ d.144.1.7 (A:) ephb2 receptor tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1omwa3 d.144.1.7 (A:186-549) G-protein coupled receptor kinase 2 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1phka_ d.144.1.7 (A:) gamma-subunit of glycogen phosphorylase kinase (Phk) {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1fota_ d.144.1.7 (A:) cAMP-dependent PK, catalytic subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1opja_ d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1u59a_ d.144.1.7 (A:) Tyrosine-protein kinase ZAP-70 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koaa2 d.144.1.7 (A:5915-6264) Twitchin, kinase domain {Caenorhabditis elegans, pjk4 [TaxId: 6239]} Back     information, alignment and structure
>d1ua2a_ d.144.1.7 (A:) Cell division protein kinase 7, CDK7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rjba_ d.144.1.7 (A:) Fl cytokine receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mqba_ d.144.1.7 (A:) epha2 receptor tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q5ka_ d.144.1.7 (A:) Glycogen synthase kinase-3 beta (Gsk3b) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s9ja_ d.144.1.7 (A:) Dual specificity mitogen-activated protein kinase kinase 1, Mek1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qpca_ d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2java1 d.144.1.7 (A:3-271) Serine/threonine-protein kinase Nek2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwsa_ d.144.1.7 (A:) Proto-oncogene serine/threonine-protein kinase Pim-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xbba_ d.144.1.7 (A:) Tyrosine-protein kinase SYK {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sm2a_ d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkka_ d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gz8a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pmea_ d.144.1.7 (A:) MAP kinase Erk2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u46a_ d.144.1.7 (A:) Activated CDC42 kinase 1, ACK1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mp8a_ d.144.1.7 (A:) Focal adhesion kinase 1 (fak) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tkia_ d.144.1.7 (A:) Titin, kinase domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t4ha_ d.144.1.7 (A:) Protein kinase wnk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ob3a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {(Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d3bqca1 d.144.1.7 (A:3-330) Protein kinase CK2, alpha subunit {Rattus norvegicus [TaxId: 10116]} Back     information, alignment and structure
>d1xjda_ d.144.1.7 (A:) Protein kinase C, theta type {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ozaa1 d.144.1.7 (A:51-385) MAP kinase activated protein kinase 2, mapkap2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a06a_ d.144.1.7 (A:) Calmodulin-dependent protein kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1lufa_ d.144.1.7 (A:) Musk tyrosine kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1unla_ d.144.1.7 (A:) Cyclin-dependent PK, CDK5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cm8a_ d.144.1.7 (A:) MAP kinase p38-gamma {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fmka3 d.144.1.7 (A:249-533) c-src tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k2pa_ d.144.1.7 (A:) Bruton's tyrosine kinase (Btk) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3blha1 d.144.1.7 (A:8-325) Cell division protein kinase 9, CDK9 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1blxa_ d.144.1.7 (A:) Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ckia_ d.144.1.7 (A:) Casein kinase-1, CK1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1jksa_ d.144.1.7 (A:) Death-associated protein kinase, Dap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fgka_ d.144.1.7 (A:) Fibroblast growth factor receptor 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vzoa_ d.144.1.7 (A:) Ribosomal protein S6 kinase alpha 5, Msk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r0pa_ d.144.1.7 (A:) Hepatocyte growth factor receptor, c-MET {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1csna_ d.144.1.7 (A:) Casein kinase-1, CK1 {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1o6ya_ d.144.1.7 (A:) Mycobacterial protein kinase PknB, catalytic domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2gfsa1 d.144.1.7 (A:5-352) MAP kinase p38 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t46a_ d.144.1.7 (A:) c-KIT receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zara2 d.144.1.9 (A:91-281) Rio2 serine protein kinase C-terminal domain {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1p4oa_ d.144.1.7 (A:) Insulin-like growth factor 1 receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fvra_ d.144.1.7 (A:) Tie2 kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vjya_ d.144.1.7 (A:) Type I TGF-beta receptor R4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1byga_ d.144.1.7 (A:) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b1pa1 d.144.1.7 (A:46-400) c-jun N-terminal kinase (jnk3s) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q8ya_ d.144.1.7 (A:) Sky1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1zara2 d.144.1.9 (A:91-281) Rio2 serine protein kinase C-terminal domain {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2ppqa1 d.144.1.6 (A:5-320) Homoserine kinase ThrB {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure