Diaphorina citri psyllid: psy6201

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220
MEHLRSSPRTPNCRSNNLTQQPEPIITRNGPATYSTPGFLSPPRDIFSVYRDQAASTALHCLLKCYALSLKDKIDVVYAIESRGFLFGPYIGQVLDIPFVPIRKKGKLPGVVERLEYGLEYGTVLDIPFVPIRKKGKLPGVVERLEYGLEYGTDCIEVQKDGGKAGKKALIVDDLIATGASCQLLTTLGVDVVECFAVMELKDLNGRQKVPSKVVSLLEF
ccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHccccccEEEEEccccccHHHHHHHHcccccccccccccccccHHHHcccccccccccccEEEccccccccccEEEEEEEEcccccEEEEEccccccccEEEEEcHHHHHHHHHHHHHHHccEEEEEEEEEEccccccccccccccEEEEEc
*************************ITRNGPATYSTPGFLSPPRDIFSVYRDQAASTALHCLLKCYALSLKDKIDVVYAIESRGFLFGPYIGQVLDIPFVPIRKKGKLPGVVERLEYGLEYGTVLDIPFVPIRKKGKLPGVVERLEYGLEYGTDCIEVQKDGGKAGKKALIVDDLIATGASCQLLTTLGVDVVECFAVMELKDLNGRQKVPSKVVSLLEF
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEHLRSSPRTPNCRSNNLTQQPEPIITRNGPATYSTPGFLSPPRDIFSVYRDQAASTALHCLLKCYALSLKDKIDVVYAIESRGFLFGPYIGQVLDIPFVPIRKKGKLPGVVERLEYGLEYGTVLDIPFVPIRKKGKLPGVVERLEYGLEYGTDCIEVQKDGGKAGKKALIVDDLIATGASCQLLTTLGVDVVECFAVMELKDLNGRQKVPSKVVSLLEF

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Adenine phosphoribosyltransferase Catalyzes a salvage reaction resulting in the formation of AMP, that is energically less costly than de novo synthesis.confidentQ183I0
Adenine phosphoribosyltransferase Catalyzes a salvage reaction resulting in the formation of AMP, that is energically less costly than de novo synthesis.confidentQ8YNI3
Adenine phosphoribosyltransferase Catalyzes a salvage reaction resulting in the formation of AMP, that is energically less costly than de novo synthesis.confidentP36972

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005488 [MF]bindingprobableGO:0003674
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
2.-.-.-Transferases.probable
2.4.-.-Glycosyltransferases.probable
2.4.2.-Pentosyltransferases.probable
2.4.2.7Adenine phosphoribosyltransferase.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1QB7, chain A
Confidence level:very confident
Coverage over the Query: 28-110,141-220
View the alignment between query and template
View the model in PyMOL
Template: 1WD5, chain A
Confidence level:confident
Coverage over the Query: 88-189
View the alignment between query and template
View the model in PyMOL