Psyllid ID: psy6192
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 174 | ||||||
| 307179861 | 2298 | Regulating synaptic membrane exocytosis | 0.425 | 0.032 | 0.635 | 2e-22 | |
| 332029406 | 1214 | Regulating synaptic membrane exocytosis | 0.425 | 0.060 | 0.621 | 3e-22 | |
| 345494657 | 1325 | PREDICTED: regulating synaptic membrane | 0.425 | 0.055 | 0.635 | 2e-21 | |
| 427796537 | 1438 | Putative rab3 effector rim1, partial [Rh | 0.413 | 0.050 | 0.594 | 5e-21 | |
| 242020223 | 1131 | conserved hypothetical protein [Pediculu | 0.425 | 0.065 | 0.594 | 5e-21 | |
| 157137000 | 1883 | hypothetical protein AaeL_AAEL000479 [Ae | 0.454 | 0.041 | 0.594 | 3e-20 | |
| 347966387 | 2775 | AGAP001690-PB [Anopheles gambiae str. PE | 0.425 | 0.026 | 0.594 | 3e-20 | |
| 347966389 | 2744 | AGAP001690-PA [Anopheles gambiae str. PE | 0.425 | 0.026 | 0.594 | 3e-20 | |
| 307196949 | 2596 | Regulating synaptic membrane exocytosis | 0.425 | 0.028 | 0.594 | 6e-20 | |
| 312380085 | 2345 | hypothetical protein AND_07923 [Anophele | 0.425 | 0.031 | 0.608 | 9e-20 |
| >gi|307179861|gb|EFN68019.1| Regulating synaptic membrane exocytosis protein 2 [Camponotus floridanus] | Back alignment and taxonomy information |
|---|
Score = 110 bits (276), Expect = 2e-22, Method: Composition-based stats.
Identities = 47/74 (63%), Positives = 59/74 (79%)
Query: 3 KEFAKTLANTNDPKWNQSFFYPGIRRSDLKLRSIEITVWDYTRYGVNDFLGEVIIELSSS 62
K KT+ANTNDP+WNQ+FFY G+RRS+L+ R++EITVWDY RY NDFLGEV++EL+
Sbjct: 640 KRRTKTVANTNDPRWNQTFFYNGVRRSELRKRALEITVWDYARYEANDFLGEVVLELAVC 699
Query: 63 LCTDEPEWFYLTKH 76
L +EPEW LT H
Sbjct: 700 LLDEEPEWHSLTAH 713
|
Source: Camponotus floridanus Species: Camponotus floridanus Genus: Camponotus Family: Formicidae Order: Hymenoptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|332029406|gb|EGI69360.1| Regulating synaptic membrane exocytosis protein 2 [Acromyrmex echinatior] | Back alignment and taxonomy information |
|---|
| >gi|345494657|ref|XP_001604596.2| PREDICTED: regulating synaptic membrane exocytosis protein 2-like [Nasonia vitripennis] | Back alignment and taxonomy information |
|---|
| >gi|427796537|gb|JAA63720.1| Putative rab3 effector rim1, partial [Rhipicephalus pulchellus] | Back alignment and taxonomy information |
|---|
| >gi|242020223|ref|XP_002430555.1| conserved hypothetical protein [Pediculus humanus corporis] gi|212515719|gb|EEB17817.1| conserved hypothetical protein [Pediculus humanus corporis] | Back alignment and taxonomy information |
|---|
| >gi|157137000|ref|XP_001656969.1| hypothetical protein AaeL_AAEL000479 [Aedes aegypti] gi|108884236|gb|EAT48461.1| AAEL000479-PA [Aedes aegypti] | Back alignment and taxonomy information |
|---|
| >gi|347966387|ref|XP_003435904.1| AGAP001690-PB [Anopheles gambiae str. PEST] gi|333470082|gb|EGK97509.1| AGAP001690-PB [Anopheles gambiae str. PEST] | Back alignment and taxonomy information |
|---|
| >gi|347966389|ref|XP_321402.5| AGAP001690-PA [Anopheles gambiae str. PEST] gi|333470081|gb|EAA00843.6| AGAP001690-PA [Anopheles gambiae str. PEST] | Back alignment and taxonomy information |
|---|
| >gi|307196949|gb|EFN78324.1| Regulating synaptic membrane exocytosis protein 2 [Harpegnathos saltator] | Back alignment and taxonomy information |
|---|
| >gi|312380085|gb|EFR26178.1| hypothetical protein AND_07923 [Anopheles darlingi] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 174 | ||||||
| FB|FBgn0053547 | 2908 | Rim "Rab3 interacting molecule | 0.425 | 0.025 | 0.486 | 8.3e-17 | |
| MGI|MGI:2152972 | 1530 | Rims2 "regulating synaptic mem | 0.505 | 0.057 | 0.406 | 1.1e-14 | |
| RGD|620001 | 1555 | Rims2 "regulating synaptic mem | 0.488 | 0.054 | 0.409 | 1.2e-14 | |
| UNIPROTKB|F1LNC5 | 1555 | Rims2 "Regulating synaptic mem | 0.488 | 0.054 | 0.409 | 1.2e-14 | |
| UNIPROTKB|Q9JIS1 | 1555 | Rims2 "Regulating synaptic mem | 0.488 | 0.054 | 0.409 | 1.2e-14 | |
| UNIPROTKB|D4AEJ9 | 1557 | Rims2 "Regulating synaptic mem | 0.488 | 0.054 | 0.409 | 1.2e-14 | |
| UNIPROTKB|F1P9T3 | 1476 | RIMS2 "Uncharacterized protein | 0.488 | 0.057 | 0.409 | 1.7e-14 | |
| UNIPROTKB|J9NYS3 | 1611 | RIMS2 "Uncharacterized protein | 0.488 | 0.052 | 0.409 | 2.1e-14 | |
| UNIPROTKB|E1B7V2 | 1342 | RIMS2 "Uncharacterized protein | 0.488 | 0.063 | 0.409 | 2.8e-14 | |
| UNIPROTKB|F1P5P9 | 1602 | F1P5P9 "Uncharacterized protei | 0.718 | 0.078 | 0.376 | 1e-13 |
| FB|FBgn0053547 Rim "Rab3 interacting molecule" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Score = 225 (84.3 bits), Expect = 8.3e-17, P = 8.3e-17
Identities = 36/74 (48%), Positives = 54/74 (72%)
Query: 88 SKTLANTNDPKWNQSFFYPGIRRSDLKLRSIEITVWDYTRYGVNDFLGEVIIELSSSLCT 147
+KT+ T +P+W Q+F Y G+RR DL R +E+T+WDY RYG NDF+GEV+I+L+ +
Sbjct: 1225 TKTVGTTCEPRWGQTFVYSGLRRCDLNGRLLEVTLWDYVRYGANDFIGEVVIDLAHHILD 1284
Query: 148 DEPEWFYLTKHKNS 161
DE EW+ L H+++
Sbjct: 1285 DEAEWYQLQPHQDT 1298
|
|
| MGI|MGI:2152972 Rims2 "regulating synaptic membrane exocytosis 2" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| RGD|620001 Rims2 "regulating synaptic membrane exocytosis 2" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1LNC5 Rims2 "Regulating synaptic membrane exocytosis protein 2" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q9JIS1 Rims2 "Regulating synaptic membrane exocytosis protein 2" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|D4AEJ9 Rims2 "Regulating synaptic membrane exocytosis protein 2" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1P9T3 RIMS2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|J9NYS3 RIMS2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E1B7V2 RIMS2 "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1P5P9 F1P5P9 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 174 | |||
| cd04031 | 125 | cd04031, C2A_RIM1alpha, C2 domain first repeat con | 6e-27 | |
| cd04031 | 125 | cd04031, C2A_RIM1alpha, C2 domain first repeat con | 2e-26 | |
| cd08521 | 123 | cd08521, C2A_SLP, C2 domain first repeat present i | 7e-12 | |
| cd08521 | 123 | cd08521, C2A_SLP, C2 domain first repeat present i | 7e-12 | |
| smart00239 | 101 | smart00239, C2, Protein kinase C conserved region | 4e-11 | |
| cd04020 | 162 | cd04020, C2B_SLP_1-2-3-4, C2 domain second repeat | 5e-11 | |
| cd04020 | 162 | cd04020, C2B_SLP_1-2-3-4, C2 domain second repeat | 6e-11 | |
| smart00239 | 101 | smart00239, C2, Protein kinase C conserved region | 9e-11 | |
| cd00030 | 102 | cd00030, C2, C2 domain | 2e-09 | |
| pfam00168 | 85 | pfam00168, C2, C2 domain | 3e-09 | |
| cd00030 | 102 | cd00030, C2, C2 domain | 5e-09 | |
| pfam00168 | 85 | pfam00168, C2, C2 domain | 5e-09 | |
| cd08381 | 122 | cd08381, C2B_PI3K_class_II, C2 domain second repea | 6e-09 | |
| cd08381 | 122 | cd08381, C2B_PI3K_class_II, C2 domain second repea | 6e-09 | |
| cd04029 | 125 | cd04029, C2A_SLP-4_5, C2 domain first repeat prese | 3e-08 | |
| cd04029 | 125 | cd04029, C2A_SLP-4_5, C2 domain first repeat prese | 3e-08 | |
| cd04035 | 123 | cd04035, C2A_Rabphilin_Doc2, C2 domain first repea | 6e-08 | |
| cd04035 | 123 | cd04035, C2A_Rabphilin_Doc2, C2 domain first repea | 1e-07 | |
| cd08384 | 133 | cd08384, C2B_Rabphilin_Doc2, C2 domain second repe | 1e-07 | |
| cd08384 | 133 | cd08384, C2B_Rabphilin_Doc2, C2 domain second repe | 1e-07 | |
| cd04026 | 131 | cd04026, C2_PKC_alpha_gamma, C2 domain in Protein | 9e-06 | |
| cd04026 | 131 | cd04026, C2_PKC_alpha_gamma, C2 domain in Protein | 1e-05 | |
| cd04040 | 115 | cd04040, C2D_Tricalbin-like, C2 domain fourth repe | 1e-05 | |
| cd04040 | 115 | cd04040, C2D_Tricalbin-like, C2 domain fourth repe | 2e-05 | |
| cd08675 | 137 | cd08675, C2B_RasGAP, C2 domain second repeat of Ra | 2e-05 | |
| cd08393 | 125 | cd08393, C2A_SLP-1_2, C2 domain first repeat prese | 5e-05 | |
| cd08393 | 125 | cd08393, C2A_SLP-1_2, C2 domain first repeat prese | 5e-05 | |
| cd08675 | 137 | cd08675, C2B_RasGAP, C2 domain second repeat of Ra | 1e-04 | |
| cd04033 | 133 | cd04033, C2_NEDD4_NEDD4L, C2 domain present in the | 1e-04 | |
| cd08386 | 125 | cd08386, C2A_Synaptotagmin-7, C2A domain first rep | 2e-04 | |
| cd04033 | 133 | cd04033, C2_NEDD4_NEDD4L, C2 domain present in the | 4e-04 | |
| cd08402 | 136 | cd08402, C2B_Synaptotagmin-1, C2 domain second rep | 4e-04 | |
| cd08402 | 136 | cd08402, C2B_Synaptotagmin-1, C2 domain second rep | 4e-04 | |
| cd08373 | 127 | cd08373, C2A_Ferlin, C2 domain first repeat in Fer | 4e-04 | |
| cd08386 | 125 | cd08386, C2A_Synaptotagmin-7, C2A domain first rep | 5e-04 | |
| cd08410 | 135 | cd08410, C2B_Synaptotagmin-17, C2 domain second re | 6e-04 | |
| cd08410 | 135 | cd08410, C2B_Synaptotagmin-17, C2 domain second re | 7e-04 | |
| cd08376 | 116 | cd08376, C2B_MCTP_PRT, C2 domain second repeat fou | 9e-04 | |
| cd00276 | 134 | cd00276, C2B_Synaptotagmin, C2 domain second repea | 0.002 | |
| cd00276 | 134 | cd00276, C2B_Synaptotagmin, C2 domain second repea | 0.002 | |
| cd04022 | 127 | cd04022, C2A_MCTP_PRT_plant, C2 domain first repea | 0.002 | |
| cd08388 | 128 | cd08388, C2A_Synaptotagmin-4-11, C2A domain first | 0.002 | |
| cd04025 | 123 | cd04025, C2B_RasA1_RasA4, C2 domain second repeat | 0.002 | |
| cd08373 | 127 | cd08373, C2A_Ferlin, C2 domain first repeat in Fer | 0.003 | |
| cd08388 | 128 | cd08388, C2A_Synaptotagmin-4-11, C2A domain first | 0.003 | |
| cd04022 | 127 | cd04022, C2A_MCTP_PRT_plant, C2 domain first repea | 0.004 | |
| cd04024 | 128 | cd04024, C2A_Synaptotagmin-like, C2 domain first r | 0.004 | |
| cd04024 | 128 | cd04024, C2A_Synaptotagmin-like, C2 domain first r | 0.004 |
| >gnl|CDD|175997 cd04031, C2A_RIM1alpha, C2 domain first repeat contained in Rab3-interacting molecule (RIM) proteins | Back alignment and domain information |
|---|
Score = 98.1 bits (245), Expect = 6e-27
Identities = 37/68 (54%), Positives = 51/68 (75%)
Query: 88 SKTLANTNDPKWNQSFFYPGIRRSDLKLRSIEITVWDYTRYGVNDFLGEVIIELSSSLCT 147
+KT+ T +P+WNQ+F Y +RR LK R++E+TVWDY R G NDFLGEV+I+L+ +L
Sbjct: 57 TKTVKKTLNPEWNQTFEYSNVRRETLKERTLEVTVWDYDRDGENDFLGEVVIDLADALLD 116
Query: 148 DEPEWFYL 155
DEP W+ L
Sbjct: 117 DEPHWYPL 124
|
RIMs are believed to organize specialized sites of the plasma membrane called active zones. They also play a role in controlling neurotransmitter release, plasticity processes, as well as memory and learning. RIM contains an N-terminal zinc finger domain, a PDZ domain, and two C-terminal C2 domains (C2A, C2B). C2 domains fold into an 8-standed beta-sandwich that can adopt 2 structural arrangements: Type I and Type II, distinguished by a circular permutation involving their N- and C-terminal beta strands. Many C2 domains are Ca2+-dependent membrane-targeting modules that bind a wide variety of substances including bind phospholipids, inositol polyphosphates, and intracellular proteins. Most C2 domain proteins are either signal transduction enzymes that contain a single C2 domain, such as protein kinase C, or membrane trafficking proteins which contain at least two C2 domains, such as synaptotagmin 1. However, there are a few exceptions to this including RIM isoforms and some splice variants of piccolo/aczonin and intersectin which only have a single C2 domain. C2 domains with a calcium binding region have negatively charged residues, primarily aspartates, that serve as ligands for calcium ions. Members here have a type-I topology and do not bind Ca2+. Length = 125 |
| >gnl|CDD|175997 cd04031, C2A_RIM1alpha, C2 domain first repeat contained in Rab3-interacting molecule (RIM) proteins | Back alignment and domain information |
|---|
| >gnl|CDD|176056 cd08521, C2A_SLP, C2 domain first repeat present in Synaptotagmin-like proteins | Back alignment and domain information |
|---|
| >gnl|CDD|176056 cd08521, C2A_SLP, C2 domain first repeat present in Synaptotagmin-like proteins | Back alignment and domain information |
|---|
| >gnl|CDD|214577 smart00239, C2, Protein kinase C conserved region 2 (CalB) | Back alignment and domain information |
|---|
| >gnl|CDD|175987 cd04020, C2B_SLP_1-2-3-4, C2 domain second repeat present in Synaptotagmin-like proteins 1-4 | Back alignment and domain information |
|---|
| >gnl|CDD|175987 cd04020, C2B_SLP_1-2-3-4, C2 domain second repeat present in Synaptotagmin-like proteins 1-4 | Back alignment and domain information |
|---|
| >gnl|CDD|214577 smart00239, C2, Protein kinase C conserved region 2 (CalB) | Back alignment and domain information |
|---|
| >gnl|CDD|175973 cd00030, C2, C2 domain | Back alignment and domain information |
|---|
| >gnl|CDD|215765 pfam00168, C2, C2 domain | Back alignment and domain information |
|---|
| >gnl|CDD|175973 cd00030, C2, C2 domain | Back alignment and domain information |
|---|
| >gnl|CDD|215765 pfam00168, C2, C2 domain | Back alignment and domain information |
|---|
| >gnl|CDD|176027 cd08381, C2B_PI3K_class_II, C2 domain second repeat present in class II phosphatidylinositol 3-kinases (PI3Ks) | Back alignment and domain information |
|---|
| >gnl|CDD|176027 cd08381, C2B_PI3K_class_II, C2 domain second repeat present in class II phosphatidylinositol 3-kinases (PI3Ks) | Back alignment and domain information |
|---|
| >gnl|CDD|175995 cd04029, C2A_SLP-4_5, C2 domain first repeat present in Synaptotagmin-like proteins 4 and 5 | Back alignment and domain information |
|---|
| >gnl|CDD|175995 cd04029, C2A_SLP-4_5, C2 domain first repeat present in Synaptotagmin-like proteins 4 and 5 | Back alignment and domain information |
|---|
| >gnl|CDD|176000 cd04035, C2A_Rabphilin_Doc2, C2 domain first repeat present in Rabphilin and Double C2 domain | Back alignment and domain information |
|---|
| >gnl|CDD|176000 cd04035, C2A_Rabphilin_Doc2, C2 domain first repeat present in Rabphilin and Double C2 domain | Back alignment and domain information |
|---|
| >gnl|CDD|176030 cd08384, C2B_Rabphilin_Doc2, C2 domain second repeat present in Rabphilin and Double C2 domain | Back alignment and domain information |
|---|
| >gnl|CDD|176030 cd08384, C2B_Rabphilin_Doc2, C2 domain second repeat present in Rabphilin and Double C2 domain | Back alignment and domain information |
|---|
| >gnl|CDD|175992 cd04026, C2_PKC_alpha_gamma, C2 domain in Protein Kinase C (PKC) alpha and gamma | Back alignment and domain information |
|---|
| >gnl|CDD|175992 cd04026, C2_PKC_alpha_gamma, C2 domain in Protein Kinase C (PKC) alpha and gamma | Back alignment and domain information |
|---|
| >gnl|CDD|176005 cd04040, C2D_Tricalbin-like, C2 domain fourth repeat present in Tricalbin-like proteins | Back alignment and domain information |
|---|
| >gnl|CDD|176005 cd04040, C2D_Tricalbin-like, C2 domain fourth repeat present in Tricalbin-like proteins | Back alignment and domain information |
|---|
| >gnl|CDD|176057 cd08675, C2B_RasGAP, C2 domain second repeat of Ras GTPase activating proteins (GAPs) | Back alignment and domain information |
|---|
| >gnl|CDD|176039 cd08393, C2A_SLP-1_2, C2 domain first repeat present in Synaptotagmin-like proteins 1 and 2 | Back alignment and domain information |
|---|
| >gnl|CDD|176039 cd08393, C2A_SLP-1_2, C2 domain first repeat present in Synaptotagmin-like proteins 1 and 2 | Back alignment and domain information |
|---|
| >gnl|CDD|176057 cd08675, C2B_RasGAP, C2 domain second repeat of Ras GTPase activating proteins (GAPs) | Back alignment and domain information |
|---|
| >gnl|CDD|175999 cd04033, C2_NEDD4_NEDD4L, C2 domain present in the Human neural precursor cell-expressed, developmentally down-regulated 4 (NEDD4) and NEDD4-like (NEDD4L/NEDD42) | Back alignment and domain information |
|---|
| >gnl|CDD|176032 cd08386, C2A_Synaptotagmin-7, C2A domain first repeat present in Synaptotagmin 7 | Back alignment and domain information |
|---|
| >gnl|CDD|175999 cd04033, C2_NEDD4_NEDD4L, C2 domain present in the Human neural precursor cell-expressed, developmentally down-regulated 4 (NEDD4) and NEDD4-like (NEDD4L/NEDD42) | Back alignment and domain information |
|---|
| >gnl|CDD|176047 cd08402, C2B_Synaptotagmin-1, C2 domain second repeat present in Synaptotagmin 1 | Back alignment and domain information |
|---|
| >gnl|CDD|176047 cd08402, C2B_Synaptotagmin-1, C2 domain second repeat present in Synaptotagmin 1 | Back alignment and domain information |
|---|
| >gnl|CDD|176019 cd08373, C2A_Ferlin, C2 domain first repeat in Ferlin | Back alignment and domain information |
|---|
| >gnl|CDD|176032 cd08386, C2A_Synaptotagmin-7, C2A domain first repeat present in Synaptotagmin 7 | Back alignment and domain information |
|---|
| >gnl|CDD|176055 cd08410, C2B_Synaptotagmin-17, C2 domain second repeat present in Synaptotagmin 17 | Back alignment and domain information |
|---|
| >gnl|CDD|176055 cd08410, C2B_Synaptotagmin-17, C2 domain second repeat present in Synaptotagmin 17 | Back alignment and domain information |
|---|
| >gnl|CDD|176022 cd08376, C2B_MCTP_PRT, C2 domain second repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP) | Back alignment and domain information |
|---|
| >gnl|CDD|175975 cd00276, C2B_Synaptotagmin, C2 domain second repeat present in Synaptotagmin | Back alignment and domain information |
|---|
| >gnl|CDD|175975 cd00276, C2B_Synaptotagmin, C2 domain second repeat present in Synaptotagmin | Back alignment and domain information |
|---|
| >gnl|CDD|175989 cd04022, C2A_MCTP_PRT_plant, C2 domain first repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP); plant subset | Back alignment and domain information |
|---|
| >gnl|CDD|176034 cd08388, C2A_Synaptotagmin-4-11, C2A domain first repeat present in Synaptotagmins 4 and 11 | Back alignment and domain information |
|---|
| >gnl|CDD|175991 cd04025, C2B_RasA1_RasA4, C2 domain second repeat present in RasA1 and RasA4 | Back alignment and domain information |
|---|
| >gnl|CDD|176019 cd08373, C2A_Ferlin, C2 domain first repeat in Ferlin | Back alignment and domain information |
|---|
| >gnl|CDD|176034 cd08388, C2A_Synaptotagmin-4-11, C2A domain first repeat present in Synaptotagmins 4 and 11 | Back alignment and domain information |
|---|
| >gnl|CDD|175989 cd04022, C2A_MCTP_PRT_plant, C2 domain first repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP); plant subset | Back alignment and domain information |
|---|
| >gnl|CDD|175990 cd04024, C2A_Synaptotagmin-like, C2 domain first repeat present in Synaptotagmin-like proteins | Back alignment and domain information |
|---|
| >gnl|CDD|175990 cd04024, C2A_Synaptotagmin-like, C2 domain first repeat present in Synaptotagmin-like proteins | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 174 | |||
| KOG1028|consensus | 421 | 99.95 | ||
| cd08677 | 118 | C2A_Synaptotagmin-13 C2 domain. Synaptotagmin is a | 99.75 | |
| KOG2059|consensus | 800 | 99.75 | ||
| KOG0696|consensus | 683 | 99.75 | ||
| cd08677 | 118 | C2A_Synaptotagmin-13 C2 domain. Synaptotagmin is a | 99.75 | |
| cd08393 | 125 | C2A_SLP-1_2 C2 domain first repeat present in Syna | 99.68 | |
| cd08393 | 125 | C2A_SLP-1_2 C2 domain first repeat present in Syna | 99.67 | |
| cd08381 | 122 | C2B_PI3K_class_II C2 domain second repeat present | 99.67 | |
| cd04029 | 125 | C2A_SLP-4_5 C2 domain first repeat present in Syna | 99.67 | |
| cd08680 | 124 | C2_Kibra C2 domain found in Human protein Kibra. K | 99.67 | |
| cd04029 | 125 | C2A_SLP-4_5 C2 domain first repeat present in Syna | 99.66 | |
| cd08381 | 122 | C2B_PI3K_class_II C2 domain second repeat present | 99.66 | |
| cd08395 | 120 | C2C_Munc13 C2 domain third repeat in Munc13 (mamma | 99.66 | |
| cd08407 | 138 | C2B_Synaptotagmin-13 C2 domain second repeat prese | 99.65 | |
| cd08680 | 124 | C2_Kibra C2 domain found in Human protein Kibra. K | 99.65 | |
| cd08392 | 128 | C2A_SLP-3 C2 domain first repeat present in Synapt | 99.64 | |
| cd04028 | 146 | C2B_RIM1alpha C2 domain second repeat contained in | 99.64 | |
| cd08392 | 128 | C2A_SLP-3 C2 domain first repeat present in Synapt | 99.64 | |
| cd08389 | 124 | C2A_Synaptotagmin-14_16 C2A domain first repeat pr | 99.63 | |
| cd08389 | 124 | C2A_Synaptotagmin-14_16 C2A domain first repeat pr | 99.63 | |
| cd08395 | 120 | C2C_Munc13 C2 domain third repeat in Munc13 (mamma | 99.63 | |
| cd04028 | 146 | C2B_RIM1alpha C2 domain second repeat contained in | 99.62 | |
| cd04010 | 148 | C2B_RasA3 C2 domain second repeat present in RAS p | 99.62 | |
| cd08406 | 136 | C2B_Synaptotagmin-12 C2 domain second repeat prese | 99.62 | |
| cd08387 | 124 | C2A_Synaptotagmin-8 C2A domain first repeat presen | 99.6 | |
| cd08388 | 128 | C2A_Synaptotagmin-4-11 C2A domain first repeat pre | 99.59 | |
| cd04031 | 125 | C2A_RIM1alpha C2 domain first repeat contained in | 99.58 | |
| cd08385 | 124 | C2A_Synaptotagmin-1-5-6-9-10 C2A domain first repe | 99.58 | |
| cd08387 | 124 | C2A_Synaptotagmin-8 C2A domain first repeat presen | 99.57 | |
| cd04010 | 148 | C2B_RasA3 C2 domain second repeat present in RAS p | 99.57 | |
| cd04031 | 125 | C2A_RIM1alpha C2 domain first repeat contained in | 99.57 | |
| cd08521 | 123 | C2A_SLP C2 domain first repeat present in Synaptot | 99.56 | |
| cd08385 | 124 | C2A_Synaptotagmin-1-5-6-9-10 C2A domain first repe | 99.56 | |
| cd08386 | 125 | C2A_Synaptotagmin-7 C2A domain first repeat presen | 99.56 | |
| cd08682 | 126 | C2_Rab11-FIP_classI C2 domain found in Rab11-famil | 99.55 | |
| cd08692 | 135 | C2B_Tac2-N C2 domain second repeat found in Tac2-N | 99.55 | |
| cd08682 | 126 | C2_Rab11-FIP_classI C2 domain found in Rab11-famil | 99.55 | |
| cd08688 | 110 | C2_KIAA0528-like C2 domain found in the Human KIAA | 99.55 | |
| cd04030 | 127 | C2C_KIAA1228 C2 domain third repeat present in unc | 99.55 | |
| cd08408 | 138 | C2B_Synaptotagmin-14_16 C2 domain second repeat pr | 99.54 | |
| cd08386 | 125 | C2A_Synaptotagmin-7 C2A domain first repeat presen | 99.54 | |
| cd08685 | 119 | C2_RGS-like C2 domain of the Regulator Of G-Protei | 99.54 | |
| cd08388 | 128 | C2A_Synaptotagmin-4-11 C2A domain first repeat pre | 99.54 | |
| cd08521 | 123 | C2A_SLP C2 domain first repeat present in Synaptot | 99.53 | |
| cd04030 | 127 | C2C_KIAA1228 C2 domain third repeat present in unc | 99.53 | |
| cd08376 | 116 | C2B_MCTP_PRT C2 domain second repeat found in Mult | 99.53 | |
| cd08390 | 123 | C2A_Synaptotagmin-15-17 C2A domain first repeat pr | 99.52 | |
| cd04026 | 131 | C2_PKC_alpha_gamma C2 domain in Protein Kinase C ( | 99.51 | |
| cd08390 | 123 | C2A_Synaptotagmin-15-17 C2A domain first repeat pr | 99.51 | |
| cd08688 | 110 | C2_KIAA0528-like C2 domain found in the Human KIAA | 99.51 | |
| KOG1013|consensus | 362 | 99.5 | ||
| cd04022 | 127 | C2A_MCTP_PRT_plant C2 domain first repeat found in | 99.5 | |
| KOG0696|consensus | 683 | 99.5 | ||
| cd08401 | 121 | C2A_RasA2_RasA3 C2 domain first repeat present in | 99.5 | |
| cd04011 | 111 | C2B_Ferlin C2 domain second repeat in Ferlin. Ferl | 99.5 | |
| cd08410 | 135 | C2B_Synaptotagmin-17 C2 domain second repeat prese | 99.5 | |
| cd08685 | 119 | C2_RGS-like C2 domain of the Regulator Of G-Protei | 99.49 | |
| cd04020 | 162 | C2B_SLP_1-2-3-4 C2 domain second repeat present in | 99.49 | |
| cd08378 | 121 | C2B_MCTP_PRT_plant C2 domain second repeat found i | 99.49 | |
| cd08379 | 126 | C2D_MCTP_PRT_plant C2 domain fourth repeat found i | 99.48 | |
| cd08407 | 138 | C2B_Synaptotagmin-13 C2 domain second repeat prese | 99.48 | |
| cd08404 | 136 | C2B_Synaptotagmin-4 C2 domain second repeat presen | 99.48 | |
| cd04020 | 162 | C2B_SLP_1-2-3-4 C2 domain second repeat present in | 99.48 | |
| cd08379 | 126 | C2D_MCTP_PRT_plant C2 domain fourth repeat found i | 99.48 | |
| cd04039 | 108 | C2_PSD C2 domain present in Phosphatidylserine dec | 99.48 | |
| cd04016 | 121 | C2_Tollip C2 domain present in Toll-interacting pr | 99.48 | |
| cd08378 | 121 | C2B_MCTP_PRT_plant C2 domain second repeat found i | 99.47 | |
| cd08409 | 137 | C2B_Synaptotagmin-15 C2 domain second repeat prese | 99.47 | |
| cd04016 | 121 | C2_Tollip C2 domain present in Toll-interacting pr | 99.47 | |
| cd08401 | 121 | C2A_RasA2_RasA3 C2 domain first repeat present in | 99.47 | |
| cd04022 | 127 | C2A_MCTP_PRT_plant C2 domain first repeat found in | 99.47 | |
| cd08384 | 133 | C2B_Rabphilin_Doc2 C2 domain second repeat present | 99.46 | |
| cd08675 | 137 | C2B_RasGAP C2 domain second repeat of Ras GTPase a | 99.46 | |
| cd04025 | 123 | C2B_RasA1_RasA4 C2 domain second repeat present in | 99.46 | |
| cd04025 | 123 | C2B_RasA1_RasA4 C2 domain second repeat present in | 99.46 | |
| cd08690 | 155 | C2_Freud-1 C2 domain found in 5' repressor element | 99.45 | |
| cd04050 | 105 | C2B_Synaptotagmin-like C2 domain second repeat pre | 99.45 | |
| cd08678 | 126 | C2_C21orf25-like C2 domain found in the Human chro | 99.45 | |
| KOG1328|consensus | 1103 | 99.45 | ||
| cd04018 | 151 | C2C_Ferlin C2 domain third repeat in Ferlin. Ferli | 99.45 | |
| cd08408 | 138 | C2B_Synaptotagmin-14_16 C2 domain second repeat pr | 99.45 | |
| KOG1030|consensus | 168 | 99.44 | ||
| cd04041 | 111 | C2A_fungal C2 domain first repeat; fungal group. C | 99.44 | |
| cd04036 | 119 | C2_cPLA2 C2 domain present in cytosolic PhosphoLip | 99.44 | |
| cd04036 | 119 | C2_cPLA2 C2 domain present in cytosolic PhosphoLip | 99.44 | |
| cd08690 | 155 | C2_Freud-1 C2 domain found in 5' repressor element | 99.44 | |
| cd04018 | 151 | C2C_Ferlin C2 domain third repeat in Ferlin. Ferli | 99.44 | |
| cd08373 | 127 | C2A_Ferlin C2 domain first repeat in Ferlin. Ferli | 99.44 | |
| cd08376 | 116 | C2B_MCTP_PRT C2 domain second repeat found in Mult | 99.43 | |
| cd08402 | 136 | C2B_Synaptotagmin-1 C2 domain second repeat presen | 99.43 | |
| cd08675 | 137 | C2B_RasGAP C2 domain second repeat of Ras GTPase a | 99.42 | |
| cd08405 | 136 | C2B_Synaptotagmin-7 C2 domain second repeat presen | 99.42 | |
| cd08373 | 127 | C2A_Ferlin C2 domain first repeat in Ferlin. Ferli | 99.42 | |
| cd04041 | 111 | C2A_fungal C2 domain first repeat; fungal group. C | 99.42 | |
| cd08678 | 126 | C2_C21orf25-like C2 domain found in the Human chro | 99.42 | |
| cd08404 | 136 | C2B_Synaptotagmin-4 C2 domain second repeat presen | 99.42 | |
| cd08406 | 136 | C2B_Synaptotagmin-12 C2 domain second repeat prese | 99.42 | |
| cd04011 | 111 | C2B_Ferlin C2 domain second repeat in Ferlin. Ferl | 99.41 | |
| cd08394 | 127 | C2A_Munc13 C2 domain first repeat in Munc13 (mamma | 99.41 | |
| cd08384 | 133 | C2B_Rabphilin_Doc2 C2 domain second repeat present | 99.41 | |
| cd08681 | 118 | C2_fungal_Inn1p-like C2 domain found in fungal Ing | 99.4 | |
| cd04042 | 121 | C2A_MCTP_PRT C2 domain first repeat found in Multi | 99.4 | |
| cd04050 | 105 | C2B_Synaptotagmin-like C2 domain second repeat pre | 99.4 | |
| cd04039 | 108 | C2_PSD C2 domain present in Phosphatidylserine dec | 99.4 | |
| cd08692 | 135 | C2B_Tac2-N C2 domain second repeat found in Tac2-N | 99.4 | |
| cd08409 | 137 | C2B_Synaptotagmin-15 C2 domain second repeat prese | 99.39 | |
| cd08410 | 135 | C2B_Synaptotagmin-17 C2 domain second repeat prese | 99.39 | |
| cd04042 | 121 | C2A_MCTP_PRT C2 domain first repeat found in Multi | 99.38 | |
| cd08403 | 134 | C2B_Synaptotagmin-3-5-6-9-10 C2 domain second repe | 99.38 | |
| cd08400 | 126 | C2_Ras_p21A1 C2 domain present in RAS p21 protein | 99.38 | |
| cd04033 | 133 | C2_NEDD4_NEDD4L C2 domain present in the Human neu | 99.36 | |
| KOG1030|consensus | 168 | 99.36 | ||
| cd04024 | 128 | C2A_Synaptotagmin-like C2 domain first repeat pres | 99.36 | |
| cd04019 | 150 | C2C_MCTP_PRT_plant C2 domain third repeat found in | 99.36 | |
| cd08405 | 136 | C2B_Synaptotagmin-7 C2 domain second repeat presen | 99.36 | |
| cd04045 | 120 | C2C_Tricalbin-like C2 domain third repeat present | 99.36 | |
| cd08394 | 127 | C2A_Munc13 C2 domain first repeat in Munc13 (mamma | 99.35 | |
| cd08681 | 118 | C2_fungal_Inn1p-like C2 domain found in fungal Ing | 99.35 | |
| cd08382 | 123 | C2_Smurf-like C2 domain present in Smad ubiquitina | 99.35 | |
| cd04048 | 120 | C2A_Copine C2 domain first repeat in Copine. There | 99.35 | |
| cd08400 | 126 | C2_Ras_p21A1 C2 domain present in RAS p21 protein | 99.35 | |
| cd08391 | 121 | C2A_C2C_Synaptotagmin_like C2 domain first and thi | 99.35 | |
| cd04026 | 131 | C2_PKC_alpha_gamma C2 domain in Protein Kinase C ( | 99.35 | |
| cd04054 | 121 | C2A_Rasal1_RasA4 C2 domain first repeat present in | 99.35 | |
| cd04048 | 120 | C2A_Copine C2 domain first repeat in Copine. There | 99.34 | |
| cd08402 | 136 | C2B_Synaptotagmin-1 C2 domain second repeat presen | 99.34 | |
| cd04043 | 126 | C2_Munc13_fungal C2 domain in Munc13 (mammalian un | 99.34 | |
| cd08382 | 123 | C2_Smurf-like C2 domain present in Smad ubiquitina | 99.34 | |
| cd04014 | 132 | C2_PKC_epsilon C2 domain in Protein Kinase C (PKC) | 99.34 | |
| cd08403 | 134 | C2B_Synaptotagmin-3-5-6-9-10 C2 domain second repe | 99.34 | |
| cd04032 | 127 | C2_Perforin C2 domain of Perforin. Perforin contai | 99.34 | |
| cd04024 | 128 | C2A_Synaptotagmin-like C2 domain first repeat pres | 99.34 | |
| cd00276 | 134 | C2B_Synaptotagmin C2 domain second repeat present | 99.33 | |
| cd04049 | 124 | C2_putative_Elicitor-responsive_gene C2 domain pre | 99.33 | |
| cd04052 | 111 | C2B_Tricalbin-like C2 domain second repeat present | 99.33 | |
| cd08676 | 153 | C2A_Munc13-like C2 domain first repeat in Munc13 ( | 99.33 | |
| cd04043 | 126 | C2_Munc13_fungal C2 domain in Munc13 (mammalian un | 99.33 | |
| cd08391 | 121 | C2A_C2C_Synaptotagmin_like C2 domain first and thi | 99.32 | |
| cd04009 | 133 | C2B_Munc13-like C2 domain second repeat in Munc13 | 99.32 | |
| cd04019 | 150 | C2C_MCTP_PRT_plant C2 domain third repeat found in | 99.32 | |
| cd04049 | 124 | C2_putative_Elicitor-responsive_gene C2 domain pre | 99.31 | |
| cd04033 | 133 | C2_NEDD4_NEDD4L C2 domain present in the Human neu | 99.29 | |
| cd04014 | 132 | C2_PKC_epsilon C2 domain in Protein Kinase C (PKC) | 99.29 | |
| cd04032 | 127 | C2_Perforin C2 domain of Perforin. Perforin contai | 99.29 | |
| KOG1028|consensus | 421 | 99.28 | ||
| cd04035 | 123 | C2A_Rabphilin_Doc2 C2 domain first repeat present | 99.28 | |
| cd04009 | 133 | C2B_Munc13-like C2 domain second repeat in Munc13 | 99.28 | |
| cd08676 | 153 | C2A_Munc13-like C2 domain first repeat in Munc13 ( | 99.28 | |
| cd04038 | 145 | C2_ArfGAP C2 domain present in Arf GTPase Activati | 99.27 | |
| cd00276 | 134 | C2B_Synaptotagmin C2 domain second repeat present | 99.27 | |
| cd04045 | 120 | C2C_Tricalbin-like C2 domain third repeat present | 99.27 | |
| cd04054 | 121 | C2A_Rasal1_RasA4 C2 domain first repeat present in | 99.26 | |
| cd08377 | 119 | C2C_MCTP_PRT C2 domain third repeat found in Multi | 99.26 | |
| cd04040 | 115 | C2D_Tricalbin-like C2 domain fourth repeat present | 99.26 | |
| cd04015 | 158 | C2_plant_PLD C2 domain present in plant phospholip | 99.26 | |
| cd08375 | 136 | C2_Intersectin C2 domain present in Intersectin. A | 99.26 | |
| cd04040 | 115 | C2D_Tricalbin-like C2 domain fourth repeat present | 99.26 | |
| cd04017 | 135 | C2D_Ferlin C2 domain fourth repeat in Ferlin. Ferl | 99.24 | |
| cd08686 | 118 | C2_ABR C2 domain in the Active BCR (Breakpoint clu | 99.24 | |
| cd04027 | 127 | C2B_Munc13 C2 domain second repeat in Munc13 (mamm | 99.24 | |
| cd08375 | 136 | C2_Intersectin C2 domain present in Intersectin. A | 99.24 | |
| cd08691 | 137 | C2_NEDL1-like C2 domain present in NEDL1 (NEDD4-li | 99.24 | |
| cd08377 | 119 | C2C_MCTP_PRT C2 domain third repeat found in Multi | 99.23 | |
| cd04017 | 135 | C2D_Ferlin C2 domain fourth repeat in Ferlin. Ferl | 99.23 | |
| cd04035 | 123 | C2A_Rabphilin_Doc2 C2 domain first repeat present | 99.22 | |
| cd04052 | 111 | C2B_Tricalbin-like C2 domain second repeat present | 99.22 | |
| cd04046 | 126 | C2_Calpain C2 domain present in Calpain proteins. | 99.22 | |
| cd04038 | 145 | C2_ArfGAP C2 domain present in Arf GTPase Activati | 99.22 | |
| cd08383 | 117 | C2A_RasGAP C2 domain (first repeat) of Ras GTPase | 99.21 | |
| cd08691 | 137 | C2_NEDL1-like C2 domain present in NEDL1 (NEDD4-li | 99.21 | |
| cd04051 | 125 | C2_SRC2_like C2 domain present in Soybean genes Re | 99.21 | |
| cd04051 | 125 | C2_SRC2_like C2 domain present in Soybean genes Re | 99.21 | |
| cd04027 | 127 | C2B_Munc13 C2 domain second repeat in Munc13 (mamm | 99.2 | |
| cd04046 | 126 | C2_Calpain C2 domain present in Calpain proteins. | 99.18 | |
| cd04037 | 124 | C2E_Ferlin C2 domain fifth repeat in Ferlin. Ferli | 99.18 | |
| cd04037 | 124 | C2E_Ferlin C2 domain fifth repeat in Ferlin. Ferli | 99.17 | |
| cd04021 | 125 | C2_E3_ubiquitin_ligase C2 domain present in E3 ubi | 99.17 | |
| cd08374 | 133 | C2F_Ferlin C2 domain sixth repeat in Ferlin. Ferli | 99.16 | |
| cd04015 | 158 | C2_plant_PLD C2 domain present in plant phospholip | 99.16 | |
| cd04044 | 124 | C2A_Tricalbin-like C2 domain first repeat present | 99.15 | |
| cd04013 | 146 | C2_SynGAP_like C2 domain present in Ras GTPase act | 99.14 | |
| cd04044 | 124 | C2A_Tricalbin-like C2 domain first repeat present | 99.13 | |
| cd08383 | 117 | C2A_RasGAP C2 domain (first repeat) of Ras GTPase | 99.12 | |
| cd08374 | 133 | C2F_Ferlin C2 domain sixth repeat in Ferlin. Ferli | 99.11 | |
| cd08686 | 118 | C2_ABR C2 domain in the Active BCR (Breakpoint clu | 99.11 | |
| cd04021 | 125 | C2_E3_ubiquitin_ligase C2 domain present in E3 ubi | 99.09 | |
| COG5038 | 1227 | Ca2+-dependent lipid-binding protein, contains C2 | 99.08 | |
| cd04047 | 110 | C2B_Copine C2 domain second repeat in Copine. Ther | 99.08 | |
| cd04047 | 110 | C2B_Copine C2 domain second repeat in Copine. Ther | 99.08 | |
| cd04013 | 146 | C2_SynGAP_like C2 domain present in Ras GTPase act | 99.03 | |
| cd08684 | 103 | C2A_Tac2-N C2 domain first repeat found in Tac2-N | 99.01 | |
| cd00275 | 128 | C2_PLC_like C2 domain present in Phosphoinositide- | 99.0 | |
| PLN03008 | 868 | Phospholipase D delta | 98.98 | |
| cd00275 | 128 | C2_PLC_like C2 domain present in Phosphoinositide- | 98.98 | |
| COG5038 | 1227 | Ca2+-dependent lipid-binding protein, contains C2 | 98.95 | |
| PLN03200 | 2102 | cellulose synthase-interactive protein; Provisiona | 98.94 | |
| PLN03008 | 868 | Phospholipase D delta | 98.94 | |
| PLN03200 | 2102 | cellulose synthase-interactive protein; Provisiona | 98.84 | |
| PF00168 | 85 | C2: C2 domain; InterPro: IPR000008 The C2 domain i | 98.83 | |
| cd08684 | 103 | C2A_Tac2-N C2 domain first repeat found in Tac2-N | 98.81 | |
| smart00239 | 101 | C2 Protein kinase C conserved region 2 (CalB). Ca2 | 98.81 | |
| KOG1328|consensus | 1103 | 98.8 | ||
| cd00030 | 102 | C2 C2 domain. The C2 domain was first identified i | 98.78 | |
| cd00030 | 102 | C2 C2 domain. The C2 domain was first identified i | 98.77 | |
| PLN02952 | 599 | phosphoinositide phospholipase C | 98.76 | |
| PF00168 | 85 | C2: C2 domain; InterPro: IPR000008 The C2 domain i | 98.74 | |
| PLN02223 | 537 | phosphoinositide phospholipase C | 98.74 | |
| smart00239 | 101 | C2 Protein kinase C conserved region 2 (CalB). Ca2 | 98.73 | |
| PLN02952 | 599 | phosphoinositide phospholipase C | 98.73 | |
| PLN02223 | 537 | phosphoinositide phospholipase C | 98.73 | |
| KOG1327|consensus | 529 | 98.64 | ||
| PLN02222 | 581 | phosphoinositide phospholipase C 2 | 98.61 | |
| PLN02230 | 598 | phosphoinositide phospholipase C 4 | 98.6 | |
| PLN02230 | 598 | phosphoinositide phospholipase C 4 | 98.54 | |
| KOG0169|consensus | 746 | 98.53 | ||
| PLN02222 | 581 | phosphoinositide phospholipase C 2 | 98.51 | |
| KOG1326|consensus | 1105 | 98.51 | ||
| KOG0169|consensus | 746 | 98.43 | ||
| KOG1011|consensus | 1283 | 98.42 | ||
| KOG0905|consensus | 1639 | 98.37 | ||
| KOG0905|consensus | 1639 | 98.37 | ||
| PLN02228 | 567 | Phosphoinositide phospholipase C | 98.35 | |
| KOG1031|consensus | 1169 | 98.33 | ||
| PLN02228 | 567 | Phosphoinositide phospholipase C | 98.27 | |
| KOG1264|consensus | 1267 | 98.22 | ||
| KOG2059|consensus | 800 | 98.14 | ||
| PLN02270 | 808 | phospholipase D alpha | 98.03 | |
| KOG1326|consensus | 1105 | 97.97 | ||
| KOG1031|consensus | 1169 | 97.94 | ||
| KOG1011|consensus | 1283 | 97.85 | ||
| PLN02964 | 644 | phosphatidylserine decarboxylase | 97.79 | |
| cd08683 | 143 | C2_C2cd3 C2 domain found in C2 calcium-dependent d | 97.74 | |
| KOG1264|consensus | 1267 | 97.73 | ||
| KOG1013|consensus | 362 | 97.68 | ||
| KOG2060|consensus | 405 | 97.55 | ||
| PLN02270 | 808 | phospholipase D alpha | 97.47 | |
| PLN02964 | 644 | phosphatidylserine decarboxylase | 97.41 | |
| PLN02352 | 758 | phospholipase D epsilon | 97.3 | |
| cd08683 | 143 | C2_C2cd3 C2 domain found in C2 calcium-dependent d | 97.25 | |
| cd08689 | 109 | C2_fungal_Pkc1p C2 domain found in protein kinase | 96.98 | |
| cd08689 | 109 | C2_fungal_Pkc1p C2 domain found in protein kinase | 96.96 | |
| cd08397 | 159 | C2_PI3K_class_III C2 domain present in class III p | 96.78 | |
| cd08397 | 159 | C2_PI3K_class_III C2 domain present in class III p | 96.62 | |
| cd08380 | 156 | C2_PI3K_like C2 domain present in phosphatidylinos | 95.92 | |
| KOG1265|consensus | 1189 | 95.82 | ||
| PF00792 | 142 | PI3K_C2: Phosphoinositide 3-kinase C2; InterPro: I | 95.79 | |
| PF00792 | 142 | PI3K_C2: Phosphoinositide 3-kinase C2; InterPro: I | 95.74 | |
| cd08398 | 158 | C2_PI3K_class_I_alpha C2 domain present in class I | 95.72 | |
| KOG1327|consensus | 529 | 95.59 | ||
| PF14429 | 184 | DOCK-C2: C2 domain in Dock180 and Zizimin proteins | 95.5 | |
| cd08380 | 156 | C2_PI3K_like C2 domain present in phosphatidylinos | 95.5 | |
| cd08695 | 189 | C2_Dock-B C2 domains found in Dedicator Of CytoKin | 95.38 | |
| cd08693 | 173 | C2_PI3K_class_I_beta_delta C2 domain present in cl | 95.38 | |
| cd08695 | 189 | C2_Dock-B C2 domains found in Dedicator Of CytoKin | 95.32 | |
| PF12416 | 340 | DUF3668: Cep120 protein; InterPro: IPR022136 This | 95.16 | |
| PLN02352 | 758 | phospholipase D epsilon | 95.1 | |
| KOG3837|consensus | 523 | 95.06 | ||
| KOG3837|consensus | 523 | 95.0 | ||
| cd08694 | 196 | C2_Dock-A C2 domains found in Dedicator Of CytoKin | 94.83 | |
| cd08693 | 173 | C2_PI3K_class_I_beta_delta C2 domain present in cl | 94.76 | |
| cd08694 | 196 | C2_Dock-A C2 domains found in Dedicator Of CytoKin | 94.74 | |
| cd08398 | 158 | C2_PI3K_class_I_alpha C2 domain present in class I | 94.71 | |
| cd08399 | 178 | C2_PI3K_class_I_gamma C2 domain present in class I | 94.59 | |
| PF14429 | 184 | DOCK-C2: C2 domain in Dock180 and Zizimin proteins | 94.54 | |
| KOG1265|consensus | 1189 | 94.46 | ||
| cd08399 | 178 | C2_PI3K_class_I_gamma C2 domain present in class I | 94.06 | |
| PF15627 | 156 | CEP76-C2: CEP76 C2 domain | 93.82 | |
| cd08679 | 178 | C2_DOCK180_related C2 domains found in Dedicator O | 93.45 | |
| cd04012 | 171 | C2A_PI3K_class_II C2 domain first repeat present i | 92.88 | |
| cd08679 | 178 | C2_DOCK180_related C2 domains found in Dedicator O | 92.83 | |
| cd04012 | 171 | C2A_PI3K_class_II C2 domain first repeat present i | 92.75 | |
| cd08696 | 179 | C2_Dock-C C2 domains found in Dedicator Of CytoKin | 92.38 | |
| cd08696 | 179 | C2_Dock-C C2 domains found in Dedicator Of CytoKin | 91.09 | |
| cd08697 | 185 | C2_Dock-D C2 domains found in Dedicator Of CytoKin | 90.86 | |
| PF12416 | 340 | DUF3668: Cep120 protein; InterPro: IPR022136 This | 90.4 | |
| smart00142 | 100 | PI3K_C2 Phosphoinositide 3-kinase, region postulat | 90.16 | |
| smart00142 | 100 | PI3K_C2 Phosphoinositide 3-kinase, region postulat | 90.09 | |
| KOG2060|consensus | 405 | 89.76 | ||
| PF15627 | 156 | CEP76-C2: CEP76 C2 domain | 89.69 | |
| cd08697 | 185 | C2_Dock-D C2 domains found in Dedicator Of CytoKin | 89.34 | |
| PF10358 | 143 | NT-C2: N-terminal C2 in EEIG1 and EHBP1 proteins; | 85.54 | |
| KOG0906|consensus | 843 | 83.63 | ||
| PF10358 | 143 | NT-C2: N-terminal C2 in EEIG1 and EHBP1 proteins; | 80.43 |
| >KOG1028|consensus | Back alignment and domain information |
|---|
Probab=99.95 E-value=1.6e-27 Score=191.19 Aligned_cols=140 Identities=28% Similarity=0.498 Sum_probs=123.4
Q ss_pred ceEeceeecCCCCCccCceEEcCCcCcCcCCcceEEEEEEeCCCCCCCceEEEEEEecccccCCCC-CceEEeccc----
Q psy6192 2 FKEFAKTLANTNDPKWNQSFFYPGIRRSDLKLRSIEITVWDYTRYGVNDFLGEVIIELSSSLCTDE-PEWFYLTKH---- 76 (174)
Q Consensus 2 ~k~rT~~~~~t~nP~w~E~f~f~~v~~~~~~~~~L~i~v~d~~~~~~~~~lG~~~~~l~~~~~~~~-~~w~~L~~~---- 76 (174)
+|.+|++.++|+||.|||+|.|. |+.+++...+|.+.|||+|+++++++||++.++|..+..... ..|.+|.+.
T Consensus 202 ~k~kT~v~r~tlnP~fnEtf~f~-v~~~~l~~~~L~l~V~~~drfsr~~~iGev~~~l~~~~~~~~~~~w~~l~~~~~~~ 280 (421)
T KOG1028|consen 202 GKFKTRVHRKTLNPVFNETFRFE-VPYEELSNRVLHLSVYDFDRFSRHDFIGEVILPLGEVDLLSTTLFWKDLQPSSTDS 280 (421)
T ss_pred CcceeeeeecCcCCccccceEee-cCHHHhccCEEEEEEEecCCcccccEEEEEEecCccccccccceeeeccccccCCc
Confidence 57899999999999999999998 999999999999999999999999999999999988776554 459888763
Q ss_pred ---ceEec----c-C--------------------------C-------------CCccccccCCCCCccccEEEeCccc
Q psy6192 77 ---TLELQ----F-P--------------------------L-------------SNLSKTLANTNDPKWNQSFFYPGIR 109 (174)
Q Consensus 77 ---~~~l~----~-p--------------------------~-------------~~kT~~~~~t~~P~wne~~~f~~~~ 109 (174)
.+++. | | + ++||.+++++.||+|||+|.|. ++
T Consensus 281 ~~~~gel~~sL~Y~p~~g~ltv~v~kar~L~~~~~~~~~d~~Vk~~l~~~~~~~~kkkT~~~~~~~npv~nesf~F~-vp 359 (421)
T KOG1028|consen 281 EELAGELLLSLCYLPTAGRLTVVVIKARNLKSMDVGGLSDPYVKVTLLDGDKRLSKKKTSVKKKTLNPVFNETFVFD-VP 359 (421)
T ss_pred ccccceEEEEEEeecCCCeEEEEEEEecCCCcccCCCCCCccEEEEEecCCceeeeeeeecccCCCCCcccccEEEe-CC
Confidence 11221 1 1 0 7889999999999999999998 99
Q ss_pred cCCCCcceEEEEEEeCCCCCCCceeEEEEEeCCc
Q psy6192 110 RSDLKLRSIEITVWDYTRYGVNDFLGEVIIELSS 143 (174)
Q Consensus 110 ~~~~~~~~l~i~v~d~~~~~~~~~iG~~~l~l~~ 143 (174)
.+++.+..+.|+|||++.++++++||.+.++...
T Consensus 360 ~~~l~~~~l~l~V~d~d~~~~~~~iG~~~lG~~~ 393 (421)
T KOG1028|consen 360 PEQLAEVSLELTVWDHDTLGSNDLIGRCILGSDS 393 (421)
T ss_pred HHHhheeEEEEEEEEcccccccceeeEEEecCCC
Confidence 9999989999999999999999999999999885
|
|
| >cd08677 C2A_Synaptotagmin-13 C2 domain | Back alignment and domain information |
|---|
| >KOG2059|consensus | Back alignment and domain information |
|---|
| >KOG0696|consensus | Back alignment and domain information |
|---|
| >cd08677 C2A_Synaptotagmin-13 C2 domain | Back alignment and domain information |
|---|
| >cd08393 C2A_SLP-1_2 C2 domain first repeat present in Synaptotagmin-like proteins 1 and 2 | Back alignment and domain information |
|---|
| >cd08393 C2A_SLP-1_2 C2 domain first repeat present in Synaptotagmin-like proteins 1 and 2 | Back alignment and domain information |
|---|
| >cd08381 C2B_PI3K_class_II C2 domain second repeat present in class II phosphatidylinositol 3-kinases (PI3Ks) | Back alignment and domain information |
|---|
| >cd04029 C2A_SLP-4_5 C2 domain first repeat present in Synaptotagmin-like proteins 4 and 5 | Back alignment and domain information |
|---|
| >cd08680 C2_Kibra C2 domain found in Human protein Kibra | Back alignment and domain information |
|---|
| >cd04029 C2A_SLP-4_5 C2 domain first repeat present in Synaptotagmin-like proteins 4 and 5 | Back alignment and domain information |
|---|
| >cd08381 C2B_PI3K_class_II C2 domain second repeat present in class II phosphatidylinositol 3-kinases (PI3Ks) | Back alignment and domain information |
|---|
| >cd08395 C2C_Munc13 C2 domain third repeat in Munc13 (mammalian uncoordinated) proteins | Back alignment and domain information |
|---|
| >cd08407 C2B_Synaptotagmin-13 C2 domain second repeat present in Synaptotagmin 13 | Back alignment and domain information |
|---|
| >cd08680 C2_Kibra C2 domain found in Human protein Kibra | Back alignment and domain information |
|---|
| >cd08392 C2A_SLP-3 C2 domain first repeat present in Synaptotagmin-like protein 3 | Back alignment and domain information |
|---|
| >cd04028 C2B_RIM1alpha C2 domain second repeat contained in Rab3-interacting molecule (RIM) proteins | Back alignment and domain information |
|---|
| >cd08392 C2A_SLP-3 C2 domain first repeat present in Synaptotagmin-like protein 3 | Back alignment and domain information |
|---|
| >cd08389 C2A_Synaptotagmin-14_16 C2A domain first repeat present in Synaptotagmins 14 and 16 | Back alignment and domain information |
|---|
| >cd08389 C2A_Synaptotagmin-14_16 C2A domain first repeat present in Synaptotagmins 14 and 16 | Back alignment and domain information |
|---|
| >cd08395 C2C_Munc13 C2 domain third repeat in Munc13 (mammalian uncoordinated) proteins | Back alignment and domain information |
|---|
| >cd04028 C2B_RIM1alpha C2 domain second repeat contained in Rab3-interacting molecule (RIM) proteins | Back alignment and domain information |
|---|
| >cd04010 C2B_RasA3 C2 domain second repeat present in RAS p21 protein activator 3 (RasA3) | Back alignment and domain information |
|---|
| >cd08406 C2B_Synaptotagmin-12 C2 domain second repeat present in Synaptotagmin 12 | Back alignment and domain information |
|---|
| >cd08387 C2A_Synaptotagmin-8 C2A domain first repeat present in Synaptotagmin 8 | Back alignment and domain information |
|---|
| >cd08388 C2A_Synaptotagmin-4-11 C2A domain first repeat present in Synaptotagmins 4 and 11 | Back alignment and domain information |
|---|
| >cd04031 C2A_RIM1alpha C2 domain first repeat contained in Rab3-interacting molecule (RIM) proteins | Back alignment and domain information |
|---|
| >cd08385 C2A_Synaptotagmin-1-5-6-9-10 C2A domain first repeat present in Synaptotagmins 1, 5, 6, 9, and 10 | Back alignment and domain information |
|---|
| >cd08387 C2A_Synaptotagmin-8 C2A domain first repeat present in Synaptotagmin 8 | Back alignment and domain information |
|---|
| >cd04010 C2B_RasA3 C2 domain second repeat present in RAS p21 protein activator 3 (RasA3) | Back alignment and domain information |
|---|
| >cd04031 C2A_RIM1alpha C2 domain first repeat contained in Rab3-interacting molecule (RIM) proteins | Back alignment and domain information |
|---|
| >cd08521 C2A_SLP C2 domain first repeat present in Synaptotagmin-like proteins | Back alignment and domain information |
|---|
| >cd08385 C2A_Synaptotagmin-1-5-6-9-10 C2A domain first repeat present in Synaptotagmins 1, 5, 6, 9, and 10 | Back alignment and domain information |
|---|
| >cd08386 C2A_Synaptotagmin-7 C2A domain first repeat present in Synaptotagmin 7 | Back alignment and domain information |
|---|
| >cd08682 C2_Rab11-FIP_classI C2 domain found in Rab11-family interacting proteins (FIP) class I | Back alignment and domain information |
|---|
| >cd08692 C2B_Tac2-N C2 domain second repeat found in Tac2-N (Tandem C2 protein in Nucleus) | Back alignment and domain information |
|---|
| >cd08682 C2_Rab11-FIP_classI C2 domain found in Rab11-family interacting proteins (FIP) class I | Back alignment and domain information |
|---|
| >cd08688 C2_KIAA0528-like C2 domain found in the Human KIAA0528 cDNA clone | Back alignment and domain information |
|---|
| >cd04030 C2C_KIAA1228 C2 domain third repeat present in uncharacterized human KIAA1228-like proteins | Back alignment and domain information |
|---|
| >cd08408 C2B_Synaptotagmin-14_16 C2 domain second repeat present in Synaptotagmins 14 and 16 | Back alignment and domain information |
|---|
| >cd08386 C2A_Synaptotagmin-7 C2A domain first repeat present in Synaptotagmin 7 | Back alignment and domain information |
|---|
| >cd08685 C2_RGS-like C2 domain of the Regulator Of G-Protein Signaling (RGS) family | Back alignment and domain information |
|---|
| >cd08388 C2A_Synaptotagmin-4-11 C2A domain first repeat present in Synaptotagmins 4 and 11 | Back alignment and domain information |
|---|
| >cd08521 C2A_SLP C2 domain first repeat present in Synaptotagmin-like proteins | Back alignment and domain information |
|---|
| >cd04030 C2C_KIAA1228 C2 domain third repeat present in uncharacterized human KIAA1228-like proteins | Back alignment and domain information |
|---|
| >cd08376 C2B_MCTP_PRT C2 domain second repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP) | Back alignment and domain information |
|---|
| >cd08390 C2A_Synaptotagmin-15-17 C2A domain first repeat present in Synaptotagmins 15 and 17 | Back alignment and domain information |
|---|
| >cd04026 C2_PKC_alpha_gamma C2 domain in Protein Kinase C (PKC) alpha and gamma | Back alignment and domain information |
|---|
| >cd08390 C2A_Synaptotagmin-15-17 C2A domain first repeat present in Synaptotagmins 15 and 17 | Back alignment and domain information |
|---|
| >cd08688 C2_KIAA0528-like C2 domain found in the Human KIAA0528 cDNA clone | Back alignment and domain information |
|---|
| >KOG1013|consensus | Back alignment and domain information |
|---|
| >cd04022 C2A_MCTP_PRT_plant C2 domain first repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP); plant subset | Back alignment and domain information |
|---|
| >KOG0696|consensus | Back alignment and domain information |
|---|
| >cd08401 C2A_RasA2_RasA3 C2 domain first repeat present in RasA2 and RasA3 | Back alignment and domain information |
|---|
| >cd04011 C2B_Ferlin C2 domain second repeat in Ferlin | Back alignment and domain information |
|---|
| >cd08410 C2B_Synaptotagmin-17 C2 domain second repeat present in Synaptotagmin 17 | Back alignment and domain information |
|---|
| >cd08685 C2_RGS-like C2 domain of the Regulator Of G-Protein Signaling (RGS) family | Back alignment and domain information |
|---|
| >cd04020 C2B_SLP_1-2-3-4 C2 domain second repeat present in Synaptotagmin-like proteins 1-4 | Back alignment and domain information |
|---|
| >cd08378 C2B_MCTP_PRT_plant C2 domain second repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP); plant subset | Back alignment and domain information |
|---|
| >cd08379 C2D_MCTP_PRT_plant C2 domain fourth repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP); plant subset | Back alignment and domain information |
|---|
| >cd08407 C2B_Synaptotagmin-13 C2 domain second repeat present in Synaptotagmin 13 | Back alignment and domain information |
|---|
| >cd08404 C2B_Synaptotagmin-4 C2 domain second repeat present in Synaptotagmin 4 | Back alignment and domain information |
|---|
| >cd04020 C2B_SLP_1-2-3-4 C2 domain second repeat present in Synaptotagmin-like proteins 1-4 | Back alignment and domain information |
|---|
| >cd08379 C2D_MCTP_PRT_plant C2 domain fourth repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP); plant subset | Back alignment and domain information |
|---|
| >cd04039 C2_PSD C2 domain present in Phosphatidylserine decarboxylase (PSD) | Back alignment and domain information |
|---|
| >cd04016 C2_Tollip C2 domain present in Toll-interacting protein (Tollip) | Back alignment and domain information |
|---|
| >cd08378 C2B_MCTP_PRT_plant C2 domain second repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP); plant subset | Back alignment and domain information |
|---|
| >cd08409 C2B_Synaptotagmin-15 C2 domain second repeat present in Synaptotagmin 15 | Back alignment and domain information |
|---|
| >cd04016 C2_Tollip C2 domain present in Toll-interacting protein (Tollip) | Back alignment and domain information |
|---|
| >cd08401 C2A_RasA2_RasA3 C2 domain first repeat present in RasA2 and RasA3 | Back alignment and domain information |
|---|
| >cd04022 C2A_MCTP_PRT_plant C2 domain first repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP); plant subset | Back alignment and domain information |
|---|
| >cd08384 C2B_Rabphilin_Doc2 C2 domain second repeat present in Rabphilin and Double C2 domain | Back alignment and domain information |
|---|
| >cd08675 C2B_RasGAP C2 domain second repeat of Ras GTPase activating proteins (GAPs) | Back alignment and domain information |
|---|
| >cd04025 C2B_RasA1_RasA4 C2 domain second repeat present in RasA1 and RasA4 | Back alignment and domain information |
|---|
| >cd04025 C2B_RasA1_RasA4 C2 domain second repeat present in RasA1 and RasA4 | Back alignment and domain information |
|---|
| >cd08690 C2_Freud-1 C2 domain found in 5' repressor element under dual repression binding protein-1 (Freud-1) | Back alignment and domain information |
|---|
| >cd04050 C2B_Synaptotagmin-like C2 domain second repeat present in Synaptotagmin-like proteins | Back alignment and domain information |
|---|
| >cd08678 C2_C21orf25-like C2 domain found in the Human chromosome 21 open reading frame 25 (C21orf25) protein | Back alignment and domain information |
|---|
| >KOG1328|consensus | Back alignment and domain information |
|---|
| >cd04018 C2C_Ferlin C2 domain third repeat in Ferlin | Back alignment and domain information |
|---|
| >cd08408 C2B_Synaptotagmin-14_16 C2 domain second repeat present in Synaptotagmins 14 and 16 | Back alignment and domain information |
|---|
| >KOG1030|consensus | Back alignment and domain information |
|---|
| >cd04041 C2A_fungal C2 domain first repeat; fungal group | Back alignment and domain information |
|---|
| >cd04036 C2_cPLA2 C2 domain present in cytosolic PhosphoLipase A2 (cPLA2) | Back alignment and domain information |
|---|
| >cd04036 C2_cPLA2 C2 domain present in cytosolic PhosphoLipase A2 (cPLA2) | Back alignment and domain information |
|---|
| >cd08690 C2_Freud-1 C2 domain found in 5' repressor element under dual repression binding protein-1 (Freud-1) | Back alignment and domain information |
|---|
| >cd04018 C2C_Ferlin C2 domain third repeat in Ferlin | Back alignment and domain information |
|---|
| >cd08373 C2A_Ferlin C2 domain first repeat in Ferlin | Back alignment and domain information |
|---|
| >cd08376 C2B_MCTP_PRT C2 domain second repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP) | Back alignment and domain information |
|---|
| >cd08402 C2B_Synaptotagmin-1 C2 domain second repeat present in Synaptotagmin 1 | Back alignment and domain information |
|---|
| >cd08675 C2B_RasGAP C2 domain second repeat of Ras GTPase activating proteins (GAPs) | Back alignment and domain information |
|---|
| >cd08405 C2B_Synaptotagmin-7 C2 domain second repeat present in Synaptotagmin 7 | Back alignment and domain information |
|---|
| >cd08373 C2A_Ferlin C2 domain first repeat in Ferlin | Back alignment and domain information |
|---|
| >cd04041 C2A_fungal C2 domain first repeat; fungal group | Back alignment and domain information |
|---|
| >cd08678 C2_C21orf25-like C2 domain found in the Human chromosome 21 open reading frame 25 (C21orf25) protein | Back alignment and domain information |
|---|
| >cd08404 C2B_Synaptotagmin-4 C2 domain second repeat present in Synaptotagmin 4 | Back alignment and domain information |
|---|
| >cd08406 C2B_Synaptotagmin-12 C2 domain second repeat present in Synaptotagmin 12 | Back alignment and domain information |
|---|
| >cd04011 C2B_Ferlin C2 domain second repeat in Ferlin | Back alignment and domain information |
|---|
| >cd08394 C2A_Munc13 C2 domain first repeat in Munc13 (mammalian uncoordinated) proteins | Back alignment and domain information |
|---|
| >cd08384 C2B_Rabphilin_Doc2 C2 domain second repeat present in Rabphilin and Double C2 domain | Back alignment and domain information |
|---|
| >cd08681 C2_fungal_Inn1p-like C2 domain found in fungal Ingression 1 (Inn1) proteins | Back alignment and domain information |
|---|
| >cd04042 C2A_MCTP_PRT C2 domain first repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP) | Back alignment and domain information |
|---|
| >cd04050 C2B_Synaptotagmin-like C2 domain second repeat present in Synaptotagmin-like proteins | Back alignment and domain information |
|---|
| >cd04039 C2_PSD C2 domain present in Phosphatidylserine decarboxylase (PSD) | Back alignment and domain information |
|---|
| >cd08692 C2B_Tac2-N C2 domain second repeat found in Tac2-N (Tandem C2 protein in Nucleus) | Back alignment and domain information |
|---|
| >cd08409 C2B_Synaptotagmin-15 C2 domain second repeat present in Synaptotagmin 15 | Back alignment and domain information |
|---|
| >cd08410 C2B_Synaptotagmin-17 C2 domain second repeat present in Synaptotagmin 17 | Back alignment and domain information |
|---|
| >cd04042 C2A_MCTP_PRT C2 domain first repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP) | Back alignment and domain information |
|---|
| >cd08403 C2B_Synaptotagmin-3-5-6-9-10 C2 domain second repeat present in Synaptotagmins 3, 5, 6, 9, and 10 | Back alignment and domain information |
|---|
| >cd08400 C2_Ras_p21A1 C2 domain present in RAS p21 protein activator 1 (RasA1) | Back alignment and domain information |
|---|
| >cd04033 C2_NEDD4_NEDD4L C2 domain present in the Human neural precursor cell-expressed, developmentally down-regulated 4 (NEDD4) and NEDD4-like (NEDD4L/NEDD42) | Back alignment and domain information |
|---|
| >KOG1030|consensus | Back alignment and domain information |
|---|
| >cd04024 C2A_Synaptotagmin-like C2 domain first repeat present in Synaptotagmin-like proteins | Back alignment and domain information |
|---|
| >cd04019 C2C_MCTP_PRT_plant C2 domain third repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP); plant subset | Back alignment and domain information |
|---|
| >cd08405 C2B_Synaptotagmin-7 C2 domain second repeat present in Synaptotagmin 7 | Back alignment and domain information |
|---|
| >cd04045 C2C_Tricalbin-like C2 domain third repeat present in Tricalbin-like proteins | Back alignment and domain information |
|---|
| >cd08394 C2A_Munc13 C2 domain first repeat in Munc13 (mammalian uncoordinated) proteins | Back alignment and domain information |
|---|
| >cd08681 C2_fungal_Inn1p-like C2 domain found in fungal Ingression 1 (Inn1) proteins | Back alignment and domain information |
|---|
| >cd08382 C2_Smurf-like C2 domain present in Smad ubiquitination-related factor (Smurf)-like proteins | Back alignment and domain information |
|---|
| >cd04048 C2A_Copine C2 domain first repeat in Copine | Back alignment and domain information |
|---|
| >cd08400 C2_Ras_p21A1 C2 domain present in RAS p21 protein activator 1 (RasA1) | Back alignment and domain information |
|---|
| >cd08391 C2A_C2C_Synaptotagmin_like C2 domain first and third repeat in Synaptotagmin-like proteins | Back alignment and domain information |
|---|
| >cd04026 C2_PKC_alpha_gamma C2 domain in Protein Kinase C (PKC) alpha and gamma | Back alignment and domain information |
|---|
| >cd04054 C2A_Rasal1_RasA4 C2 domain first repeat present in RasA1 and RasA4 | Back alignment and domain information |
|---|
| >cd04048 C2A_Copine C2 domain first repeat in Copine | Back alignment and domain information |
|---|
| >cd08402 C2B_Synaptotagmin-1 C2 domain second repeat present in Synaptotagmin 1 | Back alignment and domain information |
|---|
| >cd04043 C2_Munc13_fungal C2 domain in Munc13 (mammalian uncoordinated) proteins; fungal group | Back alignment and domain information |
|---|
| >cd08382 C2_Smurf-like C2 domain present in Smad ubiquitination-related factor (Smurf)-like proteins | Back alignment and domain information |
|---|
| >cd04014 C2_PKC_epsilon C2 domain in Protein Kinase C (PKC) epsilon | Back alignment and domain information |
|---|
| >cd08403 C2B_Synaptotagmin-3-5-6-9-10 C2 domain second repeat present in Synaptotagmins 3, 5, 6, 9, and 10 | Back alignment and domain information |
|---|
| >cd04032 C2_Perforin C2 domain of Perforin | Back alignment and domain information |
|---|
| >cd04024 C2A_Synaptotagmin-like C2 domain first repeat present in Synaptotagmin-like proteins | Back alignment and domain information |
|---|
| >cd00276 C2B_Synaptotagmin C2 domain second repeat present in Synaptotagmin | Back alignment and domain information |
|---|
| >cd04049 C2_putative_Elicitor-responsive_gene C2 domain present in the putative elicitor-responsive gene | Back alignment and domain information |
|---|
| >cd04052 C2B_Tricalbin-like C2 domain second repeat present in Tricalbin-like proteins | Back alignment and domain information |
|---|
| >cd08676 C2A_Munc13-like C2 domain first repeat in Munc13 (mammalian uncoordinated)-like proteins | Back alignment and domain information |
|---|
| >cd04043 C2_Munc13_fungal C2 domain in Munc13 (mammalian uncoordinated) proteins; fungal group | Back alignment and domain information |
|---|
| >cd08391 C2A_C2C_Synaptotagmin_like C2 domain first and third repeat in Synaptotagmin-like proteins | Back alignment and domain information |
|---|
| >cd04009 C2B_Munc13-like C2 domain second repeat in Munc13 (mammalian uncoordinated)-like proteins | Back alignment and domain information |
|---|
| >cd04019 C2C_MCTP_PRT_plant C2 domain third repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP); plant subset | Back alignment and domain information |
|---|
| >cd04049 C2_putative_Elicitor-responsive_gene C2 domain present in the putative elicitor-responsive gene | Back alignment and domain information |
|---|
| >cd04033 C2_NEDD4_NEDD4L C2 domain present in the Human neural precursor cell-expressed, developmentally down-regulated 4 (NEDD4) and NEDD4-like (NEDD4L/NEDD42) | Back alignment and domain information |
|---|
| >cd04014 C2_PKC_epsilon C2 domain in Protein Kinase C (PKC) epsilon | Back alignment and domain information |
|---|
| >cd04032 C2_Perforin C2 domain of Perforin | Back alignment and domain information |
|---|
| >KOG1028|consensus | Back alignment and domain information |
|---|
| >cd04035 C2A_Rabphilin_Doc2 C2 domain first repeat present in Rabphilin and Double C2 domain | Back alignment and domain information |
|---|
| >cd04009 C2B_Munc13-like C2 domain second repeat in Munc13 (mammalian uncoordinated)-like proteins | Back alignment and domain information |
|---|
| >cd08676 C2A_Munc13-like C2 domain first repeat in Munc13 (mammalian uncoordinated)-like proteins | Back alignment and domain information |
|---|
| >cd04038 C2_ArfGAP C2 domain present in Arf GTPase Activating Proteins (GAP) | Back alignment and domain information |
|---|
| >cd00276 C2B_Synaptotagmin C2 domain second repeat present in Synaptotagmin | Back alignment and domain information |
|---|
| >cd04045 C2C_Tricalbin-like C2 domain third repeat present in Tricalbin-like proteins | Back alignment and domain information |
|---|
| >cd04054 C2A_Rasal1_RasA4 C2 domain first repeat present in RasA1 and RasA4 | Back alignment and domain information |
|---|
| >cd08377 C2C_MCTP_PRT C2 domain third repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP) | Back alignment and domain information |
|---|
| >cd04040 C2D_Tricalbin-like C2 domain fourth repeat present in Tricalbin-like proteins | Back alignment and domain information |
|---|
| >cd04015 C2_plant_PLD C2 domain present in plant phospholipase D (PLD) | Back alignment and domain information |
|---|
| >cd08375 C2_Intersectin C2 domain present in Intersectin | Back alignment and domain information |
|---|
| >cd04040 C2D_Tricalbin-like C2 domain fourth repeat present in Tricalbin-like proteins | Back alignment and domain information |
|---|
| >cd04017 C2D_Ferlin C2 domain fourth repeat in Ferlin | Back alignment and domain information |
|---|
| >cd08686 C2_ABR C2 domain in the Active BCR (Breakpoint cluster region) Related protein | Back alignment and domain information |
|---|
| >cd04027 C2B_Munc13 C2 domain second repeat in Munc13 (mammalian uncoordinated) proteins | Back alignment and domain information |
|---|
| >cd08375 C2_Intersectin C2 domain present in Intersectin | Back alignment and domain information |
|---|
| >cd08691 C2_NEDL1-like C2 domain present in NEDL1 (NEDD4-like ubiquitin protein ligase-1) | Back alignment and domain information |
|---|
| >cd08377 C2C_MCTP_PRT C2 domain third repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP) | Back alignment and domain information |
|---|
| >cd04017 C2D_Ferlin C2 domain fourth repeat in Ferlin | Back alignment and domain information |
|---|
| >cd04035 C2A_Rabphilin_Doc2 C2 domain first repeat present in Rabphilin and Double C2 domain | Back alignment and domain information |
|---|
| >cd04052 C2B_Tricalbin-like C2 domain second repeat present in Tricalbin-like proteins | Back alignment and domain information |
|---|
| >cd04046 C2_Calpain C2 domain present in Calpain proteins | Back alignment and domain information |
|---|
| >cd04038 C2_ArfGAP C2 domain present in Arf GTPase Activating Proteins (GAP) | Back alignment and domain information |
|---|
| >cd08383 C2A_RasGAP C2 domain (first repeat) of Ras GTPase activating proteins (GAPs) | Back alignment and domain information |
|---|
| >cd08691 C2_NEDL1-like C2 domain present in NEDL1 (NEDD4-like ubiquitin protein ligase-1) | Back alignment and domain information |
|---|
| >cd04051 C2_SRC2_like C2 domain present in Soybean genes Regulated by Cold 2 (SRC2)-like proteins | Back alignment and domain information |
|---|
| >cd04051 C2_SRC2_like C2 domain present in Soybean genes Regulated by Cold 2 (SRC2)-like proteins | Back alignment and domain information |
|---|
| >cd04027 C2B_Munc13 C2 domain second repeat in Munc13 (mammalian uncoordinated) proteins | Back alignment and domain information |
|---|
| >cd04046 C2_Calpain C2 domain present in Calpain proteins | Back alignment and domain information |
|---|
| >cd04037 C2E_Ferlin C2 domain fifth repeat in Ferlin | Back alignment and domain information |
|---|
| >cd04037 C2E_Ferlin C2 domain fifth repeat in Ferlin | Back alignment and domain information |
|---|
| >cd04021 C2_E3_ubiquitin_ligase C2 domain present in E3 ubiquitin ligase | Back alignment and domain information |
|---|
| >cd08374 C2F_Ferlin C2 domain sixth repeat in Ferlin | Back alignment and domain information |
|---|
| >cd04015 C2_plant_PLD C2 domain present in plant phospholipase D (PLD) | Back alignment and domain information |
|---|
| >cd04044 C2A_Tricalbin-like C2 domain first repeat present in Tricalbin-like proteins | Back alignment and domain information |
|---|
| >cd04013 C2_SynGAP_like C2 domain present in Ras GTPase activating protein (GAP) family | Back alignment and domain information |
|---|
| >cd04044 C2A_Tricalbin-like C2 domain first repeat present in Tricalbin-like proteins | Back alignment and domain information |
|---|
| >cd08383 C2A_RasGAP C2 domain (first repeat) of Ras GTPase activating proteins (GAPs) | Back alignment and domain information |
|---|
| >cd08374 C2F_Ferlin C2 domain sixth repeat in Ferlin | Back alignment and domain information |
|---|
| >cd08686 C2_ABR C2 domain in the Active BCR (Breakpoint cluster region) Related protein | Back alignment and domain information |
|---|
| >cd04021 C2_E3_ubiquitin_ligase C2 domain present in E3 ubiquitin ligase | Back alignment and domain information |
|---|
| >COG5038 Ca2+-dependent lipid-binding protein, contains C2 domain [General function prediction only] | Back alignment and domain information |
|---|
| >cd04047 C2B_Copine C2 domain second repeat in Copine | Back alignment and domain information |
|---|
| >cd04047 C2B_Copine C2 domain second repeat in Copine | Back alignment and domain information |
|---|
| >cd04013 C2_SynGAP_like C2 domain present in Ras GTPase activating protein (GAP) family | Back alignment and domain information |
|---|
| >cd08684 C2A_Tac2-N C2 domain first repeat found in Tac2-N (Tandem C2 protein in Nucleus) | Back alignment and domain information |
|---|
| >cd00275 C2_PLC_like C2 domain present in Phosphoinositide-specific phospholipases C (PLC) | Back alignment and domain information |
|---|
| >PLN03008 Phospholipase D delta | Back alignment and domain information |
|---|
| >cd00275 C2_PLC_like C2 domain present in Phosphoinositide-specific phospholipases C (PLC) | Back alignment and domain information |
|---|
| >COG5038 Ca2+-dependent lipid-binding protein, contains C2 domain [General function prediction only] | Back alignment and domain information |
|---|
| >PLN03200 cellulose synthase-interactive protein; Provisional | Back alignment and domain information |
|---|
| >PLN03008 Phospholipase D delta | Back alignment and domain information |
|---|
| >PLN03200 cellulose synthase-interactive protein; Provisional | Back alignment and domain information |
|---|
| >PF00168 C2: C2 domain; InterPro: IPR000008 The C2 domain is a Ca2+-dependent membrane-targeting module found in many cellular proteins involved in signal transduction or membrane trafficking | Back alignment and domain information |
|---|
| >cd08684 C2A_Tac2-N C2 domain first repeat found in Tac2-N (Tandem C2 protein in Nucleus) | Back alignment and domain information |
|---|
| >smart00239 C2 Protein kinase C conserved region 2 (CalB) | Back alignment and domain information |
|---|
| >KOG1328|consensus | Back alignment and domain information |
|---|
| >cd00030 C2 C2 domain | Back alignment and domain information |
|---|
| >cd00030 C2 C2 domain | Back alignment and domain information |
|---|
| >PLN02952 phosphoinositide phospholipase C | Back alignment and domain information |
|---|
| >PF00168 C2: C2 domain; InterPro: IPR000008 The C2 domain is a Ca2+-dependent membrane-targeting module found in many cellular proteins involved in signal transduction or membrane trafficking | Back alignment and domain information |
|---|
| >PLN02223 phosphoinositide phospholipase C | Back alignment and domain information |
|---|
| >smart00239 C2 Protein kinase C conserved region 2 (CalB) | Back alignment and domain information |
|---|
| >PLN02952 phosphoinositide phospholipase C | Back alignment and domain information |
|---|
| >PLN02223 phosphoinositide phospholipase C | Back alignment and domain information |
|---|
| >KOG1327|consensus | Back alignment and domain information |
|---|
| >PLN02222 phosphoinositide phospholipase C 2 | Back alignment and domain information |
|---|
| >PLN02230 phosphoinositide phospholipase C 4 | Back alignment and domain information |
|---|
| >PLN02230 phosphoinositide phospholipase C 4 | Back alignment and domain information |
|---|
| >KOG0169|consensus | Back alignment and domain information |
|---|
| >PLN02222 phosphoinositide phospholipase C 2 | Back alignment and domain information |
|---|
| >KOG1326|consensus | Back alignment and domain information |
|---|
| >KOG0169|consensus | Back alignment and domain information |
|---|
| >KOG1011|consensus | Back alignment and domain information |
|---|
| >KOG0905|consensus | Back alignment and domain information |
|---|
| >KOG0905|consensus | Back alignment and domain information |
|---|
| >PLN02228 Phosphoinositide phospholipase C | Back alignment and domain information |
|---|
| >KOG1031|consensus | Back alignment and domain information |
|---|
| >PLN02228 Phosphoinositide phospholipase C | Back alignment and domain information |
|---|
| >KOG1264|consensus | Back alignment and domain information |
|---|
| >KOG2059|consensus | Back alignment and domain information |
|---|
| >PLN02270 phospholipase D alpha | Back alignment and domain information |
|---|
| >KOG1326|consensus | Back alignment and domain information |
|---|
| >KOG1031|consensus | Back alignment and domain information |
|---|
| >KOG1011|consensus | Back alignment and domain information |
|---|
| >PLN02964 phosphatidylserine decarboxylase | Back alignment and domain information |
|---|
| >cd08683 C2_C2cd3 C2 domain found in C2 calcium-dependent domain containing 3 (C2cd3) proteins | Back alignment and domain information |
|---|
| >KOG1264|consensus | Back alignment and domain information |
|---|
| >KOG1013|consensus | Back alignment and domain information |
|---|
| >KOG2060|consensus | Back alignment and domain information |
|---|
| >PLN02270 phospholipase D alpha | Back alignment and domain information |
|---|
| >PLN02964 phosphatidylserine decarboxylase | Back alignment and domain information |
|---|
| >PLN02352 phospholipase D epsilon | Back alignment and domain information |
|---|
| >cd08683 C2_C2cd3 C2 domain found in C2 calcium-dependent domain containing 3 (C2cd3) proteins | Back alignment and domain information |
|---|
| >cd08689 C2_fungal_Pkc1p C2 domain found in protein kinase C (Pkc1p) in Saccharomyces cerevisiae | Back alignment and domain information |
|---|
| >cd08689 C2_fungal_Pkc1p C2 domain found in protein kinase C (Pkc1p) in Saccharomyces cerevisiae | Back alignment and domain information |
|---|
| >cd08397 C2_PI3K_class_III C2 domain present in class III phosphatidylinositol 3-kinases (PI3Ks) | Back alignment and domain information |
|---|
| >cd08397 C2_PI3K_class_III C2 domain present in class III phosphatidylinositol 3-kinases (PI3Ks) | Back alignment and domain information |
|---|
| >cd08380 C2_PI3K_like C2 domain present in phosphatidylinositol 3-kinases (PI3Ks) | Back alignment and domain information |
|---|
| >KOG1265|consensus | Back alignment and domain information |
|---|
| >PF00792 PI3K_C2: Phosphoinositide 3-kinase C2; InterPro: IPR002420 Phosphatidylinositol 3-kinase (PI3-kinase) (2 | Back alignment and domain information |
|---|
| >PF00792 PI3K_C2: Phosphoinositide 3-kinase C2; InterPro: IPR002420 Phosphatidylinositol 3-kinase (PI3-kinase) (2 | Back alignment and domain information |
|---|
| >cd08398 C2_PI3K_class_I_alpha C2 domain present in class I alpha phosphatidylinositol 3-kinases (PI3Ks) | Back alignment and domain information |
|---|
| >KOG1327|consensus | Back alignment and domain information |
|---|
| >PF14429 DOCK-C2: C2 domain in Dock180 and Zizimin proteins; PDB: 3L4C_A | Back alignment and domain information |
|---|
| >cd08380 C2_PI3K_like C2 domain present in phosphatidylinositol 3-kinases (PI3Ks) | Back alignment and domain information |
|---|
| >cd08695 C2_Dock-B C2 domains found in Dedicator Of CytoKinesis (Dock) class B proteins | Back alignment and domain information |
|---|
| >cd08693 C2_PI3K_class_I_beta_delta C2 domain present in class I beta and delta phosphatidylinositol 3-kinases (PI3Ks) | Back alignment and domain information |
|---|
| >cd08695 C2_Dock-B C2 domains found in Dedicator Of CytoKinesis (Dock) class B proteins | Back alignment and domain information |
|---|
| >PF12416 DUF3668: Cep120 protein; InterPro: IPR022136 This domain family is found in eukaryotes, and is typically between 75 and 114 amino acids in length | Back alignment and domain information |
|---|
| >PLN02352 phospholipase D epsilon | Back alignment and domain information |
|---|
| >KOG3837|consensus | Back alignment and domain information |
|---|
| >KOG3837|consensus | Back alignment and domain information |
|---|
| >cd08694 C2_Dock-A C2 domains found in Dedicator Of CytoKinesis (Dock) class A proteins | Back alignment and domain information |
|---|
| >cd08693 C2_PI3K_class_I_beta_delta C2 domain present in class I beta and delta phosphatidylinositol 3-kinases (PI3Ks) | Back alignment and domain information |
|---|
| >cd08694 C2_Dock-A C2 domains found in Dedicator Of CytoKinesis (Dock) class A proteins | Back alignment and domain information |
|---|
| >cd08398 C2_PI3K_class_I_alpha C2 domain present in class I alpha phosphatidylinositol 3-kinases (PI3Ks) | Back alignment and domain information |
|---|
| >cd08399 C2_PI3K_class_I_gamma C2 domain present in class I gamma phosphatidylinositol 3-kinases (PI3Ks) | Back alignment and domain information |
|---|
| >PF14429 DOCK-C2: C2 domain in Dock180 and Zizimin proteins; PDB: 3L4C_A | Back alignment and domain information |
|---|
| >KOG1265|consensus | Back alignment and domain information |
|---|
| >cd08399 C2_PI3K_class_I_gamma C2 domain present in class I gamma phosphatidylinositol 3-kinases (PI3Ks) | Back alignment and domain information |
|---|
| >PF15627 CEP76-C2: CEP76 C2 domain | Back alignment and domain information |
|---|
| >cd08679 C2_DOCK180_related C2 domains found in Dedicator Of CytoKinesis 1 (DOCK 180) and related proteins | Back alignment and domain information |
|---|
| >cd04012 C2A_PI3K_class_II C2 domain first repeat present in class II phosphatidylinositol 3-kinases (PI3Ks) | Back alignment and domain information |
|---|
| >cd08679 C2_DOCK180_related C2 domains found in Dedicator Of CytoKinesis 1 (DOCK 180) and related proteins | Back alignment and domain information |
|---|
| >cd04012 C2A_PI3K_class_II C2 domain first repeat present in class II phosphatidylinositol 3-kinases (PI3Ks) | Back alignment and domain information |
|---|
| >cd08696 C2_Dock-C C2 domains found in Dedicator Of CytoKinesis (Dock) class C proteins | Back alignment and domain information |
|---|
| >cd08696 C2_Dock-C C2 domains found in Dedicator Of CytoKinesis (Dock) class C proteins | Back alignment and domain information |
|---|
| >cd08697 C2_Dock-D C2 domains found in Dedicator Of CytoKinesis (Dock) class C proteins | Back alignment and domain information |
|---|
| >PF12416 DUF3668: Cep120 protein; InterPro: IPR022136 This domain family is found in eukaryotes, and is typically between 75 and 114 amino acids in length | Back alignment and domain information |
|---|
| >smart00142 PI3K_C2 Phosphoinositide 3-kinase, region postulated to contain C2 domain | Back alignment and domain information |
|---|
| >smart00142 PI3K_C2 Phosphoinositide 3-kinase, region postulated to contain C2 domain | Back alignment and domain information |
|---|
| >KOG2060|consensus | Back alignment and domain information |
|---|
| >PF15627 CEP76-C2: CEP76 C2 domain | Back alignment and domain information |
|---|
| >cd08697 C2_Dock-D C2 domains found in Dedicator Of CytoKinesis (Dock) class C proteins | Back alignment and domain information |
|---|
| >PF10358 NT-C2: N-terminal C2 in EEIG1 and EHBP1 proteins; InterPro: IPR019448 This entry represents the N-terminal 150 residues of a family of conserved proteins which are induced by oestrogen [] | Back alignment and domain information |
|---|
| >KOG0906|consensus | Back alignment and domain information |
|---|
| >PF10358 NT-C2: N-terminal C2 in EEIG1 and EHBP1 proteins; InterPro: IPR019448 This entry represents the N-terminal 150 residues of a family of conserved proteins which are induced by oestrogen [] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 174 | ||||
| 1v27_A | 141 | Solution Structure Of The First C2 Domain Of Rim2 L | 7e-14 | ||
| 2bwq_A | 129 | Crystal Structure Of The Rim2 C2a-Domain At 1.4 Ang | 5e-13 | ||
| 2bwq_A | 129 | Crystal Structure Of The Rim2 C2a-Domain At 1.4 Ang | 6e-13 | ||
| 1rh8_A | 142 | Three-Dimensional Structure Of The Calcium-Free Pic | 2e-12 | ||
| 1rh8_A | 142 | Three-Dimensional Structure Of The Calcium-Free Pic | 2e-11 | ||
| 2k3h_A | 140 | Structural Determinants For Ca2+ And Pip2 Binding B | 4e-07 | ||
| 2chd_A | 142 | Crystal Structure Of The C2a Domain Of Rabphilin-3a | 4e-07 | ||
| 1dsy_A | 139 | C2 Domain From Protein Kinase C (Alpha) Complexed W | 9e-05 | ||
| 1dsy_A | 139 | C2 Domain From Protein Kinase C (Alpha) Complexed W | 2e-04 | ||
| 3gpe_A | 137 | Crystal Structure Analysis Of Pkc (Alpha)-C2 Domain | 1e-04 | ||
| 3gpe_A | 137 | Crystal Structure Analysis Of Pkc (Alpha)-C2 Domain | 2e-04 | ||
| 2cm6_A | 166 | Crystal Structure Of The C2b Domain Of Rabphilin3a | 1e-04 | ||
| 2cm6_A | 166 | Crystal Structure Of The C2b Domain Of Rabphilin3a | 1e-04 | ||
| 3rpb_A | 140 | The C2b-Domain Of Rabphilin: Structural Variations | 1e-04 | ||
| 3rpb_A | 140 | The C2b-Domain Of Rabphilin: Structural Variations | 1e-04 | ||
| 2cm5_A | 166 | Crystal Structure Of The C2b Domain Of Rabphilin Le | 1e-04 | ||
| 2cm5_A | 166 | Crystal Structure Of The C2b Domain Of Rabphilin Le | 1e-04 | ||
| 3pfq_A | 674 | Crystal Structure And Allosteric Activation Of Prot | 4e-04 | ||
| 3pfq_A | 674 | Crystal Structure And Allosteric Activation Of Prot | 7e-04 | ||
| 2d8k_A | 141 | Solution Structure Of The First C2 Domain Of Synapt | 6e-04 | ||
| 2uzp_A | 144 | Crystal Structure Of The C2 Domain Of Human Protein | 7e-04 | ||
| 4dnl_A | 140 | Crystal Structure Of A C2 Domain Of A Protein Kinas | 8e-04 |
| >pdb|1V27|A Chain A, Solution Structure Of The First C2 Domain Of Rim2 Length = 141 | Back alignment and structure |
|
| >pdb|2BWQ|A Chain A, Crystal Structure Of The Rim2 C2a-Domain At 1.4 Angstrom Resolution Length = 129 | Back alignment and structure |
| >pdb|2BWQ|A Chain A, Crystal Structure Of The Rim2 C2a-Domain At 1.4 Angstrom Resolution Length = 129 | Back alignment and structure |
| >pdb|1RH8|A Chain A, Three-Dimensional Structure Of The Calcium-Free Piccolo C2a- Domain Length = 142 | Back alignment and structure |
| >pdb|1RH8|A Chain A, Three-Dimensional Structure Of The Calcium-Free Piccolo C2a- Domain Length = 142 | Back alignment and structure |
| >pdb|2K3H|A Chain A, Structural Determinants For Ca2+ And Pip2 Binding By The C2a Domain Of Rabphilin-3a Length = 140 | Back alignment and structure |
| >pdb|2CHD|A Chain A, Crystal Structure Of The C2a Domain Of Rabphilin-3a Length = 142 | Back alignment and structure |
| >pdb|1DSY|A Chain A, C2 Domain From Protein Kinase C (Alpha) Complexed With Ca2+ And Phosphatidylserine Length = 139 | Back alignment and structure |
| >pdb|1DSY|A Chain A, C2 Domain From Protein Kinase C (Alpha) Complexed With Ca2+ And Phosphatidylserine Length = 139 | Back alignment and structure |
| >pdb|3GPE|A Chain A, Crystal Structure Analysis Of Pkc (Alpha)-C2 Domain Complexed With Ca2+ And Ptdins(4,5)p2 Length = 137 | Back alignment and structure |
| >pdb|3GPE|A Chain A, Crystal Structure Analysis Of Pkc (Alpha)-C2 Domain Complexed With Ca2+ And Ptdins(4,5)p2 Length = 137 | Back alignment and structure |
| >pdb|2CM6|A Chain A, Crystal Structure Of The C2b Domain Of Rabphilin3a Length = 166 | Back alignment and structure |
| >pdb|2CM6|A Chain A, Crystal Structure Of The C2b Domain Of Rabphilin3a Length = 166 | Back alignment and structure |
| >pdb|3RPB|A Chain A, The C2b-Domain Of Rabphilin: Structural Variations In A Janus-Faced Domain Length = 140 | Back alignment and structure |
| >pdb|3RPB|A Chain A, The C2b-Domain Of Rabphilin: Structural Variations In A Janus-Faced Domain Length = 140 | Back alignment and structure |
| >pdb|2CM5|A Chain A, Crystal Structure Of The C2b Domain Of Rabphilin Length = 166 | Back alignment and structure |
| >pdb|2CM5|A Chain A, Crystal Structure Of The C2b Domain Of Rabphilin Length = 166 | Back alignment and structure |
| >pdb|3PFQ|A Chain A, Crystal Structure And Allosteric Activation Of Protein Kinase C Beta Ii Length = 674 | Back alignment and structure |
| >pdb|3PFQ|A Chain A, Crystal Structure And Allosteric Activation Of Protein Kinase C Beta Ii Length = 674 | Back alignment and structure |
| >pdb|2D8K|A Chain A, Solution Structure Of The First C2 Domain Of Synaptotagmin Vii Length = 141 | Back alignment and structure |
| >pdb|2UZP|A Chain A, Crystal Structure Of The C2 Domain Of Human Protein Kinase C Gamma. Length = 144 | Back alignment and structure |
| >pdb|4DNL|A Chain A, Crystal Structure Of A C2 Domain Of A Protein Kinase C Alpha (Prkca) From Homo Sapiens At 1.90 A Resolution Length = 140 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 174 | |||
| 1dqv_A | 296 | Synaptotagmin III; beta sandwich, calcium ION, C2 | 2e-23 | |
| 1dqv_A | 296 | Synaptotagmin III; beta sandwich, calcium ION, C2 | 7e-11 | |
| 2r83_A | 284 | Synaptotagmin-1; C2A-C2B, exocytosis, calcium, cel | 2e-22 | |
| 2r83_A | 284 | Synaptotagmin-1; C2A-C2B, exocytosis, calcium, cel | 2e-11 | |
| 1rh8_A | 142 | Piccolo protein; beta-sandwich, metal binding prot | 6e-21 | |
| 1rh8_A | 142 | Piccolo protein; beta-sandwich, metal binding prot | 7e-21 | |
| 2bwq_A | 129 | Regulating synaptic membrane exocytosis protein 2; | 4e-20 | |
| 2bwq_A | 129 | Regulating synaptic membrane exocytosis protein 2; | 5e-20 | |
| 1v27_A | 141 | Regulating synaptic membrane exocytosis protein 2; | 1e-19 | |
| 1v27_A | 141 | Regulating synaptic membrane exocytosis protein 2; | 3e-19 | |
| 2d8k_A | 141 | Synaptotagmin VII; exocytosis, calcium binding, ly | 6e-19 | |
| 2d8k_A | 141 | Synaptotagmin VII; exocytosis, calcium binding, ly | 9e-19 | |
| 2b3r_A | 134 | Phosphatidylinositol-4-phosphate 3-kinase C2 DOMA | 8e-19 | |
| 2b3r_A | 134 | Phosphatidylinositol-4-phosphate 3-kinase C2 DOMA | 1e-18 | |
| 2chd_A | 142 | Rabphilin-3A, exophilin-1; C2 domain, C2A, calcium | 1e-18 | |
| 2chd_A | 142 | Rabphilin-3A, exophilin-1; C2 domain, C2A, calcium | 2e-18 | |
| 1ugk_A | 138 | Synaptotagmin IV, KIAA1342; beta sandwich, structu | 1e-18 | |
| 1ugk_A | 138 | Synaptotagmin IV, KIAA1342; beta sandwich, structu | 9e-17 | |
| 1a25_A | 149 | CALB, protein kinase C (beta); calcium++/phospholi | 1e-18 | |
| 1a25_A | 149 | CALB, protein kinase C (beta); calcium++/phospholi | 7e-18 | |
| 3rdl_A | 137 | Protein kinase C alpha type; protein kinase PKC, t | 2e-18 | |
| 3rdl_A | 137 | Protein kinase C alpha type; protein kinase PKC, t | 8e-18 | |
| 3fdw_A | 148 | Synaptotagmin-like protein 4; structural genomics, | 8e-17 | |
| 3fdw_A | 148 | Synaptotagmin-like protein 4; structural genomics, | 2e-16 | |
| 2enp_A | 147 | B/K protein; C2 type 1,beta sandwich, structural g | 1e-16 | |
| 2enp_A | 147 | B/K protein; C2 type 1,beta sandwich, structural g | 6e-16 | |
| 3f04_A | 143 | Synaptotagmin-1; C2A, calcium, cell junction, cyto | 6e-16 | |
| 3f04_A | 143 | Synaptotagmin-1; C2A, calcium, cell junction, cyto | 1e-15 | |
| 1rsy_A | 152 | Synaptotagmin I; calcium/phospholipid binding prot | 1e-15 | |
| 1rsy_A | 152 | Synaptotagmin I; calcium/phospholipid binding prot | 3e-15 | |
| 2z0u_A | 155 | WW domain-containing protein 1; C2 domain, alterna | 1e-15 | |
| 2z0u_A | 155 | WW domain-containing protein 1; C2 domain, alterna | 2e-15 | |
| 2dmg_A | 142 | KIAA1228 protein; beta-sandwich, structural genomi | 2e-15 | |
| 2dmg_A | 142 | KIAA1228 protein; beta-sandwich, structural genomi | 9e-15 | |
| 1wfm_A | 138 | Synaptotagmin XIII; C2 domain, exocytosis, neurotr | 4e-15 | |
| 1wfm_A | 138 | Synaptotagmin XIII; C2 domain, exocytosis, neurotr | 9e-15 | |
| 2cm5_A | 166 | Rabphilin-3A; protein transport, zinc-finger, Ca2+ | 3e-14 | |
| 2cm5_A | 166 | Rabphilin-3A; protein transport, zinc-finger, Ca2+ | 7e-14 | |
| 3fbk_A | 153 | RGS3, RGP3, regulator of G-protein signaling 3; al | 2e-13 | |
| 3fbk_A | 153 | RGS3, RGP3, regulator of G-protein signaling 3; al | 3e-13 | |
| 1w15_A | 153 | Synaptotagmin IV; metal binding protein, endocytos | 6e-13 | |
| 1w15_A | 153 | Synaptotagmin IV; metal binding protein, endocytos | 6e-13 | |
| 2dmh_A | 140 | Myoferlin; beta-sandwich, FER-1-like protein 3, mu | 3e-12 | |
| 2dmh_A | 140 | Myoferlin; beta-sandwich, FER-1-like protein 3, mu | 2e-11 | |
| 2ep6_A | 133 | MCTP2 protein; beta sandwich, Ca2+ binding, membra | 5e-12 | |
| 2ep6_A | 133 | MCTP2 protein; beta sandwich, Ca2+ binding, membra | 2e-11 | |
| 1tjx_A | 159 | Similar to synaptotagmini/P65; C2B domain, calcium | 9e-12 | |
| 1tjx_A | 159 | Similar to synaptotagmini/P65; C2B domain, calcium | 1e-11 | |
| 3n5a_A | 138 | Synaptotagmin-7; calcium/phospholipid binding prot | 1e-11 | |
| 3n5a_A | 138 | Synaptotagmin-7; calcium/phospholipid binding prot | 1e-11 | |
| 3b7y_A | 153 | E3 ubiquitin-protein ligase NEDD4; C2 domain, UBL- | 1e-10 | |
| 3b7y_A | 153 | E3 ubiquitin-protein ligase NEDD4; C2 domain, UBL- | 1e-10 | |
| 2q3x_A | 171 | Regulating synaptic membrane exocytosis protein 1; | 1e-10 | |
| 2q3x_A | 171 | Regulating synaptic membrane exocytosis protein 1; | 1e-10 | |
| 2nq3_A | 173 | Itchy homolog E3 ubiquitin protein ligase; C2 doma | 3e-09 | |
| 2nq3_A | 173 | Itchy homolog E3 ubiquitin protein ligase; C2 doma | 4e-09 | |
| 3kwu_A | 148 | MUNC13-1; calcium binding protein, phospholipid bi | 3e-09 | |
| 3kwu_A | 148 | MUNC13-1; calcium binding protein, phospholipid bi | 4e-09 | |
| 1gmi_A | 136 | Protein kinase C, epsilon type; PKC, C2 domain, X- | 3e-09 | |
| 1gmi_A | 136 | Protein kinase C, epsilon type; PKC, C2 domain, X- | 8e-09 | |
| 1rlw_A | 126 | Phospholipase A2, CALB domain; hydrolase, C2 domai | 6e-09 | |
| 1rlw_A | 126 | Phospholipase A2, CALB domain; hydrolase, C2 domai | 9e-09 | |
| 3nsj_A | 540 | Perforin-1; pore forming protein, immune system; H | 9e-09 | |
| 3nsj_A | 540 | Perforin-1; pore forming protein, immune system; H | 1e-08 | |
| 3m7f_B | 176 | E3 ubiquitin-protein ligase NEDD4; C2 domain, GRB1 | 2e-08 | |
| 3m7f_B | 176 | E3 ubiquitin-protein ligase NEDD4; C2 domain, GRB1 | 2e-08 | |
| 3pyc_A | 132 | E3 ubiquitin-protein ligase smurf1; phospholipid b | 2e-08 | |
| 3pyc_A | 132 | E3 ubiquitin-protein ligase smurf1; phospholipid b | 3e-08 | |
| 2fk9_A | 157 | Protein kinase C, ETA type; ATP-binding, metal-bin | 2e-08 | |
| 2fk9_A | 157 | Protein kinase C, ETA type; ATP-binding, metal-bin | 5e-08 | |
| 1wfj_A | 136 | Putative elicitor-responsive gene; C2 domain, rike | 8e-07 | |
| 1wfj_A | 136 | Putative elicitor-responsive gene; C2 domain, rike | 2e-06 | |
| 2cjt_A | 131 | UNC-13 homolog A, MUNC13-1; phorbol-ester binding, | 2e-06 | |
| 2cjt_A | 131 | UNC-13 homolog A, MUNC13-1; phorbol-ester binding, | 3e-06 | |
| 2cjs_A | 167 | UNC-13 homolog A, MUNC13-1; neurotransmitter trans | 1e-05 | |
| 2cjs_A | 167 | UNC-13 homolog A, MUNC13-1; neurotransmitter trans | 6e-05 |
| >1dqv_A Synaptotagmin III; beta sandwich, calcium ION, C2 domain, endocytosis/exocytosis complex; 3.20A {Rattus rattus} SCOP: b.7.1.2 b.7.1.2 PDB: 3hn8_A Length = 296 | Back alignment and structure |
|---|
Score = 93.0 bits (231), Expect = 2e-23
Identities = 34/207 (16%), Positives = 72/207 (34%), Gaps = 55/207 (26%)
Query: 7 KTLANTNDPKWNQSFFYPGIRRSDLKLRSIEITVWDYTRYGVNDFLGEVIIELSS---SL 63
K T +P +N++F + + ++L R + +V+D+ R+ +D +G+V+++
Sbjct: 60 KVHRKTLNPIFNETFQFS-VPLAELAQRKLHFSVYDFDRFSRHDLIGQVVLDNLLELAEQ 118
Query: 64 CTDEPEWFYLTKHTL------ELQFPLS----------------NL-------------- 87
D P W + + EL F L NL
Sbjct: 119 PPDRPLWRDILEGGSEKADLGELNFSLCYLPTAGLLTVTIIKASNLKAMDLTGFSDPYVK 178
Query: 88 --------------SKTLANTNDPKWNQSFFYPGIRRSDLKLRSIEITVWDYTRYGVNDF 133
+ NT +P +N++ + + ++ + I V DY G N+
Sbjct: 179 ASLISEGRRLKKRKTSIKKNTLNPTYNEALVFD-VAPESVENVGLSIAVVDYDCIGHNEV 237
Query: 134 LGEVIIELSSSLCTDEPEWFYLTKHKN 160
+G + ++ W + +
Sbjct: 238 IGVCRVGPEAADPHGREHWAEMLANPR 264
|
| >1dqv_A Synaptotagmin III; beta sandwich, calcium ION, C2 domain, endocytosis/exocytosis complex; 3.20A {Rattus rattus} SCOP: b.7.1.2 b.7.1.2 PDB: 3hn8_A Length = 296 | Back alignment and structure |
|---|
| >2r83_A Synaptotagmin-1; C2A-C2B, exocytosis, calcium, cell junction, cytoplasmic vesicle, glycoprotein, lipoprotein, membrane, metal-binding palmitate; 2.70A {Homo sapiens} SCOP: b.7.1.2 Length = 284 | Back alignment and structure |
|---|
| >2r83_A Synaptotagmin-1; C2A-C2B, exocytosis, calcium, cell junction, cytoplasmic vesicle, glycoprotein, lipoprotein, membrane, metal-binding palmitate; 2.70A {Homo sapiens} SCOP: b.7.1.2 Length = 284 | Back alignment and structure |
|---|
| >1rh8_A Piccolo protein; beta-sandwich, metal binding protein; NMR {Rattus norvegicus} SCOP: b.7.1.2 Length = 142 | Back alignment and structure |
|---|
| >1rh8_A Piccolo protein; beta-sandwich, metal binding protein; NMR {Rattus norvegicus} SCOP: b.7.1.2 Length = 142 | Back alignment and structure |
|---|
| >2bwq_A Regulating synaptic membrane exocytosis protein 2; C2 domain, neurotransmitter release, transport protein; 1.41A {Rattus norvegicus} SCOP: b.7.1.2 Length = 129 | Back alignment and structure |
|---|
| >2bwq_A Regulating synaptic membrane exocytosis protein 2; C2 domain, neurotransmitter release, transport protein; 1.41A {Rattus norvegicus} SCOP: b.7.1.2 Length = 129 | Back alignment and structure |
|---|
| >1v27_A Regulating synaptic membrane exocytosis protein 2; RAB3-interacting molecule, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.7.1.2 Length = 141 | Back alignment and structure |
|---|
| >1v27_A Regulating synaptic membrane exocytosis protein 2; RAB3-interacting molecule, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.7.1.2 Length = 141 | Back alignment and structure |
|---|
| >2d8k_A Synaptotagmin VII; exocytosis, calcium binding, lysosome, C2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 141 | Back alignment and structure |
|---|
| >2d8k_A Synaptotagmin VII; exocytosis, calcium binding, lysosome, C2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 141 | Back alignment and structure |
|---|
| >2b3r_A Phosphatidylinositol-4-phosphate 3-kinase C2 DOMA containing alpha polypeptide; C2 domain, lipid binding, PI3-kinase, transferase; 2.30A {Mus musculus} Length = 134 | Back alignment and structure |
|---|
| >2b3r_A Phosphatidylinositol-4-phosphate 3-kinase C2 DOMA containing alpha polypeptide; C2 domain, lipid binding, PI3-kinase, transferase; 2.30A {Mus musculus} Length = 134 | Back alignment and structure |
|---|
| >2chd_A Rabphilin-3A, exophilin-1; C2 domain, C2A, calcium binding, synaptic EXOC metal-binding, protein transport, synapse, transport, zinc-; 1.92A {Rattus norvegicus} PDB: 2k3h_A Length = 142 | Back alignment and structure |
|---|
| >2chd_A Rabphilin-3A, exophilin-1; C2 domain, C2A, calcium binding, synaptic EXOC metal-binding, protein transport, synapse, transport, zinc-; 1.92A {Rattus norvegicus} PDB: 2k3h_A Length = 142 | Back alignment and structure |
|---|
| >1ugk_A Synaptotagmin IV, KIAA1342; beta sandwich, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.7.1.2 Length = 138 | Back alignment and structure |
|---|
| >1ugk_A Synaptotagmin IV, KIAA1342; beta sandwich, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.7.1.2 Length = 138 | Back alignment and structure |
|---|
| >1a25_A CALB, protein kinase C (beta); calcium++/phospholipid binding protein, calcium-binding protein; HET: PSE; 2.70A {Rattus norvegicus} SCOP: b.7.1.2 Length = 149 | Back alignment and structure |
|---|
| >1a25_A CALB, protein kinase C (beta); calcium++/phospholipid binding protein, calcium-binding protein; HET: PSE; 2.70A {Rattus norvegicus} SCOP: b.7.1.2 Length = 149 | Back alignment and structure |
|---|
| >3fdw_A Synaptotagmin-like protein 4; structural genomics, phospholipid binding, alternative splicing, cell membrane, cytoplasmic vesicle, membrane; 2.20A {Homo sapiens} Length = 148 | Back alignment and structure |
|---|
| >3fdw_A Synaptotagmin-like protein 4; structural genomics, phospholipid binding, alternative splicing, cell membrane, cytoplasmic vesicle, membrane; 2.20A {Homo sapiens} Length = 148 | Back alignment and structure |
|---|
| >2enp_A B/K protein; C2 type 1,beta sandwich, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 147 | Back alignment and structure |
|---|
| >2enp_A B/K protein; C2 type 1,beta sandwich, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 147 | Back alignment and structure |
|---|
| >3f04_A Synaptotagmin-1; C2A, calcium, cell junction, cytoplasmic vesicle, glycoprotein, lipoprotein, membrane, metal- binding, palmitate, phosphoprotein; 1.35A {Homo sapiens} PDB: 3f01_A 3f05_A 3f00_A 1byn_A 2k45_A 2k4a_A 2k8m_A 2ki6_A* Length = 143 | Back alignment and structure |
|---|
| >3f04_A Synaptotagmin-1; C2A, calcium, cell junction, cytoplasmic vesicle, glycoprotein, lipoprotein, membrane, metal- binding, palmitate, phosphoprotein; 1.35A {Homo sapiens} PDB: 3f01_A 3f05_A 3f00_A 1byn_A 2k45_A 2k4a_A 2k8m_A 2ki6_A* Length = 143 | Back alignment and structure |
|---|
| >1rsy_A Synaptotagmin I; calcium/phospholipid binding protein; 1.90A {Rattus norvegicus} SCOP: b.7.1.2 Length = 152 | Back alignment and structure |
|---|
| >1rsy_A Synaptotagmin I; calcium/phospholipid binding protein; 1.90A {Rattus norvegicus} SCOP: b.7.1.2 Length = 152 | Back alignment and structure |
|---|
| >2z0u_A WW domain-containing protein 1; C2 domain, alternative splicing, coiled coil, cytoplasm, phosphorylation, polymorphism, lipid binding protein; 2.20A {Homo sapiens} Length = 155 | Back alignment and structure |
|---|
| >2z0u_A WW domain-containing protein 1; C2 domain, alternative splicing, coiled coil, cytoplasm, phosphorylation, polymorphism, lipid binding protein; 2.20A {Homo sapiens} Length = 155 | Back alignment and structure |
|---|
| >2dmg_A KIAA1228 protein; beta-sandwich, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 142 | Back alignment and structure |
|---|
| >2dmg_A KIAA1228 protein; beta-sandwich, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 142 | Back alignment and structure |
|---|
| >1wfm_A Synaptotagmin XIII; C2 domain, exocytosis, neurotransmitter release, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: b.7.1.2 Length = 138 | Back alignment and structure |
|---|
| >1wfm_A Synaptotagmin XIII; C2 domain, exocytosis, neurotransmitter release, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: b.7.1.2 Length = 138 | Back alignment and structure |
|---|
| >2cm5_A Rabphilin-3A; protein transport, zinc-finger, Ca2+ binding, metal-binding, synaptic exocytosis, C2A-C2B linker fragment, C2B, zinc, synapse; 1.28A {Rattus norvegicus} SCOP: b.7.1.2 PDB: 2cm6_A 3rpb_A Length = 166 | Back alignment and structure |
|---|
| >2cm5_A Rabphilin-3A; protein transport, zinc-finger, Ca2+ binding, metal-binding, synaptic exocytosis, C2A-C2B linker fragment, C2B, zinc, synapse; 1.28A {Rattus norvegicus} SCOP: b.7.1.2 PDB: 2cm6_A 3rpb_A Length = 166 | Back alignment and structure |
|---|
| >3fbk_A RGS3, RGP3, regulator of G-protein signaling 3; all beta-sheet fold, structural genomics, PSI-2, protein structure initiative; 2.00A {Homo sapiens} Length = 153 | Back alignment and structure |
|---|
| >3fbk_A RGS3, RGP3, regulator of G-protein signaling 3; all beta-sheet fold, structural genomics, PSI-2, protein structure initiative; 2.00A {Homo sapiens} Length = 153 | Back alignment and structure |
|---|
| >1w15_A Synaptotagmin IV; metal binding protein, endocytosis/exocytosis neurotransmitter release, transmembrane; 1.93A {Rattus norvegicus} SCOP: b.7.1.2 PDB: 1w16_A Length = 153 | Back alignment and structure |
|---|
| >1w15_A Synaptotagmin IV; metal binding protein, endocytosis/exocytosis neurotransmitter release, transmembrane; 1.93A {Rattus norvegicus} SCOP: b.7.1.2 PDB: 1w16_A Length = 153 | Back alignment and structure |
|---|
| >2dmh_A Myoferlin; beta-sandwich, FER-1-like protein 3, muscular dystrophy, cardiomyopathy, membrane fusion, dystrophin, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 140 | Back alignment and structure |
|---|
| >2dmh_A Myoferlin; beta-sandwich, FER-1-like protein 3, muscular dystrophy, cardiomyopathy, membrane fusion, dystrophin, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 140 | Back alignment and structure |
|---|
| >2ep6_A MCTP2 protein; beta sandwich, Ca2+ binding, membrane binding, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.7.1.1 Length = 133 | Back alignment and structure |
|---|
| >2ep6_A MCTP2 protein; beta sandwich, Ca2+ binding, membrane binding, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.7.1.1 Length = 133 | Back alignment and structure |
|---|
| >1tjx_A Similar to synaptotagmini/P65; C2B domain, calcium binding, endocytosis-EX complex; HET: GOL; 1.04A {Rattus norvegicus} SCOP: b.7.1.2 PDB: 1tjm_A* 1uov_A 1uow_A 1k5w_A 2lha_A* Length = 159 | Back alignment and structure |
|---|
| >1tjx_A Similar to synaptotagmini/P65; C2B domain, calcium binding, endocytosis-EX complex; HET: GOL; 1.04A {Rattus norvegicus} SCOP: b.7.1.2 PDB: 1tjm_A* 1uov_A 1uow_A 1k5w_A 2lha_A* Length = 159 | Back alignment and structure |
|---|
| >3n5a_A Synaptotagmin-7; calcium/phospholipid binding protein, protein transport; 1.44A {Mus musculus} Length = 138 | Back alignment and structure |
|---|
| >3n5a_A Synaptotagmin-7; calcium/phospholipid binding protein, protein transport; 1.44A {Mus musculus} Length = 138 | Back alignment and structure |
|---|
| >3b7y_A E3 ubiquitin-protein ligase NEDD4; C2 domain, UBL-conjugation pathway, structural genomics consortium, SGC, cytoplasm; 1.80A {Homo sapiens} PDB: 2nsq_A Length = 153 | Back alignment and structure |
|---|
| >3b7y_A E3 ubiquitin-protein ligase NEDD4; C2 domain, UBL-conjugation pathway, structural genomics consortium, SGC, cytoplasm; 1.80A {Homo sapiens} PDB: 2nsq_A Length = 153 | Back alignment and structure |
|---|
| >2q3x_A Regulating synaptic membrane exocytosis protein 1; C2 domain dimer, neurotransmitter release, transport protein; HET: MSE; 1.73A {Rattus norvegicus} Length = 171 | Back alignment and structure |
|---|
| >2q3x_A Regulating synaptic membrane exocytosis protein 1; C2 domain dimer, neurotransmitter release, transport protein; HET: MSE; 1.73A {Rattus norvegicus} Length = 171 | Back alignment and structure |
|---|
| >2nq3_A Itchy homolog E3 ubiquitin protein ligase; C2 domain, UBL conjugation pathway, structural genomics consortium, SGC; 1.80A {Homo sapiens} SCOP: b.7.1.1 Length = 173 | Back alignment and structure |
|---|
| >2nq3_A Itchy homolog E3 ubiquitin protein ligase; C2 domain, UBL conjugation pathway, structural genomics consortium, SGC; 1.80A {Homo sapiens} SCOP: b.7.1.1 Length = 173 | Back alignment and structure |
|---|
| >3kwu_A MUNC13-1; calcium binding protein, phospholipid binding protein, metal binding protein; HET: GOL; 1.37A {Rattus norvegicus} PDB: 3kwt_A* Length = 148 | Back alignment and structure |
|---|
| >3kwu_A MUNC13-1; calcium binding protein, phospholipid binding protein, metal binding protein; HET: GOL; 1.37A {Rattus norvegicus} PDB: 3kwt_A* Length = 148 | Back alignment and structure |
|---|
| >1gmi_A Protein kinase C, epsilon type; PKC, C2 domain, X-RAY, phospholipids, PKC epsilon.; 1.7A {Rattus rattus} SCOP: b.7.1.1 Length = 136 | Back alignment and structure |
|---|
| >1gmi_A Protein kinase C, epsilon type; PKC, C2 domain, X-RAY, phospholipids, PKC epsilon.; 1.7A {Rattus rattus} SCOP: b.7.1.1 Length = 136 | Back alignment and structure |
|---|
| >1rlw_A Phospholipase A2, CALB domain; hydrolase, C2 domain; 2.40A {Homo sapiens} SCOP: b.7.1.1 Length = 126 | Back alignment and structure |
|---|
| >1rlw_A Phospholipase A2, CALB domain; hydrolase, C2 domain; 2.40A {Homo sapiens} SCOP: b.7.1.1 Length = 126 | Back alignment and structure |
|---|
| >3nsj_A Perforin-1; pore forming protein, immune system; HET: NAG; 2.75A {Mus musculus} Length = 540 | Back alignment and structure |
|---|
| >3nsj_A Perforin-1; pore forming protein, immune system; HET: NAG; 2.75A {Mus musculus} Length = 540 | Back alignment and structure |
|---|
| >3m7f_B E3 ubiquitin-protein ligase NEDD4; C2 domain, GRB10, SH2 domain, phosphoprotein, conjugation pathway, signaling protein-ligase complex; 2.00A {Mus musculus} Length = 176 | Back alignment and structure |
|---|
| >3m7f_B E3 ubiquitin-protein ligase NEDD4; C2 domain, GRB10, SH2 domain, phosphoprotein, conjugation pathway, signaling protein-ligase complex; 2.00A {Mus musculus} Length = 176 | Back alignment and structure |
|---|
| >3pyc_A E3 ubiquitin-protein ligase smurf1; phospholipid binding, membrane associate, lipid binding PROT; 1.96A {Homo sapiens} PDB: 2jqz_A Length = 132 | Back alignment and structure |
|---|
| >3pyc_A E3 ubiquitin-protein ligase smurf1; phospholipid binding, membrane associate, lipid binding PROT; 1.96A {Homo sapiens} PDB: 2jqz_A Length = 132 | Back alignment and structure |
|---|
| >2fk9_A Protein kinase C, ETA type; ATP-binding, metal-binding, nucleotide-binding, diacylglycerol binding, serine/threonine-protein kinase, transferase; 1.75A {Homo sapiens} Length = 157 | Back alignment and structure |
|---|
| >2fk9_A Protein kinase C, ETA type; ATP-binding, metal-binding, nucleotide-binding, diacylglycerol binding, serine/threonine-protein kinase, transferase; 1.75A {Homo sapiens} Length = 157 | Back alignment and structure |
|---|
| >1wfj_A Putative elicitor-responsive gene; C2 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, plant protein; NMR {Arabidopsis thaliana} SCOP: b.7.1.2 Length = 136 | Back alignment and structure |
|---|
| >1wfj_A Putative elicitor-responsive gene; C2 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, plant protein; NMR {Arabidopsis thaliana} SCOP: b.7.1.2 Length = 136 | Back alignment and structure |
|---|
| >2cjt_A UNC-13 homolog A, MUNC13-1; phorbol-ester binding, neurotransmitter release, RIM, MUNC13 domains, exocytosis, metal-binding; 1.44A {Rattus norvegicus} SCOP: b.7.1.1 Length = 131 | Back alignment and structure |
|---|
| >2cjt_A UNC-13 homolog A, MUNC13-1; phorbol-ester binding, neurotransmitter release, RIM, MUNC13 domains, exocytosis, metal-binding; 1.44A {Rattus norvegicus} SCOP: b.7.1.1 Length = 131 | Back alignment and structure |
|---|
| >2cjs_A UNC-13 homolog A, MUNC13-1; neurotransmitter transport, zinc finger, synapto phorbol-ester binding; 1.78A {Rattus norvegicus} SCOP: b.7.1.1 Length = 167 | Back alignment and structure |
|---|
| >2cjs_A UNC-13 homolog A, MUNC13-1; neurotransmitter transport, zinc finger, synapto phorbol-ester binding; 1.78A {Rattus norvegicus} SCOP: b.7.1.1 Length = 167 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 174 | |||
| 2r83_A | 284 | Synaptotagmin-1; C2A-C2B, exocytosis, calcium, cel | 99.96 | |
| 1dqv_A | 296 | Synaptotagmin III; beta sandwich, calcium ION, C2 | 99.95 | |
| 3rdl_A | 137 | Protein kinase C alpha type; protein kinase PKC, t | 99.68 | |
| 1wfm_A | 138 | Synaptotagmin XIII; C2 domain, exocytosis, neurotr | 99.67 | |
| 1wfm_A | 138 | Synaptotagmin XIII; C2 domain, exocytosis, neurotr | 99.65 | |
| 2z0u_A | 155 | WW domain-containing protein 1; C2 domain, alterna | 99.64 | |
| 1a25_A | 149 | CALB, protein kinase C (beta); calcium++/phospholi | 99.62 | |
| 2z0u_A | 155 | WW domain-containing protein 1; C2 domain, alterna | 99.62 | |
| 2b3r_A | 134 | Phosphatidylinositol-4-phosphate 3-kinase C2 DOMA | 99.61 | |
| 2b3r_A | 134 | Phosphatidylinositol-4-phosphate 3-kinase C2 DOMA | 99.61 | |
| 3f04_A | 143 | Synaptotagmin-1; C2A, calcium, cell junction, cyto | 99.6 | |
| 3f04_A | 143 | Synaptotagmin-1; C2A, calcium, cell junction, cyto | 99.6 | |
| 3fbk_A | 153 | RGS3, RGP3, regulator of G-protein signaling 3; al | 99.6 | |
| 3fdw_A | 148 | Synaptotagmin-like protein 4; structural genomics, | 99.59 | |
| 2enp_A | 147 | B/K protein; C2 type 1,beta sandwich, structural g | 99.59 | |
| 1rsy_A | 152 | Synaptotagmin I; calcium/phospholipid binding prot | 99.59 | |
| 1v27_A | 141 | Regulating synaptic membrane exocytosis protein 2; | 99.59 | |
| 2bwq_A | 129 | Regulating synaptic membrane exocytosis protein 2; | 99.59 | |
| 2enp_A | 147 | B/K protein; C2 type 1,beta sandwich, structural g | 99.58 | |
| 2d8k_A | 141 | Synaptotagmin VII; exocytosis, calcium binding, ly | 99.58 | |
| 1rsy_A | 152 | Synaptotagmin I; calcium/phospholipid binding prot | 99.58 | |
| 2bwq_A | 129 | Regulating synaptic membrane exocytosis protein 2; | 99.58 | |
| 3fdw_A | 148 | Synaptotagmin-like protein 4; structural genomics, | 99.58 | |
| 2dmg_A | 142 | KIAA1228 protein; beta-sandwich, structural genomi | 99.58 | |
| 1rh8_A | 142 | Piccolo protein; beta-sandwich, metal binding prot | 99.57 | |
| 1v27_A | 141 | Regulating synaptic membrane exocytosis protein 2; | 99.57 | |
| 2d8k_A | 141 | Synaptotagmin VII; exocytosis, calcium binding, ly | 99.57 | |
| 1ugk_A | 138 | Synaptotagmin IV, KIAA1342; beta sandwich, structu | 99.56 | |
| 1ugk_A | 138 | Synaptotagmin IV, KIAA1342; beta sandwich, structu | 99.55 | |
| 1a25_A | 149 | CALB, protein kinase C (beta); calcium++/phospholi | 99.54 | |
| 3n5a_A | 138 | Synaptotagmin-7; calcium/phospholipid binding prot | 99.54 | |
| 2q3x_A | 171 | Regulating synaptic membrane exocytosis protein 1; | 99.53 | |
| 3rdl_A | 137 | Protein kinase C alpha type; protein kinase PKC, t | 99.53 | |
| 2cm5_A | 166 | Rabphilin-3A; protein transport, zinc-finger, Ca2+ | 99.52 | |
| 2dmg_A | 142 | KIAA1228 protein; beta-sandwich, structural genomi | 99.52 | |
| 3b7y_A | 153 | E3 ubiquitin-protein ligase NEDD4; C2 domain, UBL- | 99.52 | |
| 3fbk_A | 153 | RGS3, RGP3, regulator of G-protein signaling 3; al | 99.51 | |
| 1rh8_A | 142 | Piccolo protein; beta-sandwich, metal binding prot | 99.51 | |
| 1tjx_A | 159 | Similar to synaptotagmini/P65; C2B domain, calcium | 99.51 | |
| 1w15_A | 153 | Synaptotagmin IV; metal binding protein, endocytos | 99.5 | |
| 2chd_A | 142 | Rabphilin-3A, exophilin-1; C2 domain, C2A, calcium | 99.5 | |
| 2q3x_A | 171 | Regulating synaptic membrane exocytosis protein 1; | 99.49 | |
| 2dmh_A | 140 | Myoferlin; beta-sandwich, FER-1-like protein 3, mu | 99.48 | |
| 1rlw_A | 126 | Phospholipase A2, CALB domain; hydrolase, C2 domai | 99.48 | |
| 1rlw_A | 126 | Phospholipase A2, CALB domain; hydrolase, C2 domai | 99.48 | |
| 3n5a_A | 138 | Synaptotagmin-7; calcium/phospholipid binding prot | 99.47 | |
| 2fk9_A | 157 | Protein kinase C, ETA type; ATP-binding, metal-bin | 99.47 | |
| 3b7y_A | 153 | E3 ubiquitin-protein ligase NEDD4; C2 domain, UBL- | 99.47 | |
| 1tjx_A | 159 | Similar to synaptotagmini/P65; C2B domain, calcium | 99.46 | |
| 1gmi_A | 136 | Protein kinase C, epsilon type; PKC, C2 domain, X- | 99.46 | |
| 2dmh_A | 140 | Myoferlin; beta-sandwich, FER-1-like protein 3, mu | 99.45 | |
| 3m7f_B | 176 | E3 ubiquitin-protein ligase NEDD4; C2 domain, GRB1 | 99.45 | |
| 3kwu_A | 148 | MUNC13-1; calcium binding protein, phospholipid bi | 99.44 | |
| 2cm5_A | 166 | Rabphilin-3A; protein transport, zinc-finger, Ca2+ | 99.44 | |
| 2fk9_A | 157 | Protein kinase C, ETA type; ATP-binding, metal-bin | 99.44 | |
| 1w15_A | 153 | Synaptotagmin IV; metal binding protein, endocytos | 99.43 | |
| 1gmi_A | 136 | Protein kinase C, epsilon type; PKC, C2 domain, X- | 99.42 | |
| 2chd_A | 142 | Rabphilin-3A, exophilin-1; C2 domain, C2A, calcium | 99.41 | |
| 2ep6_A | 133 | MCTP2 protein; beta sandwich, Ca2+ binding, membra | 99.41 | |
| 3m7f_B | 176 | E3 ubiquitin-protein ligase NEDD4; C2 domain, GRB1 | 99.41 | |
| 3kwu_A | 148 | MUNC13-1; calcium binding protein, phospholipid bi | 99.4 | |
| 2r83_A | 284 | Synaptotagmin-1; C2A-C2B, exocytosis, calcium, cel | 99.4 | |
| 2ep6_A | 133 | MCTP2 protein; beta sandwich, Ca2+ binding, membra | 99.38 | |
| 2cjt_A | 131 | UNC-13 homolog A, MUNC13-1; phorbol-ester binding, | 99.36 | |
| 2nq3_A | 173 | Itchy homolog E3 ubiquitin protein ligase; C2 doma | 99.35 | |
| 2cjt_A | 131 | UNC-13 homolog A, MUNC13-1; phorbol-ester binding, | 99.35 | |
| 1wfj_A | 136 | Putative elicitor-responsive gene; C2 domain, rike | 99.35 | |
| 1wfj_A | 136 | Putative elicitor-responsive gene; C2 domain, rike | 99.33 | |
| 3pyc_A | 132 | E3 ubiquitin-protein ligase smurf1; phospholipid b | 99.32 | |
| 2nq3_A | 173 | Itchy homolog E3 ubiquitin protein ligase; C2 doma | 99.31 | |
| 3pyc_A | 132 | E3 ubiquitin-protein ligase smurf1; phospholipid b | 99.31 | |
| 3l9b_A | 144 | Otoferlin; C2-domain, beta-sheets, cell membrane, | 99.3 | |
| 2cjs_A | 167 | UNC-13 homolog A, MUNC13-1; neurotransmitter trans | 99.28 | |
| 2cjs_A | 167 | UNC-13 homolog A, MUNC13-1; neurotransmitter trans | 99.27 | |
| 1dqv_A | 296 | Synaptotagmin III; beta sandwich, calcium ION, C2 | 99.23 | |
| 3pfq_A | 674 | PKC-B, PKC-beta, protein kinase C beta type; phosp | 99.22 | |
| 3l9b_A | 144 | Otoferlin; C2-domain, beta-sheets, cell membrane, | 99.18 | |
| 3nsj_A | 540 | Perforin-1; pore forming protein, immune system; H | 99.17 | |
| 1cjy_A | 749 | CPLA2, protein (cytosolic phospholipase A2); lipid | 99.1 | |
| 1cjy_A | 749 | CPLA2, protein (cytosolic phospholipase A2); lipid | 99.09 | |
| 1djx_A | 624 | PLC-D1, phosphoinositide-specific phospholipase C, | 99.05 | |
| 1djx_A | 624 | PLC-D1, phosphoinositide-specific phospholipase C, | 99.02 | |
| 3jzy_A | 510 | Intersectin 2; C2 domain, structural genomics cons | 99.01 | |
| 3jzy_A | 510 | Intersectin 2; C2 domain, structural genomics cons | 99.0 | |
| 3nsj_A | 540 | Perforin-1; pore forming protein, immune system; H | 99.0 | |
| 3pfq_A | 674 | PKC-B, PKC-beta, protein kinase C beta type; phosp | 98.96 | |
| 3bxj_A | 483 | RAS GTPase-activating protein syngap; GTPase activ | 98.95 | |
| 3bxj_A | 483 | RAS GTPase-activating protein syngap; GTPase activ | 98.85 | |
| 2zkm_X | 799 | 1-phosphatidylinositol-4,5-bisphosphate phosphodie | 98.56 | |
| 3ohm_B | 885 | 1-phosphatidylinositol-4,5-bisphosphate phosphodi | 98.5 | |
| 3qr0_A | 816 | Phospholipase C-beta (PLC-beta); PH domain, EF han | 98.48 | |
| 2zkm_X | 799 | 1-phosphatidylinositol-4,5-bisphosphate phosphodie | 98.47 | |
| 3ohm_B | 885 | 1-phosphatidylinositol-4,5-bisphosphate phosphodi | 98.47 | |
| 3qr0_A | 816 | Phospholipase C-beta (PLC-beta); PH domain, EF han | 98.39 | |
| 1yrk_A | 126 | NPKC-delta, protein kinase C, delta type; C2 domai | 97.97 | |
| 1yrk_A | 126 | NPKC-delta, protein kinase C, delta type; C2 domai | 97.95 | |
| 2enj_A | 138 | NPKC-theta, protein kinase C theta type; beta-sand | 97.92 | |
| 2enj_A | 138 | NPKC-theta, protein kinase C theta type; beta-sand | 97.9 | |
| 3l4c_A | 220 | Dedicator of cytokinesis protein 1; DOCK180, DOCK1 | 94.62 | |
| 3l4c_A | 220 | Dedicator of cytokinesis protein 1; DOCK180, DOCK1 | 94.47 | |
| 2wxf_A | 940 | Phosphatidylinositol-4,5-bisphosphate 3-kinase Ca | 82.51 | |
| 2wxf_A | 940 | Phosphatidylinositol-4,5-bisphosphate 3-kinase Ca | 80.47 |
| >2r83_A Synaptotagmin-1; C2A-C2B, exocytosis, calcium, cell junction, cytoplasmic vesicle, glycoprotein, lipoprotein, membrane, metal-binding palmitate; 2.70A {Homo sapiens} SCOP: b.7.1.2 | Back alignment and structure |
|---|
Probab=99.96 E-value=3.3e-29 Score=191.44 Aligned_cols=155 Identities=23% Similarity=0.392 Sum_probs=128.2
Q ss_pred ceEeceeecCCCCCccCceEEcCCcCcCcCCcceEEEEEEeCCCCCCCceEEEEEEecccccCCCC-CceEEecccc---
Q psy6192 2 FKEFAKTLANTNDPKWNQSFFYPGIRRSDLKLRSIEITVWDYTRYGVNDFLGEVIIELSSSLCTDE-PEWFYLTKHT--- 77 (174)
Q Consensus 2 ~k~rT~~~~~t~nP~w~E~f~f~~v~~~~~~~~~L~i~v~d~~~~~~~~~lG~~~~~l~~~~~~~~-~~w~~L~~~~--- 77 (174)
++++|+++++++||.|||+|.|. +..+++....|.|.|||++.++++++||++.++|..+..... ..|++|.+..
T Consensus 54 ~~~~T~~~~~~~nP~wne~f~f~-v~~~~~~~~~l~~~V~d~d~~~~~~~lG~~~i~l~~l~~~~~~~~w~~L~~~~~~~ 132 (284)
T 2r83_A 54 KKFETKVHRKTLNPVFNEQFTFK-VPYSELAGKTLVMAVYDFDRFSKHDIIGEFKVPMNTVDFGHVTEEWRDLQSAEKEE 132 (284)
T ss_dssp SCEECCCCCSCSSCEEEEEEEEC-CCGGGCTTCEEEEEEEECCSSSCCCEEEEEEEEGGGCCCSSCEEEEEECBCCSSCC
T ss_pred ceEeCCcccCCCCCeeCceEEEE-echHHhCcCEEEEEEEECCCCCCCceeEEEEEcchhcccCCcceeEEEeecccccc
Confidence 46789999999999999999998 888777678999999999999999999999999998875543 3499986431
Q ss_pred ----eEec---------------------cC-----------------------CCCccccccCCCCCccccEEEeCccc
Q psy6192 78 ----LELQ---------------------FP-----------------------LSNLSKTLANTNDPKWNQSFFYPGIR 109 (174)
Q Consensus 78 ----~~l~---------------------~p-----------------------~~~kT~~~~~t~~P~wne~~~f~~~~ 109 (174)
+++. ++ .+++|+++++++||+|||.|.|. ++
T Consensus 133 ~~~~G~i~l~l~~~p~~~~l~v~v~~a~~L~~~d~~~~~dpyv~v~~~~~~~~~~~~kT~v~~~t~nP~wne~f~f~-v~ 211 (284)
T 2r83_A 133 QEKLGDICFSLRYVPTAGKLTVVILEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTIKKNTLNPYYNESFSFE-VP 211 (284)
T ss_dssp CCCCCEEEEEEEEETTTTEEEEEEEEEESCCCCSTTSCCCEEEEEEEEETTEEEEEEECCCCCSCSSCEEEEEEEEE-CC
T ss_pred ccccccEEEEEEecCcCCceEEEEEEeECCCCcCCCCCcCeEEEEEEEeCCcEeeeeccceecCCCCCEEceeEEEe-CC
Confidence 1111 00 04689999999999999999999 88
Q ss_pred cCCCCcceEEEEEEeCCCCCCCceeEEEEEeCCcCC-------------CCCcCceeecccC
Q psy6192 110 RSDLKLRSIEITVWDYTRYGVNDFLGEVIIELSSSL-------------CTDEPEWFYLTKH 158 (174)
Q Consensus 110 ~~~~~~~~l~i~v~d~~~~~~~~~iG~~~l~l~~~~-------------~~~~~~W~~L~~~ 158 (174)
.+++....|.|+|||++.++++++||++.|+++++. ....++||+|.+.
T Consensus 212 ~~~l~~~~l~i~V~d~d~~~~~~~iG~~~i~l~~~~~~~~~w~~~~~~~~~~~~~W~~L~~~ 273 (284)
T 2r83_A 212 FEQIQKVQVVVTVLDYDKIGKNDAIGKVFVGYNSTGAELRHWSDMLANPRRPIAQWHTLQVE 273 (284)
T ss_dssp TTTGGGEEEEEEEEECCSSSCCCEEEEEEEETTCCHHHHHHHHHHHHSTTSCEEEEEECBCH
T ss_pred HHHhCceEEEEEEEeCCCCCCCcEEEEEEECCCCCCcHHHHHHHHHHCCCCchheeeecCCc
Confidence 888877889999999999999999999999998631 1245689999874
|
| >1dqv_A Synaptotagmin III; beta sandwich, calcium ION, C2 domain, endocytosis/exocytosis complex; 3.20A {Rattus rattus} SCOP: b.7.1.2 b.7.1.2 PDB: 3hn8_A | Back alignment and structure |
|---|
| >1wfm_A Synaptotagmin XIII; C2 domain, exocytosis, neurotransmitter release, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: b.7.1.2 | Back alignment and structure |
|---|
| >1wfm_A Synaptotagmin XIII; C2 domain, exocytosis, neurotransmitter release, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: b.7.1.2 | Back alignment and structure |
|---|
| >2z0u_A WW domain-containing protein 1; C2 domain, alternative splicing, coiled coil, cytoplasm, phosphorylation, polymorphism, lipid binding protein; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >1a25_A CALB, protein kinase C (beta); calcium++/phospholipid binding protein, calcium-binding protein; HET: PSE; 2.70A {Rattus norvegicus} SCOP: b.7.1.2 | Back alignment and structure |
|---|
| >2z0u_A WW domain-containing protein 1; C2 domain, alternative splicing, coiled coil, cytoplasm, phosphorylation, polymorphism, lipid binding protein; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >2b3r_A Phosphatidylinositol-4-phosphate 3-kinase C2 DOMA containing alpha polypeptide; C2 domain, lipid binding, PI3-kinase, transferase; 2.30A {Mus musculus} | Back alignment and structure |
|---|
| >2b3r_A Phosphatidylinositol-4-phosphate 3-kinase C2 DOMA containing alpha polypeptide; C2 domain, lipid binding, PI3-kinase, transferase; 2.30A {Mus musculus} | Back alignment and structure |
|---|
| >3f04_A Synaptotagmin-1; C2A, calcium, cell junction, cytoplasmic vesicle, glycoprotein, lipoprotein, membrane, metal- binding, palmitate, phosphoprotein; 1.35A {Homo sapiens} SCOP: b.7.1.2 PDB: 3f01_A 3f05_A 3f00_A 1byn_A 2k45_A 2k4a_A 2k8m_A 2ki6_A* | Back alignment and structure |
|---|
| >3f04_A Synaptotagmin-1; C2A, calcium, cell junction, cytoplasmic vesicle, glycoprotein, lipoprotein, membrane, metal- binding, palmitate, phosphoprotein; 1.35A {Homo sapiens} SCOP: b.7.1.2 PDB: 3f01_A 3f05_A 3f00_A 1byn_A 2k45_A 2k4a_A 2k8m_A 2ki6_A* | Back alignment and structure |
|---|
| >3fbk_A RGS3, RGP3, regulator of G-protein signaling 3; all beta-sheet fold, structural genomics, PSI-2, protein structure initiative; 2.00A {Homo sapiens} SCOP: b.7.1.0 | Back alignment and structure |
|---|
| >3fdw_A Synaptotagmin-like protein 4; structural genomics, phospholipid binding, alternative splicing, cell membrane, cytoplasmic vesicle, membrane; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >2enp_A B/K protein; C2 type 1,beta sandwich, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1rsy_A Synaptotagmin I; calcium/phospholipid binding protein; 1.90A {Rattus norvegicus} SCOP: b.7.1.2 | Back alignment and structure |
|---|
| >1v27_A Regulating synaptic membrane exocytosis protein 2; RAB3-interacting molecule, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.7.1.2 | Back alignment and structure |
|---|
| >2bwq_A Regulating synaptic membrane exocytosis protein 2; C2 domain, neurotransmitter release, transport protein; 1.41A {Rattus norvegicus} SCOP: b.7.1.2 | Back alignment and structure |
|---|
| >2enp_A B/K protein; C2 type 1,beta sandwich, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2d8k_A Synaptotagmin VII; exocytosis, calcium binding, lysosome, C2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1rsy_A Synaptotagmin I; calcium/phospholipid binding protein; 1.90A {Rattus norvegicus} SCOP: b.7.1.2 | Back alignment and structure |
|---|
| >2bwq_A Regulating synaptic membrane exocytosis protein 2; C2 domain, neurotransmitter release, transport protein; 1.41A {Rattus norvegicus} SCOP: b.7.1.2 | Back alignment and structure |
|---|
| >3fdw_A Synaptotagmin-like protein 4; structural genomics, phospholipid binding, alternative splicing, cell membrane, cytoplasmic vesicle, membrane; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >2dmg_A KIAA1228 protein; beta-sandwich, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1rh8_A Piccolo protein; beta-sandwich, metal binding protein; NMR {Rattus norvegicus} SCOP: b.7.1.2 | Back alignment and structure |
|---|
| >1v27_A Regulating synaptic membrane exocytosis protein 2; RAB3-interacting molecule, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.7.1.2 | Back alignment and structure |
|---|
| >2d8k_A Synaptotagmin VII; exocytosis, calcium binding, lysosome, C2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1ugk_A Synaptotagmin IV, KIAA1342; beta sandwich, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.7.1.2 | Back alignment and structure |
|---|
| >1ugk_A Synaptotagmin IV, KIAA1342; beta sandwich, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.7.1.2 | Back alignment and structure |
|---|
| >1a25_A CALB, protein kinase C (beta); calcium++/phospholipid binding protein, calcium-binding protein; HET: PSE; 2.70A {Rattus norvegicus} SCOP: b.7.1.2 | Back alignment and structure |
|---|
| >3n5a_A Synaptotagmin-7; calcium/phospholipid binding protein, protein transport; 1.44A {Mus musculus} | Back alignment and structure |
|---|
| >2q3x_A Regulating synaptic membrane exocytosis protein 1; C2 domain dimer, neurotransmitter release, transport protein; HET: MSE; 1.73A {Rattus norvegicus} | Back alignment and structure |
|---|
| >2cm5_A Rabphilin-3A; protein transport, zinc-finger, Ca2+ binding, metal-binding, synaptic exocytosis, C2A-C2B linker fragment, C2B, zinc, synapse; 1.28A {Rattus norvegicus} SCOP: b.7.1.2 PDB: 2cm6_A 3rpb_A | Back alignment and structure |
|---|
| >2dmg_A KIAA1228 protein; beta-sandwich, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3b7y_A E3 ubiquitin-protein ligase NEDD4; C2 domain, UBL-conjugation pathway, structural genomics consortium, SGC, cytoplasm; 1.80A {Homo sapiens} PDB: 2nsq_A | Back alignment and structure |
|---|
| >3fbk_A RGS3, RGP3, regulator of G-protein signaling 3; all beta-sheet fold, structural genomics, PSI-2, protein structure initiative; 2.00A {Homo sapiens} SCOP: b.7.1.0 | Back alignment and structure |
|---|
| >1rh8_A Piccolo protein; beta-sandwich, metal binding protein; NMR {Rattus norvegicus} SCOP: b.7.1.2 | Back alignment and structure |
|---|
| >1tjx_A Similar to synaptotagmini/P65; C2B domain, calcium binding, endocytosis-EX complex; HET: GOL; 1.04A {Rattus norvegicus} SCOP: b.7.1.2 PDB: 1tjm_A* 1uov_A 1uow_A 1k5w_A 2lha_A* | Back alignment and structure |
|---|
| >1w15_A Synaptotagmin IV; metal binding protein, endocytosis/exocytosis neurotransmitter release, transmembrane; 1.93A {Rattus norvegicus} SCOP: b.7.1.2 PDB: 1w16_A | Back alignment and structure |
|---|
| >2chd_A Rabphilin-3A, exophilin-1; C2 domain, C2A, calcium binding, synaptic EXOC metal-binding, protein transport, synapse, transport, zinc-; 1.92A {Rattus norvegicus} PDB: 2k3h_A | Back alignment and structure |
|---|
| >2q3x_A Regulating synaptic membrane exocytosis protein 1; C2 domain dimer, neurotransmitter release, transport protein; HET: MSE; 1.73A {Rattus norvegicus} | Back alignment and structure |
|---|
| >2dmh_A Myoferlin; beta-sandwich, FER-1-like protein 3, muscular dystrophy, cardiomyopathy, membrane fusion, dystrophin, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1rlw_A Phospholipase A2, CALB domain; hydrolase, C2 domain; 2.40A {Homo sapiens} SCOP: b.7.1.1 | Back alignment and structure |
|---|
| >1rlw_A Phospholipase A2, CALB domain; hydrolase, C2 domain; 2.40A {Homo sapiens} SCOP: b.7.1.1 | Back alignment and structure |
|---|
| >3n5a_A Synaptotagmin-7; calcium/phospholipid binding protein, protein transport; 1.44A {Mus musculus} | Back alignment and structure |
|---|
| >2fk9_A Protein kinase C, ETA type; ATP-binding, metal-binding, nucleotide-binding, diacylglycerol binding, serine/threonine-protein kinase, transferase; 1.75A {Homo sapiens} | Back alignment and structure |
|---|
| >3b7y_A E3 ubiquitin-protein ligase NEDD4; C2 domain, UBL-conjugation pathway, structural genomics consortium, SGC, cytoplasm; 1.80A {Homo sapiens} PDB: 2nsq_A | Back alignment and structure |
|---|
| >1tjx_A Similar to synaptotagmini/P65; C2B domain, calcium binding, endocytosis-EX complex; HET: GOL; 1.04A {Rattus norvegicus} SCOP: b.7.1.2 PDB: 1tjm_A* 1uov_A 1uow_A 1k5w_A 2lha_A* | Back alignment and structure |
|---|
| >1gmi_A Protein kinase C, epsilon type; PKC, C2 domain, X-RAY, phospholipids, PKC epsilon.; 1.7A {Rattus rattus} SCOP: b.7.1.1 | Back alignment and structure |
|---|
| >2dmh_A Myoferlin; beta-sandwich, FER-1-like protein 3, muscular dystrophy, cardiomyopathy, membrane fusion, dystrophin, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3m7f_B E3 ubiquitin-protein ligase NEDD4; C2 domain, GRB10, SH2 domain, phosphoprotein, conjugation pathway, signaling protein-ligase complex; 2.00A {Mus musculus} | Back alignment and structure |
|---|
| >3kwu_A MUNC13-1; calcium binding protein, phospholipid binding protein, metal binding protein; HET: GOL; 1.37A {Rattus norvegicus} SCOP: b.7.1.0 PDB: 3kwt_A* | Back alignment and structure |
|---|
| >2cm5_A Rabphilin-3A; protein transport, zinc-finger, Ca2+ binding, metal-binding, synaptic exocytosis, C2A-C2B linker fragment, C2B, zinc, synapse; 1.28A {Rattus norvegicus} SCOP: b.7.1.2 PDB: 2cm6_A 3rpb_A | Back alignment and structure |
|---|
| >2fk9_A Protein kinase C, ETA type; ATP-binding, metal-binding, nucleotide-binding, diacylglycerol binding, serine/threonine-protein kinase, transferase; 1.75A {Homo sapiens} | Back alignment and structure |
|---|
| >1w15_A Synaptotagmin IV; metal binding protein, endocytosis/exocytosis neurotransmitter release, transmembrane; 1.93A {Rattus norvegicus} SCOP: b.7.1.2 PDB: 1w16_A | Back alignment and structure |
|---|
| >1gmi_A Protein kinase C, epsilon type; PKC, C2 domain, X-RAY, phospholipids, PKC epsilon.; 1.7A {Rattus rattus} SCOP: b.7.1.1 | Back alignment and structure |
|---|
| >2chd_A Rabphilin-3A, exophilin-1; C2 domain, C2A, calcium binding, synaptic EXOC metal-binding, protein transport, synapse, transport, zinc-; 1.92A {Rattus norvegicus} PDB: 2k3h_A | Back alignment and structure |
|---|
| >2ep6_A MCTP2 protein; beta sandwich, Ca2+ binding, membrane binding, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.7.1.1 | Back alignment and structure |
|---|
| >3m7f_B E3 ubiquitin-protein ligase NEDD4; C2 domain, GRB10, SH2 domain, phosphoprotein, conjugation pathway, signaling protein-ligase complex; 2.00A {Mus musculus} | Back alignment and structure |
|---|
| >3kwu_A MUNC13-1; calcium binding protein, phospholipid binding protein, metal binding protein; HET: GOL; 1.37A {Rattus norvegicus} SCOP: b.7.1.0 PDB: 3kwt_A* | Back alignment and structure |
|---|
| >2r83_A Synaptotagmin-1; C2A-C2B, exocytosis, calcium, cell junction, cytoplasmic vesicle, glycoprotein, lipoprotein, membrane, metal-binding palmitate; 2.70A {Homo sapiens} SCOP: b.7.1.2 | Back alignment and structure |
|---|
| >2ep6_A MCTP2 protein; beta sandwich, Ca2+ binding, membrane binding, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.7.1.1 | Back alignment and structure |
|---|
| >2cjt_A UNC-13 homolog A, MUNC13-1; phorbol-ester binding, neurotransmitter release, RIM, MUNC13 domains, exocytosis, metal-binding; 1.44A {Rattus norvegicus} SCOP: b.7.1.1 | Back alignment and structure |
|---|
| >2nq3_A Itchy homolog E3 ubiquitin protein ligase; C2 domain, UBL conjugation pathway, structural genomics consortium, SGC; 1.80A {Homo sapiens} SCOP: b.7.1.1 | Back alignment and structure |
|---|
| >2cjt_A UNC-13 homolog A, MUNC13-1; phorbol-ester binding, neurotransmitter release, RIM, MUNC13 domains, exocytosis, metal-binding; 1.44A {Rattus norvegicus} SCOP: b.7.1.1 | Back alignment and structure |
|---|
| >1wfj_A Putative elicitor-responsive gene; C2 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, plant protein; NMR {Arabidopsis thaliana} SCOP: b.7.1.2 | Back alignment and structure |
|---|
| >1wfj_A Putative elicitor-responsive gene; C2 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, plant protein; NMR {Arabidopsis thaliana} SCOP: b.7.1.2 | Back alignment and structure |
|---|
| >3pyc_A E3 ubiquitin-protein ligase smurf1; phospholipid binding, membrane associate, lipid binding PROT; 1.96A {Homo sapiens} PDB: 2jqz_A | Back alignment and structure |
|---|
| >2nq3_A Itchy homolog E3 ubiquitin protein ligase; C2 domain, UBL conjugation pathway, structural genomics consortium, SGC; 1.80A {Homo sapiens} SCOP: b.7.1.1 | Back alignment and structure |
|---|
| >3pyc_A E3 ubiquitin-protein ligase smurf1; phospholipid binding, membrane associate, lipid binding PROT; 1.96A {Homo sapiens} PDB: 2jqz_A | Back alignment and structure |
|---|
| >3l9b_A Otoferlin; C2-domain, beta-sheets, cell membrane, synaptic V hearing, membrane, synapse, transmembrane, membrane protein; 1.95A {Rattus norvegicus} | Back alignment and structure |
|---|
| >2cjs_A UNC-13 homolog A, MUNC13-1; neurotransmitter transport, zinc finger, synapto phorbol-ester binding; 1.78A {Rattus norvegicus} SCOP: b.7.1.1 | Back alignment and structure |
|---|
| >2cjs_A UNC-13 homolog A, MUNC13-1; neurotransmitter transport, zinc finger, synapto phorbol-ester binding; 1.78A {Rattus norvegicus} SCOP: b.7.1.1 | Back alignment and structure |
|---|
| >1dqv_A Synaptotagmin III; beta sandwich, calcium ION, C2 domain, endocytosis/exocytosis complex; 3.20A {Rattus rattus} SCOP: b.7.1.2 b.7.1.2 PDB: 3hn8_A | Back alignment and structure |
|---|
| >3pfq_A PKC-B, PKC-beta, protein kinase C beta type; phosphorylation, transferase; HET: TPO SEP ANP; 4.00A {Rattus norvegicus} PDB: 1tbn_A 1tbo_A 2e73_A | Back alignment and structure |
|---|
| >3l9b_A Otoferlin; C2-domain, beta-sheets, cell membrane, synaptic V hearing, membrane, synapse, transmembrane, membrane protein; 1.95A {Rattus norvegicus} | Back alignment and structure |
|---|
| >3nsj_A Perforin-1; pore forming protein, immune system; HET: NAG; 2.75A {Mus musculus} | Back alignment and structure |
|---|
| >1cjy_A CPLA2, protein (cytosolic phospholipase A2); lipid-binding, hydrolase; HET: MES; 2.50A {Homo sapiens} SCOP: b.7.1.1 c.19.1.2 PDB: 1bci_A | Back alignment and structure |
|---|
| >1cjy_A CPLA2, protein (cytosolic phospholipase A2); lipid-binding, hydrolase; HET: MES; 2.50A {Homo sapiens} SCOP: b.7.1.1 c.19.1.2 PDB: 1bci_A | Back alignment and structure |
|---|
| >1djx_A PLC-D1, phosphoinositide-specific phospholipase C, isozyme delta1; phosphoric diester hydrolase, hydrolase, lipid degradation, transducer; HET: I3P; 2.30A {Rattus norvegicus} SCOP: a.39.1.7 b.7.1.1 c.1.18.1 PDB: 1djg_A 1dji_A 1djh_A* 1djw_A* 1djy_A* 1djz_A* 2isd_A 1qas_A 1qat_A | Back alignment and structure |
|---|
| >1djx_A PLC-D1, phosphoinositide-specific phospholipase C, isozyme delta1; phosphoric diester hydrolase, hydrolase, lipid degradation, transducer; HET: I3P; 2.30A {Rattus norvegicus} SCOP: a.39.1.7 b.7.1.1 c.1.18.1 PDB: 1djg_A 1dji_A 1djh_A* 1djw_A* 1djy_A* 1djz_A* 2isd_A 1qas_A 1qat_A | Back alignment and structure |
|---|
| >3jzy_A Intersectin 2; C2 domain, structural genomics consortium (SGC), endocytosis; 1.56A {Homo sapiens} PDB: 3qbv_B* 1ki1_B | Back alignment and structure |
|---|
| >3jzy_A Intersectin 2; C2 domain, structural genomics consortium (SGC), endocytosis; 1.56A {Homo sapiens} PDB: 3qbv_B* 1ki1_B | Back alignment and structure |
|---|
| >3nsj_A Perforin-1; pore forming protein, immune system; HET: NAG; 2.75A {Mus musculus} | Back alignment and structure |
|---|
| >3pfq_A PKC-B, PKC-beta, protein kinase C beta type; phosphorylation, transferase; HET: TPO SEP ANP; 4.00A {Rattus norvegicus} PDB: 1tbn_A 1tbo_A 2e73_A | Back alignment and structure |
|---|
| >3bxj_A RAS GTPase-activating protein syngap; GTPase activation, membrane, phosphoprotein, SH3-binding, signaling protein; 3.00A {Rattus norvegicus} | Back alignment and structure |
|---|
| >3bxj_A RAS GTPase-activating protein syngap; GTPase activation, membrane, phosphoprotein, SH3-binding, signaling protein; 3.00A {Rattus norvegicus} | Back alignment and structure |
|---|
| >2zkm_X 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase beta-2; phospholipase C, phosphoinositide phospholipase, PLC-beta-2, calcium, coiled coil; 1.62A {Homo sapiens} SCOP: a.39.1.7 b.7.1.1 b.55.1.1 c.1.18.1 PDB: 2fju_B | Back alignment and structure |
|---|
| >3ohm_B 1-phosphatidylinositol-4,5-bisphosphate phosphodi beta-3; PH domain, EF hand, TIM barrel, C2 domain, GTPase, lipase, C binding, GTP binding; HET: GDP; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >3qr0_A Phospholipase C-beta (PLC-beta); PH domain, EF hand, C2 domain, TIM barrel domain, hydrolase, calcium binding, phospholipid binding; 2.00A {Sepia officinalis} PDB: 3qr1_A | Back alignment and structure |
|---|
| >2zkm_X 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase beta-2; phospholipase C, phosphoinositide phospholipase, PLC-beta-2, calcium, coiled coil; 1.62A {Homo sapiens} SCOP: a.39.1.7 b.7.1.1 b.55.1.1 c.1.18.1 PDB: 2fju_B | Back alignment and structure |
|---|
| >3ohm_B 1-phosphatidylinositol-4,5-bisphosphate phosphodi beta-3; PH domain, EF hand, TIM barrel, C2 domain, GTPase, lipase, C binding, GTP binding; HET: GDP; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >3qr0_A Phospholipase C-beta (PLC-beta); PH domain, EF hand, C2 domain, TIM barrel domain, hydrolase, calcium binding, phospholipid binding; 2.00A {Sepia officinalis} PDB: 3qr1_A | Back alignment and structure |
|---|
| >1yrk_A NPKC-delta, protein kinase C, delta type; C2 domain, protein binding; HET: PTR; 1.70A {Homo sapiens} PDB: 1bdy_A | Back alignment and structure |
|---|
| >1yrk_A NPKC-delta, protein kinase C, delta type; C2 domain, protein binding; HET: PTR; 1.70A {Homo sapiens} PDB: 1bdy_A | Back alignment and structure |
|---|
| >2enj_A NPKC-theta, protein kinase C theta type; beta-sandwich, phosphotyrosine binding, TCR, T-cell, diacylglycerol, phorbol ester, structural genomics; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2enj_A NPKC-theta, protein kinase C theta type; beta-sandwich, phosphotyrosine binding, TCR, T-cell, diacylglycerol, phorbol ester, structural genomics; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3l4c_A Dedicator of cytokinesis protein 1; DOCK180, DOCK1, phosphoinositide specificity, guanine exchan factor, RHO GTPase, cytoskeleton, cell migration; 2.37A {Homo sapiens} | Back alignment and structure |
|---|
| >3l4c_A Dedicator of cytokinesis protein 1; DOCK180, DOCK1, phosphoinositide specificity, guanine exchan factor, RHO GTPase, cytoskeleton, cell migration; 2.37A {Homo sapiens} | Back alignment and structure |
|---|
| >2wxf_A Phosphatidylinositol-4,5-bisphosphate 3-kinase Ca subunit delta isoform; transferase, phosphoprotein, isoform-specific inhibitors; HET: 039; 1.90A {Mus musculus} PDB: 2wxg_A* 2wxh_A* 2wxi_A* 2wxj_A* 2wxk_A* 2wxl_A* 2wxm_A* 2wxn_A* 2wxo_A* 2wxp_A* 2wxq_A* 2wxr_A 2x38_A* | Back alignment and structure |
|---|
| >2wxf_A Phosphatidylinositol-4,5-bisphosphate 3-kinase Ca subunit delta isoform; transferase, phosphoprotein, isoform-specific inhibitors; HET: 039; 1.90A {Mus musculus} PDB: 2wxg_A* 2wxh_A* 2wxi_A* 2wxj_A* 2wxk_A* 2wxl_A* 2wxm_A* 2wxn_A* 2wxo_A* 2wxp_A* 2wxq_A* 2wxr_A 2x38_A* | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 174 | ||||
| d2bwqa1 | 125 | b.7.1.2 (A:729-853) Regulating synaptic membrane e | 2e-14 | |
| d2bwqa1 | 125 | b.7.1.2 (A:729-853) Regulating synaptic membrane e | 2e-14 | |
| d1ugka_ | 138 | b.7.1.2 (A:) Synaptotagmin IV {Human (Homo sapiens | 5e-11 | |
| d1ugka_ | 138 | b.7.1.2 (A:) Synaptotagmin IV {Human (Homo sapiens | 3e-10 | |
| d1w15a_ | 138 | b.7.1.2 (A:) Synaptotagmin IV {Rat (Rattus norvegi | 4e-10 | |
| d1w15a_ | 138 | b.7.1.2 (A:) Synaptotagmin IV {Rat (Rattus norvegi | 1e-09 | |
| d1a25a_ | 132 | b.7.1.2 (A:) C2 domain from protein kinase c (beta | 4e-09 | |
| d1a25a_ | 132 | b.7.1.2 (A:) C2 domain from protein kinase c (beta | 2e-08 | |
| d1rh8a_ | 142 | b.7.1.2 (A:) Piccolo {Rat (Rattus norvegicus) [Tax | 2e-08 | |
| d1rh8a_ | 142 | b.7.1.2 (A:) Piccolo {Rat (Rattus norvegicus) [Tax | 2e-08 | |
| d2cm5a1 | 137 | b.7.1.2 (A:541-677) C2b-domain of rabphilin {Rat ( | 3e-08 | |
| d2cm5a1 | 137 | b.7.1.2 (A:541-677) C2b-domain of rabphilin {Rat ( | 8e-08 | |
| d1uowa_ | 157 | b.7.1.2 (A:) Synaptogamin I {Rat (Rattus norvegicu | 3e-08 | |
| d1uowa_ | 157 | b.7.1.2 (A:) Synaptogamin I {Rat (Rattus norvegicu | 6e-08 | |
| d1dqva2 | 145 | b.7.1.2 (A:425-569) Synaptotagmin III {Rat (Rattus | 3e-07 | |
| d1dqva2 | 145 | b.7.1.2 (A:425-569) Synaptotagmin III {Rat (Rattus | 4e-07 | |
| d1rsya_ | 143 | b.7.1.2 (A:) Synaptogamin I {Rat (Rattus norvegicu | 5e-07 | |
| d1rsya_ | 143 | b.7.1.2 (A:) Synaptogamin I {Rat (Rattus norvegicu | 9e-07 | |
| d1dqva1 | 130 | b.7.1.2 (A:295-424) Synaptotagmin III {Rat (Rattus | 2e-06 | |
| d1dqva1 | 130 | b.7.1.2 (A:295-424) Synaptotagmin III {Rat (Rattus | 2e-06 | |
| d2ep6a1 | 126 | b.7.1.1 (A:92-217) Multiple C2 and transmembrane d | 9e-06 | |
| d2ep6a1 | 126 | b.7.1.1 (A:92-217) Multiple C2 and transmembrane d | 7e-05 | |
| d1wfja_ | 136 | b.7.1.2 (A:) C2 domain protein At1g63220 {Thale cr | 1e-05 | |
| d1wfja_ | 136 | b.7.1.2 (A:) C2 domain protein At1g63220 {Thale cr | 3e-05 | |
| d1wfma_ | 138 | b.7.1.2 (A:) Synaptotagmin XIII {Human (Homo sapie | 3e-04 | |
| d1wfma_ | 138 | b.7.1.2 (A:) Synaptotagmin XIII {Human (Homo sapie | 0.003 | |
| d1rlwa_ | 126 | b.7.1.1 (A:) Domain from cytosolic phospholipase A | 7e-04 | |
| d1rlwa_ | 126 | b.7.1.1 (A:) Domain from cytosolic phospholipase A | 8e-04 | |
| d1qasa2 | 131 | b.7.1.1 (A:626-756) PI-specific phospholipase C is | 0.002 | |
| d2nq3a1 | 133 | b.7.1.1 (A:13-145) E3 ubiquitin-protein ligase Itc | 0.003 |
| >d2bwqa1 b.7.1.2 (A:729-853) Regulating synaptic membrane exocytosis protein, rim2 {Human (Homo sapiens) [TaxId: 9606]} Length = 125 | Back information, alignment and structure |
|---|
class: All beta proteins fold: C2 domain-like superfamily: C2 domain (Calcium/lipid-binding domain, CaLB) family: Synaptotagmin-like (S variant) domain: Regulating synaptic membrane exocytosis protein, rim2 species: Human (Homo sapiens) [TaxId: 9606]
Score = 64.3 bits (156), Expect = 2e-14
Identities = 31/69 (44%), Positives = 46/69 (66%), Gaps = 2/69 (2%)
Query: 7 KTLANTNDPKWNQSFFYPGIRRSDLKLRSIEITVWDYTRYGV--NDFLGEVIIELSSSLC 64
KT+ T +PKWNQ+F Y + R + + R +EIT+WD R ++FLGE++IEL ++L
Sbjct: 56 KTVKKTLEPKWNQTFIYSPVHRREFRERMLEITLWDQARVREEESEFLGEILIELETALL 115
Query: 65 TDEPEWFYL 73
DEP W+ L
Sbjct: 116 DDEPHWYKL 124
|
| >d2bwqa1 b.7.1.2 (A:729-853) Regulating synaptic membrane exocytosis protein, rim2 {Human (Homo sapiens) [TaxId: 9606]} Length = 125 | Back information, alignment and structure |
|---|
| >d1ugka_ b.7.1.2 (A:) Synaptotagmin IV {Human (Homo sapiens) [TaxId: 9606]} Length = 138 | Back information, alignment and structure |
|---|
| >d1ugka_ b.7.1.2 (A:) Synaptotagmin IV {Human (Homo sapiens) [TaxId: 9606]} Length = 138 | Back information, alignment and structure |
|---|
| >d1w15a_ b.7.1.2 (A:) Synaptotagmin IV {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 138 | Back information, alignment and structure |
|---|
| >d1w15a_ b.7.1.2 (A:) Synaptotagmin IV {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 138 | Back information, alignment and structure |
|---|
| >d1a25a_ b.7.1.2 (A:) C2 domain from protein kinase c (beta) {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 132 | Back information, alignment and structure |
|---|
| >d1a25a_ b.7.1.2 (A:) C2 domain from protein kinase c (beta) {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 132 | Back information, alignment and structure |
|---|
| >d1rh8a_ b.7.1.2 (A:) Piccolo {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 142 | Back information, alignment and structure |
|---|
| >d1rh8a_ b.7.1.2 (A:) Piccolo {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 142 | Back information, alignment and structure |
|---|
| >d2cm5a1 b.7.1.2 (A:541-677) C2b-domain of rabphilin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 137 | Back information, alignment and structure |
|---|
| >d2cm5a1 b.7.1.2 (A:541-677) C2b-domain of rabphilin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 137 | Back information, alignment and structure |
|---|
| >d1uowa_ b.7.1.2 (A:) Synaptogamin I {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 157 | Back information, alignment and structure |
|---|
| >d1uowa_ b.7.1.2 (A:) Synaptogamin I {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 157 | Back information, alignment and structure |
|---|
| >d1dqva2 b.7.1.2 (A:425-569) Synaptotagmin III {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 145 | Back information, alignment and structure |
|---|
| >d1dqva2 b.7.1.2 (A:425-569) Synaptotagmin III {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 145 | Back information, alignment and structure |
|---|
| >d1rsya_ b.7.1.2 (A:) Synaptogamin I {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 143 | Back information, alignment and structure |
|---|
| >d1rsya_ b.7.1.2 (A:) Synaptogamin I {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 143 | Back information, alignment and structure |
|---|
| >d1dqva1 b.7.1.2 (A:295-424) Synaptotagmin III {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 130 | Back information, alignment and structure |
|---|
| >d1dqva1 b.7.1.2 (A:295-424) Synaptotagmin III {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 130 | Back information, alignment and structure |
|---|
| >d2ep6a1 b.7.1.1 (A:92-217) Multiple C2 and transmembrane domain-containing protein 2, MCTP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 126 | Back information, alignment and structure |
|---|
| >d2ep6a1 b.7.1.1 (A:92-217) Multiple C2 and transmembrane domain-containing protein 2, MCTP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 126 | Back information, alignment and structure |
|---|
| >d1wfja_ b.7.1.2 (A:) C2 domain protein At1g63220 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 136 | Back information, alignment and structure |
|---|
| >d1wfja_ b.7.1.2 (A:) C2 domain protein At1g63220 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 136 | Back information, alignment and structure |
|---|
| >d1wfma_ b.7.1.2 (A:) Synaptotagmin XIII {Human (Homo sapiens) [TaxId: 9606]} Length = 138 | Back information, alignment and structure |
|---|
| >d1wfma_ b.7.1.2 (A:) Synaptotagmin XIII {Human (Homo sapiens) [TaxId: 9606]} Length = 138 | Back information, alignment and structure |
|---|
| >d1rlwa_ b.7.1.1 (A:) Domain from cytosolic phospholipase A2 {Human (Homo sapiens) [TaxId: 9606]} Length = 126 | Back information, alignment and structure |
|---|
| >d1rlwa_ b.7.1.1 (A:) Domain from cytosolic phospholipase A2 {Human (Homo sapiens) [TaxId: 9606]} Length = 126 | Back information, alignment and structure |
|---|
| >d1qasa2 b.7.1.1 (A:626-756) PI-specific phospholipase C isozyme D1 (PLC-D1), C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 131 | Back information, alignment and structure |
|---|
| >d2nq3a1 b.7.1.1 (A:13-145) E3 ubiquitin-protein ligase Itchy {Human (Homo sapiens) [TaxId: 9606]} Length = 133 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 174 | |||
| d1a25a_ | 132 | C2 domain from protein kinase c (beta) {Rat (Rattu | 99.66 | |
| d1rh8a_ | 142 | Piccolo {Rat (Rattus norvegicus) [TaxId: 10116]} | 99.63 | |
| d1wfma_ | 138 | Synaptotagmin XIII {Human (Homo sapiens) [TaxId: 9 | 99.61 | |
| d1dqva1 | 130 | Synaptotagmin III {Rat (Rattus norvegicus) [TaxId: | 99.58 | |
| d1wfma_ | 138 | Synaptotagmin XIII {Human (Homo sapiens) [TaxId: 9 | 99.57 | |
| d2bwqa1 | 125 | Regulating synaptic membrane exocytosis protein, r | 99.57 | |
| d1dqva1 | 130 | Synaptotagmin III {Rat (Rattus norvegicus) [TaxId: | 99.57 | |
| d1uowa_ | 157 | Synaptogamin I {Rat (Rattus norvegicus) [TaxId: 10 | 99.56 | |
| d1rsya_ | 143 | Synaptogamin I {Rat (Rattus norvegicus) [TaxId: 10 | 99.56 | |
| d1rsya_ | 143 | Synaptogamin I {Rat (Rattus norvegicus) [TaxId: 10 | 99.55 | |
| d1a25a_ | 132 | C2 domain from protein kinase c (beta) {Rat (Rattu | 99.55 | |
| d1rh8a_ | 142 | Piccolo {Rat (Rattus norvegicus) [TaxId: 10116]} | 99.55 | |
| d2bwqa1 | 125 | Regulating synaptic membrane exocytosis protein, r | 99.55 | |
| d1w15a_ | 138 | Synaptotagmin IV {Rat (Rattus norvegicus) [TaxId: | 99.52 | |
| d1ugka_ | 138 | Synaptotagmin IV {Human (Homo sapiens) [TaxId: 960 | 99.51 | |
| d2cm5a1 | 137 | C2b-domain of rabphilin {Rat (Rattus norvegicus) [ | 99.5 | |
| d1dqva2 | 145 | Synaptotagmin III {Rat (Rattus norvegicus) [TaxId: | 99.45 | |
| d1ugka_ | 138 | Synaptotagmin IV {Human (Homo sapiens) [TaxId: 960 | 99.44 | |
| d1w15a_ | 138 | Synaptotagmin IV {Rat (Rattus norvegicus) [TaxId: | 99.43 | |
| d2ep6a1 | 126 | Multiple C2 and transmembrane domain-containing pr | 99.43 | |
| d1rlwa_ | 126 | Domain from cytosolic phospholipase A2 {Human (Hom | 99.41 | |
| d1rlwa_ | 126 | Domain from cytosolic phospholipase A2 {Human (Hom | 99.4 | |
| d1uowa_ | 157 | Synaptogamin I {Rat (Rattus norvegicus) [TaxId: 10 | 99.4 | |
| d2ep6a1 | 126 | Multiple C2 and transmembrane domain-containing pr | 99.38 | |
| d1gmia_ | 136 | Domain from protein kinase C epsilon {Rat (Rattus | 99.37 | |
| d1qasa2 | 131 | PI-specific phospholipase C isozyme D1 (PLC-D1), C | 99.36 | |
| d2cjta1 | 128 | Unc-13 homolog A {Rat (Rattus norvegicus) [TaxId: | 99.36 | |
| d2cm5a1 | 137 | C2b-domain of rabphilin {Rat (Rattus norvegicus) [ | 99.35 | |
| d1gmia_ | 136 | Domain from protein kinase C epsilon {Rat (Rattus | 99.34 | |
| d2nq3a1 | 133 | E3 ubiquitin-protein ligase Itchy {Human (Homo sap | 99.31 | |
| d1dqva2 | 145 | Synaptotagmin III {Rat (Rattus norvegicus) [TaxId: | 99.31 | |
| d1qasa2 | 131 | PI-specific phospholipase C isozyme D1 (PLC-D1), C | 99.3 | |
| d2cjta1 | 128 | Unc-13 homolog A {Rat (Rattus norvegicus) [TaxId: | 99.29 | |
| d1wfja_ | 136 | C2 domain protein At1g63220 {Thale cress (Arabidop | 99.27 | |
| d1wfja_ | 136 | C2 domain protein At1g63220 {Thale cress (Arabidop | 99.24 | |
| d2nq3a1 | 133 | E3 ubiquitin-protein ligase Itchy {Human (Homo sap | 99.21 | |
| d1bdya_ | 123 | Domain from protein kinase C delta {Rat (Rattus no | 99.19 | |
| d1bdya_ | 123 | Domain from protein kinase C delta {Rat (Rattus no | 99.12 | |
| d2zkmx2 | 122 | Phospholipase C-beta-2 {Human (Homo sapiens) [TaxI | 98.94 | |
| d2zkmx2 | 122 | Phospholipase C-beta-2 {Human (Homo sapiens) [TaxI | 98.89 | |
| d1e7ua2 | 174 | Phoshoinositide 3-kinase (PI3K) {Pig (Sus scrofa) | 92.42 | |
| d1e7ua2 | 174 | Phoshoinositide 3-kinase (PI3K) {Pig (Sus scrofa) | 91.62 |
| >d1a25a_ b.7.1.2 (A:) C2 domain from protein kinase c (beta) {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
class: All beta proteins fold: C2 domain-like superfamily: C2 domain (Calcium/lipid-binding domain, CaLB) family: Synaptotagmin-like (S variant) domain: C2 domain from protein kinase c (beta) species: Rat (Rattus norvegicus) [TaxId: 10116]
Probab=99.66 E-value=2.3e-17 Score=110.70 Aligned_cols=78 Identities=24% Similarity=0.526 Sum_probs=67.1
Q ss_pred CCccccccCCCCCccccEEEeCccccCCCCcceEEEEEEeCCCCCCCceeEEEEEeCCcCCCCCcCceeeccc--CCCCC
Q psy6192 85 SNLSKTLANTNDPKWNQSFFYPGIRRSDLKLRSIEITVWDYTRYGVNDFLGEVIIELSSSLCTDEPEWFYLTK--HKNSG 162 (174)
Q Consensus 85 ~~kT~~~~~t~~P~wne~~~f~~~~~~~~~~~~l~i~v~d~~~~~~~~~iG~~~l~l~~~~~~~~~~W~~L~~--~~~~~ 162 (174)
+++|+++++|.||+|||.|.|. +...... ..|.|+|||++.++++++||.+.|++.++...+.++||+|.+ +|+..
T Consensus 53 ~~kT~v~~~t~nP~wne~f~f~-v~~~~~~-~~L~i~V~d~d~~~~d~~iG~~~i~l~~l~~~~~~~W~~L~~~~~ge~~ 130 (132)
T d1a25a_ 53 KQKTKTIKCSLNPEWNETFRFQ-LKESDKD-RRLSVEIWDWDLTSRNDFMGSLSFGISELQKAGVDGWFKLLSQEEGEYF 130 (132)
T ss_dssp CEECCCCSSCSSCEEEEEEEEE-CCSGGGG-CEEEEEEEECCSSSCCEEEEEEEEEHHHHTTCCEEEEEECBCHHHHTTC
T ss_pred ccEEeeecCCCCCccceEEEEE-eEccccC-CEEeEEEEecCCCCCCcEeEEEEEeHHHcCCCCCCeEEECCCCCCCccc
Confidence 5789999999999999999998 7654433 679999999999999999999999999987777789999987 66665
Q ss_pred CC
Q psy6192 163 SN 164 (174)
Q Consensus 163 ~~ 164 (174)
|+
T Consensus 131 n~ 132 (132)
T d1a25a_ 131 NV 132 (132)
T ss_dssp CC
T ss_pred CC
Confidence 54
|
| >d1rh8a_ b.7.1.2 (A:) Piccolo {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1wfma_ b.7.1.2 (A:) Synaptotagmin XIII {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1dqva1 b.7.1.2 (A:295-424) Synaptotagmin III {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1wfma_ b.7.1.2 (A:) Synaptotagmin XIII {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2bwqa1 b.7.1.2 (A:729-853) Regulating synaptic membrane exocytosis protein, rim2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1dqva1 b.7.1.2 (A:295-424) Synaptotagmin III {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1uowa_ b.7.1.2 (A:) Synaptogamin I {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1rsya_ b.7.1.2 (A:) Synaptogamin I {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1rsya_ b.7.1.2 (A:) Synaptogamin I {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1a25a_ b.7.1.2 (A:) C2 domain from protein kinase c (beta) {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1rh8a_ b.7.1.2 (A:) Piccolo {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2bwqa1 b.7.1.2 (A:729-853) Regulating synaptic membrane exocytosis protein, rim2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1w15a_ b.7.1.2 (A:) Synaptotagmin IV {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1ugka_ b.7.1.2 (A:) Synaptotagmin IV {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cm5a1 b.7.1.2 (A:541-677) C2b-domain of rabphilin {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1dqva2 b.7.1.2 (A:425-569) Synaptotagmin III {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1ugka_ b.7.1.2 (A:) Synaptotagmin IV {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1w15a_ b.7.1.2 (A:) Synaptotagmin IV {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2ep6a1 b.7.1.1 (A:92-217) Multiple C2 and transmembrane domain-containing protein 2, MCTP2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rlwa_ b.7.1.1 (A:) Domain from cytosolic phospholipase A2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rlwa_ b.7.1.1 (A:) Domain from cytosolic phospholipase A2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uowa_ b.7.1.2 (A:) Synaptogamin I {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2ep6a1 b.7.1.1 (A:92-217) Multiple C2 and transmembrane domain-containing protein 2, MCTP2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1gmia_ b.7.1.1 (A:) Domain from protein kinase C epsilon {Rat (Rattus rattus) [TaxId: 10117]} | Back information, alignment and structure |
|---|
| >d1qasa2 b.7.1.1 (A:626-756) PI-specific phospholipase C isozyme D1 (PLC-D1), C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2cjta1 b.7.1.1 (A:1-128) Unc-13 homolog A {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2cm5a1 b.7.1.2 (A:541-677) C2b-domain of rabphilin {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1gmia_ b.7.1.1 (A:) Domain from protein kinase C epsilon {Rat (Rattus rattus) [TaxId: 10117]} | Back information, alignment and structure |
|---|
| >d2nq3a1 b.7.1.1 (A:13-145) E3 ubiquitin-protein ligase Itchy {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1dqva2 b.7.1.2 (A:425-569) Synaptotagmin III {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1qasa2 b.7.1.1 (A:626-756) PI-specific phospholipase C isozyme D1 (PLC-D1), C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2cjta1 b.7.1.1 (A:1-128) Unc-13 homolog A {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1wfja_ b.7.1.2 (A:) C2 domain protein At1g63220 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1wfja_ b.7.1.2 (A:) C2 domain protein At1g63220 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d2nq3a1 b.7.1.1 (A:13-145) E3 ubiquitin-protein ligase Itchy {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1bdya_ b.7.1.1 (A:) Domain from protein kinase C delta {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1bdya_ b.7.1.1 (A:) Domain from protein kinase C delta {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2zkmx2 b.7.1.1 (X:678-799) Phospholipase C-beta-2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2zkmx2 b.7.1.1 (X:678-799) Phospholipase C-beta-2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|