Diaphorina citri psyllid: psy6198

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-
MYSAAAMGNWEPYQILLRSRVFINKSKGPNISPCGTPISFSWTPTLKGSDSGQLSEFIEGLGPGQVVGRQVLGLPSKGEVQLSLNNVKGCLVVEVIRAKNLQPKPDSKTLP
cccHHHcccccHHHHHHHHccccccccccccccccccccccccccEEccccccHHHHHcccccccEEcCEECcccccccEEEEEEECcccEEEEEEEcccccccccccccc
********NWEPYQILLRSRVFIN*****************WTPTLK*****QLSEFIEGLGPGQVVGRQVLGLPSKGEVQLSLNNVKGCLVVEVIRAKNLQ*********
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MYSAAAMGNWEPYQILLRSRVFINKSKGPNISPCGTPISFSWTPTLKGSDSGQLSEFIEGLGPGQVVGRQVLGLPSKGEVQLSLNNVKGCLVVEVIRAKNLQPKPDSKTLP

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0044325 [MF]ion channel bindingprobableGO:0003674, GO:0005488, GO:0005515
GO:0042391 [BP]regulation of membrane potentialprobableGO:0019725, GO:0050801, GO:0009987, GO:0006873, GO:0048878, GO:0042592, GO:0065007, GO:0044763, GO:0008150, GO:0055082, GO:0065008, GO:0044699
GO:0019904 [MF]protein domain specific bindingprobableGO:0003674, GO:0005488, GO:0005515
GO:0043234 [CC]protein complexprobableGO:0005575, GO:0032991
GO:0019933 [BP]cAMP-mediated signalingprobableGO:0044700, GO:0051716, GO:0008150, GO:0050896, GO:0009987, GO:0050794, GO:0023052, GO:0019935, GO:0065007, GO:0044763, GO:0007165, GO:0019932, GO:0007154, GO:0035556, GO:0050789, GO:0044699
GO:0048791 [BP]calcium ion-dependent exocytosis of neurotransmitterprobableGO:0019226, GO:0007269, GO:0035637, GO:0007268, GO:0032940, GO:0032501, GO:0023052, GO:0001505, GO:0044699, GO:0065007, GO:0065008, GO:0009987, GO:0050877, GO:0003008, GO:0006810, GO:0023061, GO:0044765, GO:0044763, GO:0003001, GO:0051649, GO:0007267, GO:0007154, GO:0051234, GO:0051179, GO:0051641, GO:0044700, GO:0046903, GO:0044707, GO:0008150, GO:0006836
GO:0046982 [MF]protein heterodimerization activityprobableGO:0046983, GO:0003674, GO:0005488, GO:0005515
GO:2000300 [BP]regulation of synaptic vesicle exocytosisprobableGO:0032879, GO:0051046, GO:0060341, GO:0010646, GO:0051049, GO:0065007, GO:0050804, GO:0008150, GO:0031644, GO:0046928, GO:0044057, GO:0051239, GO:0023051, GO:0051588, GO:0051969, GO:0060627, GO:0050789, GO:0050794, GO:0017157
GO:0050806 [BP]positive regulation of synaptic transmissionprobableGO:0044057, GO:0031644, GO:0031646, GO:0051240, GO:0010647, GO:0050804, GO:0023056, GO:0050789, GO:0065007, GO:0051239, GO:0023051, GO:0048518, GO:0008150, GO:0051969, GO:0010646, GO:0051971, GO:0050794, GO:0048522
GO:0048786 [CC]presynaptic active zoneprobableGO:0044464, GO:0005623, GO:0005575, GO:0097458, GO:0044456, GO:0045202
GO:0017156 [BP]calcium ion-dependent exocytosisprobableGO:0046903, GO:0006810, GO:0016192, GO:0006887, GO:0044765, GO:0032940, GO:0044763, GO:0051649, GO:0008150, GO:0009987, GO:0051234, GO:0051179, GO:0044699, GO:0051641
GO:0006461 [BP]protein complex assemblyprobableGO:0022607, GO:0071822, GO:0070271, GO:0043933, GO:0016043, GO:0065003, GO:0044085, GO:0008150, GO:0071840
GO:0042734 [CC]presynaptic membraneprobableGO:0097060, GO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0097458, GO:0044456, GO:0045202

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2Q3X, chain A
Confidence level:very confident
Coverage over the Query: 60-105
View the alignment between query and template
View the model in PyMOL