Diaphorina citri psyllid: psy6192


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170----
GFKEFAKTLANTNDPKWNQSFFYPGIRRSDLKLRSIEITVWDYTRYGVNDFLGEVIIELSSSLCTDEPEWFYLTKHTLELQFPLSNLSKTLANTNDPKWNQSFFYPGIRRSDLKLRSIEITVWDYTRYGVNDFLGEVIIELSSSLCTDEPEWFYLTKHKNSGSNPTIDNNVHSK
cccccccccccccccccccEEEccccccccccccEEEEEEccccccccccccccEEEEcccccccccccccccccccccccccccccccccccccccccccEEEEccccHHHHcccEEEEEEccccccccccEEEEEEEEcccccccccccEECcccccccccccccccccccc
**KEFAKTLANTNDPKWNQSFFYPGIRRSDLKLRSIEITVWDYTRYGVNDFLGEVIIELSSSLCTDEPEWFYLTKHTLELQFPLSNLSKTLANTNDPKWNQSFFYPGIRRSDLKLRSIEITVWDYTRYGVNDFLGEVIIELSSSLCTDEPEWFYLT******************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
GFKEFAKTLANTNDPKWNQSFFYPGIRRSDLKLRSIEITVWDYTRYGVNDFLGEVIIELSSSLCTDEPEWFYLTKHTLELQFPLSNLSKTLANTNDPKWNQSFFYPGIRRSDLKLRSIEITVWDYTRYGVNDFLGEVIIELSSSLCTDEPEWFYLTKHKNSGSNPTIDNNVHSK

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0044425 [CC]membrane partprobableGO:0005575, GO:0016020
GO:0030141 [CC]secretory granuleprobableGO:0005737, GO:0031982, GO:0016023, GO:0031410, GO:0044464, GO:0044444, GO:0005623, GO:0031988, GO:0005575, GO:0043229, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0043231
GO:0005543 [MF]phospholipid bindingprobableGO:0043168, GO:0043167, GO:0003674, GO:0008289, GO:0005488
GO:0005515 [MF]protein bindingprobableGO:0003674, GO:0005488
GO:0044446 [CC]intracellular organelle partprobableGO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043226, GO:0044422
GO:0032940 [BP]secretion by cellprobableGO:0046903, GO:0006810, GO:0009987, GO:0044765, GO:0044763, GO:0051649, GO:0008150, GO:0051234, GO:0051179, GO:0044699, GO:0051641
GO:0065008 [BP]regulation of biological qualityprobableGO:0008150, GO:0065007
GO:0097458 [CC]neuron partprobableGO:0005575, GO:0044464, GO:0005623
GO:0044456 [CC]synapse partprobableGO:0005575, GO:0045202

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1RH8, chain A
Confidence level:very confident
Coverage over the Query: 85-160
View the alignment between query and template
View the model in PyMOL
Template: 1RH8, chain A
Confidence level:very confident
Coverage over the Query: 3-77
View the alignment between query and template
View the model in PyMOL