Psyllid ID: psy6201

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220
MEHLRSSPRTPNCRSNNLTQQPEPIITRNGPATYSTPGFLSPPRDIFSVYRDQAASTALHCLLKCYALSLKDKIDVVYAIESRGFLFGPYIGQVLDIPFVPIRKKGKLPGVVERLEYGLEYGTVLDIPFVPIRKKGKLPGVVERLEYGLEYGTDCIEVQKDGGKAGKKALIVDDLIATGASCQLLTTLGVDVVECFAVMELKDLNGRQKVPSKVVSLLEF
ccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHccccccEEEEEccccccHHHHHHHHcccccccccccccccccHHHHcccccccccccccEEEccccccccccEEEEEEEEcccccEEEEEccccccccEEEEEcHHHHHHHHHHHHHHHccEEEEEEEEEEccccccccccccccEEEEEc
ccccccccccccccccccccHHHHHHHHHcccccccccEEEcccccHHHHccHHHHHHHHHHHHHHHHHccccccEEEEEcccHHHHHHHHHHHHccEEEEEEEcccccccEEEEEHHHHHHHHHccEEEEEEEcccccccEEEEEEEccccEEEEEEEccccccccEEEEEEEEEcccHHHHHHHHcccEEEEEEEEEEcHHcccHHHccccEEEEEEc
mehlrssprtpncrsnnltqqpepiitrngpatystpgflspprdifsVYRDQAASTALHCLLKCYALSLKDKIDVVYAIESrgflfgpyigqvldipfvpirkkgklpgVVERLEYGleygtvldipfvpirkkgklpgVVERLEYGLEYGTDCIEVQKdggkagkkALIVDDLIATGASCQLLTTLGVDVVECFAVMElkdlngrqkvpSKVVSLLEF
mehlrssprtpncrsnnltqqpepiitrngpATYSTPGFLSPPRDIFSVYRDQAASTALHCLLKCYALSLKDKIDVVYAIESRGFLFGPYIGQVLDIPFVPIRKKGKLPGVVERLEYGLEygtvldipfvpirkkgklPGVVERLEYGLEYGTDCIEVQKDGGKAGKKALIVDDLIATGASCQLLTTLGVDVVECFAVMelkdlngrqkvpskvvsllef
MEHLRSSPRTPNCRSNNLTQQPEPIITRNGPATYSTPGFLSPPRDIFSVYRDQAASTALHCLLKCYALSLKDKIDVVYAIESRGFLFGPYIGQVLDIPFVPIRKKGKLPGVVERLEYGLEYGTVLDIPFVPIRKKGKLPGVVERLEYGLEYGTDCIEVQKDGGKAGKKALIVDDLIATGASCQLLTTLGVDVVECFAVMELKDLNGRQKVPSKVVSLLEF
*************************************GFLSPPRDIFSVYRDQAASTALHCLLKCYALSLKDKIDVVYAIESRGFLFGPYIGQVLDIPFVPIRKKGKLPGVVERLEYGLEYGTVLDIPFVPIRKKGKLPGVVERLEYGLEYGTDCIEVQKDGGKAGKKALIVDDLIATGASCQLLTTLGVDVVECFAVMELKDLN***************
*************************ITRNGPATYSTPGFLSPPRDIFSVYRDQAASTALHCLLKCYALSLKDKIDVVYAIESRGFLFGPYIGQVLDIPFVPIRKKGKLPGVVERLEYGLEYGTVLDIPFVPIRKKGKLPGVVERLEYGLEYGTDCIEVQKDGGKAGKKALIVDDLIATGASCQLLTTLGVDVVECFAVMELKDLNGRQKVPSKVVSLLEF
***************NNLTQQPEPIITRNGPATYSTPGFLSPPRDIFSVYRDQAASTALHCLLKCYALSLKDKIDVVYAIESRGFLFGPYIGQVLDIPFVPIRKKGKLPGVVERLEYGLEYGTVLDIPFVPIRKKGKLPGVVERLEYGLEYGTDCIEVQKDGGKAGKKALIVDDLIATGASCQLLTTLGVDVVECFAVMELKDLNGRQKVPSKVVSLLEF
*****************LTQQPEPIITRNGPATYSTPGFLSPPRDIFSVYRDQAASTALHCLLKCYALSLKDKIDVVYAIESRGFLFGPYIGQVLDIPFVPIRKKGKLPGVVERLEYGLEYGTVLDIPFVPIRKKGKLPGVVERLEYGLEYGTDCIEVQKDGGKAGKKALIVDDLIATGASCQLLTTLGVDVVECFAVMELKDLNGRQKVPSKVVSLLEF
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEHLRSSPRTPNCRSNNLTQQPEPIITRNGPATYSTPGFLSPPRDIFSVYRDQAASTALHCLLKCYALSLKDKIDVVYAIESRGFLFGPYIGQVLDIPFVPIRKKGKLPGVVERLEYGLEYGTVLDIPFVPIRKKGKLPGVVERLEYGLEYGTDCIEVQKDGGKAGKKALIVDDLIATGASCQLLTTLGVDVVECFAVMELKDLNGRQKVPSKVVSLLEF
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query220 2.2.26 [Sep-21-2011]
Q3MAA1172 Adenine phosphoribosyltra yes N/A 0.695 0.889 0.376 2e-21
Q8YNI3172 Adenine phosphoribosyltra yes N/A 0.695 0.889 0.376 7e-21
Q183I0170 Adenine phosphoribosyltra yes N/A 0.654 0.847 0.382 2e-20
B2IU50172 Adenine phosphoribosyltra yes N/A 0.704 0.901 0.364 2e-20
P54363181 Adenine phosphoribosyltra yes N/A 0.668 0.812 0.364 3e-20
Q64427180 Adenine phosphoribosyltra N/A N/A 0.704 0.861 0.373 5e-20
P47958180 Adenine phosphoribosyltra N/A N/A 0.668 0.816 0.366 5e-20
P47952180 Adenine phosphoribosyltra yes N/A 0.704 0.861 0.378 7e-20
P36972180 Adenine phosphoribosyltra yes N/A 0.704 0.861 0.378 7e-20
P07741180 Adenine phosphoribosyltra yes N/A 0.704 0.861 0.357 9e-20
>sp|Q3MAA1|APT_ANAVT Adenine phosphoribosyltransferase OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=apt PE=3 SV=1 Back     alignment and function desciption
 Score =  102 bits (253), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 73/194 (37%), Positives = 102/194 (52%), Gaps = 41/194 (21%)

Query: 34  YSTPGFLSPPRDIFSVYRD-QAASTALHCLL-KCYALSLKDKIDVVYAIESRGFLFGPYI 91
           +  PG L   RDI ++ RD Q     +  L  KC+  +L   ID V  +ESRGF+FG   
Sbjct: 13  FPKPGILF--RDITTLLRDRQGLRYTIDFLAEKCFEANLD--IDYVIGMESRGFIFG--- 65

Query: 92  GQVLDIPFVPIRKKGKLPGVVERLEYGLEYGTVLDIPFVPIRKKGKLPGVVERLEYGLEY 151
                                  L Y L  G      F+P+RKKGKLP  V  +EY LEY
Sbjct: 66  ---------------------TPLAYKLGAG------FIPVRKKGKLPAAVHSIEYELEY 98

Query: 152 GTDCIEVQKDGGKAGKKALIVDDLIATG----ASCQLLTTLGVDVVECFAVMELKDLNGR 207
           GTDC+EV +D      + LIVDDLIATG    A+ +L+  +G ++V    ++EL+DL GR
Sbjct: 99  GTDCLEVHRDALHPDSRVLIVDDLIATGGTASATAKLVQQIGCELVGFGFIIELRDLQGR 158

Query: 208 QKVPS-KVVSLLEF 220
           + +P   ++SL+E+
Sbjct: 159 KHLPDVPIISLVEY 172
Catalyzes a salvage reaction resulting in the formation of AMP, that is energically less costly than de novo synthesis.
Anabaena variabilis (strain ATCC 29413 / PCC 7937) (taxid: 240292)
EC: 2EC: .EC: 4EC: .EC: 2EC: .EC: 7
>sp|Q8YNI3|APT_NOSS1 Adenine phosphoribosyltransferase OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=apt PE=3 SV=1 Back     alignment and function description
>sp|Q183I0|APT_CLOD6 Adenine phosphoribosyltransferase OS=Clostridium difficile (strain 630) GN=apt PE=3 SV=1 Back     alignment and function description
>sp|B2IU50|APT_NOSP7 Adenine phosphoribosyltransferase OS=Nostoc punctiforme (strain ATCC 29133 / PCC 73102) GN=apt PE=3 SV=1 Back     alignment and function description
>sp|P54363|APT_DROPS Adenine phosphoribosyltransferase OS=Drosophila pseudoobscura pseudoobscura GN=Aprt PE=3 SV=1 Back     alignment and function description
>sp|Q64427|APT_MASHI Adenine phosphoribosyltransferase OS=Mastomys hildebrandtii GN=APRT PE=3 SV=1 Back     alignment and function description
>sp|P47958|APT_STOLO Adenine phosphoribosyltransferase OS=Stochomys longicaudatus GN=APRT PE=3 SV=1 Back     alignment and function description
>sp|P47952|APT_CRIGR Adenine phosphoribosyltransferase OS=Cricetulus griseus GN=APRT PE=3 SV=2 Back     alignment and function description
>sp|P36972|APT_RAT Adenine phosphoribosyltransferase OS=Rattus norvegicus GN=Aprt PE=1 SV=1 Back     alignment and function description
>sp|P07741|APT_HUMAN Adenine phosphoribosyltransferase OS=Homo sapiens GN=APRT PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query220
156545545177 PREDICTED: adenine phosphoribosyltransfe 0.695 0.864 0.418 1e-26
307194647177 Adenine phosphoribosyltransferase [Harpe 0.731 0.909 0.400 1e-24
239789040181 ACYPI003436 [Acyrthosiphon pisum] 0.704 0.856 0.371 1e-24
443682398157 hypothetical protein CAPTEDRAFT_120164, 0.668 0.936 0.364 4e-24
383865605177 PREDICTED: adenine phosphoribosyltransfe 0.731 0.909 0.381 5e-24
320165065183 adenine phosphoribosyltransferase [Capsa 0.704 0.846 0.371 5e-24
91086121179 PREDICTED: similar to adenine phosphorib 0.704 0.865 0.356 6e-24
72048560183 PREDICTED: adenine phosphoribosyltransfe 0.704 0.846 0.406 6e-24
193676624181 PREDICTED: adenine phosphoribosyltransfe 0.704 0.856 0.366 1e-23
332021884178 Adenine phosphoribosyltransferase [Acrom 0.731 0.904 0.391 3e-23
>gi|156545545|ref|XP_001604748.1| PREDICTED: adenine phosphoribosyltransferase-like [Nasonia vitripennis] Back     alignment and taxonomy information
 Score =  125 bits (315), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 80/191 (41%), Positives = 102/191 (53%), Gaps = 38/191 (19%)

Query: 34  YSTPGFLSPPRDIFSVYRDQAASTALHCLLKCYALSLKDKIDVVYAIESRGFLFGPYIGQ 93
           +  PG L   RDIF ++++ AA+ A+  L+  +   L   ID V  ++SRGFL GP I  
Sbjct: 20  FPKPGILF--RDIFGIFKNVAATKAMKDLMVEHVALLD--IDFVVGLDSRGFLLGPVIS- 74

Query: 94  VLDIPFVPIRKKGKLPGVVERLEYGLEYGTVLDIPFVPIRKKGKLPGVVERLEYGLEYGT 153
                                    LE       PFVPIRKKGKLPG V +  Y LEYG 
Sbjct: 75  -------------------------LELAK----PFVPIRKKGKLPGKVFQQSYTLEYGE 105

Query: 154 DCIEVQKDGGKAGKKALIVDDLIATGASC----QLLTTLGVDVVECFAVMELKDLNGRQK 209
           D  E+Q D  +  KKALIVDDL+ATG S      LL   GV VVEC  +MELK LNGR K
Sbjct: 106 DVFEIQADSVQGNKKALIVDDLLATGGSMSAAENLLKKAGVTVVECLVIMELKSLNGRAK 165

Query: 210 VPSKVVSLLEF 220
           + + + +LL++
Sbjct: 166 IEAPIHALLQY 176

Source: Nasonia vitripennis

Species: Nasonia vitripennis

Genus: Nasonia

Family: Pteromalidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|307194647|gb|EFN76926.1| Adenine phosphoribosyltransferase [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|239789040|dbj|BAH71169.1| ACYPI003436 [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|443682398|gb|ELT87011.1| hypothetical protein CAPTEDRAFT_120164, partial [Capitella teleta] Back     alignment and taxonomy information
>gi|383865605|ref|XP_003708263.1| PREDICTED: adenine phosphoribosyltransferase-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|320165065|gb|EFW41964.1| adenine phosphoribosyltransferase [Capsaspora owczarzaki ATCC 30864] Back     alignment and taxonomy information
>gi|91086121|ref|XP_968297.1| PREDICTED: similar to adenine phosphoribosyltransferase [Tribolium castaneum] gi|270010221|gb|EFA06669.1| hypothetical protein TcasGA2_TC009597 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|72048560|ref|XP_788872.1| PREDICTED: adenine phosphoribosyltransferase-like [Strongylocentrotus purpuratus] Back     alignment and taxonomy information
>gi|193676624|ref|XP_001945850.1| PREDICTED: adenine phosphoribosyltransferase-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|332021884|gb|EGI62220.1| Adenine phosphoribosyltransferase [Acromyrmex echinatior] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query220
RGD|1307758180 Aprt "adenine phosphoribosyl t 0.472 0.577 0.449 4.6e-18
UNIPROTKB|P36972180 Aprt "Adenine phosphoribosyltr 0.472 0.577 0.449 4.6e-18
FB|FBgn0000109182 Aprt "Adenine phosphoribosyltr 0.472 0.571 0.462 5.8e-18
TAIR|locus:2127480183 APT3 "adenine phosphoribosyl t 0.677 0.814 0.375 1.6e-17
ZFIN|ZDB-GENE-040426-1492177 aprt "adenine phosphoribosyl t 0.436 0.542 0.465 8.6e-17
MGI|MGI:88061180 Aprt "adenine phosphoribosyl t 0.472 0.577 0.431 8.6e-17
TAIR|locus:2135550182 APT4 "adenine phosphoribosyl t 0.677 0.818 0.357 1.1e-16
WB|WBGene00020557185 T19B4.3 [Caenorhabditis elegan 0.472 0.562 0.412 1.4e-16
UNIPROTKB|P07741180 APRT "Adenine phosphoribosyltr 0.472 0.577 0.422 1.4e-16
TAIR|locus:2016309192 APT2 "adenine phosphoribosyl t 0.463 0.531 0.433 1.4e-16
RGD|1307758 Aprt "adenine phosphoribosyl transferase" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
 Score = 219 (82.2 bits), Expect = 4.6e-18, P = 4.6e-18
 Identities = 49/109 (44%), Positives = 69/109 (63%)

Query:   117 YGLEYGTVLDIPFVPIRKKGKLPGVVERLEYGLEYGTDCIEVQKDGGKAGKKALIVDDLI 176
             +G      L +  V IRK+GKLPG      Y LEYG   +E+QKD  + G+K +IVDDL+
Sbjct:    71 FGPSLAQELGVGCVLIRKRGKLPGPTVSASYSLEYGKAELEIQKDALEPGQKVVIVDDLL 130

Query:   177 ATG----ASCQLLTTLGVDVVECFAVMELKDLNGRQKV-PSKVVSLLEF 220
             ATG    A+C+LL+ L  +VVEC +++EL  L GR+K+ P    SLL++
Sbjct:   131 ATGGTMCAACELLSQLRAEVVECVSLVELTSLKGREKLGPVPFFSLLQY 179
GO:0002055 "adenine binding" evidence=IEA;ISO
GO:0003999 "adenine phosphoribosyltransferase activity" evidence=IEA;ISO
GO:0005575 "cellular_component" evidence=ND
GO:0005634 "nucleus" evidence=IEA;ISO
GO:0005737 "cytoplasm" evidence=IEA;ISO
GO:0006166 "purine ribonucleoside salvage" evidence=IEA;ISO
GO:0006168 "adenine salvage" evidence=IEA;ISO
GO:0007595 "lactation" evidence=IDA
GO:0007625 "grooming behavior" evidence=IEA;ISO
GO:0008152 "metabolic process" evidence=ISO
GO:0016208 "AMP binding" evidence=ISO;IDA
GO:0032869 "cellular response to insulin stimulus" evidence=IEP
GO:0044209 "AMP salvage" evidence=IEA
GO:0046083 "adenine metabolic process" evidence=ISO
GO:0005730 "nucleolus" evidence=ISO
UNIPROTKB|P36972 Aprt "Adenine phosphoribosyltransferase" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
FB|FBgn0000109 Aprt "Adenine phosphoribosyltransferase" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
TAIR|locus:2127480 APT3 "adenine phosphoribosyl transferase 3" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040426-1492 aprt "adenine phosphoribosyl transferase" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
MGI|MGI:88061 Aprt "adenine phosphoribosyl transferase" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
TAIR|locus:2135550 APT4 "adenine phosphoribosyl transferase 4" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
WB|WBGene00020557 T19B4.3 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
UNIPROTKB|P07741 APRT "Adenine phosphoribosyltransferase" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
TAIR|locus:2016309 APT2 "adenine phosphoribosyl transferase 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q183I0APT_CLOD62, ., 4, ., 2, ., 70.38250.65450.8470yesN/A
Q8YNI3APT_NOSS12, ., 4, ., 2, ., 70.37620.69540.8895yesN/A
Q92N62APT_RHIME2, ., 4, ., 2, ., 70.33840.69090.8444yesN/A
A0PZW4APT_CLONN2, ., 4, ., 2, ., 70.35510.65450.8372yesN/A
B2IU50APT_NOSP72, ., 4, ., 2, ., 70.36450.70450.9011yesN/A
P36972APT_RAT2, ., 4, ., 2, ., 70.37820.70450.8611yesN/A
Q11GC0APT_MESSB2, ., 4, ., 2, ., 70.35440.67720.8232yesN/A
Q60AN2APT_METCA2, ., 4, ., 2, ., 70.34190.69090.8888yesN/A
Q56JW4APT_BOVIN2, ., 4, ., 2, ., 70.34530.70900.8666yesN/A
Q5LNY7APT_RUEPO2, ., 4, ., 2, ., 70.33330.61810.7597yesN/A
A1UZL8APT_BURMS2, ., 4, ., 2, ., 70.32160.70.7475yesN/A
A5GLQ5APT_SYNPW2, ., 4, ., 2, ., 70.35130.66810.8546yesN/A
P12426APT_DROME2, ., 4, ., 2, ., 70.36460.66810.8076yesN/A
Q5HUN2APT_CAMJR2, ., 4, ., 2, ., 70.37290.650.7857yesN/A
A8ZWU1APT_DESOH2, ., 4, ., 2, ., 70.35160.65900.8381yesN/A
Q3MAA1APT_ANAVT2, ., 4, ., 2, ., 70.37620.69540.8895yesN/A
P07741APT_HUMAN2, ., 4, ., 2, ., 70.35750.70450.8611yesN/A
P91455APT_CAEEL2, ., 4, ., 2, ., 70.32940.63180.7513yesN/A
Q2IS06APT_RHOP22, ., 4, ., 2, ., 70.35890.69090.8397yesN/A
A5G4S5APT_GEOUR2, ., 4, ., 2, ., 70.34610.65900.8479yesN/A
P08030APT_MOUSE2, ., 4, ., 2, ., 70.36780.70450.8611yesN/A
A8FLX6APT_CAMJ82, ., 4, ., 2, ., 70.37290.650.7857yesN/A
Q1MDK6APT_RHIL32, ., 4, ., 2, ., 70.34870.69090.8444yesN/A
Q98HV0APT_RHILO2, ., 4, ., 2, ., 70.36410.65450.7955yesN/A
A1VZR0APT_CAMJJ2, ., 4, ., 2, ., 70.37290.650.7857yesN/A
Q8UD91APT_AGRT52, ., 4, ., 2, ., 70.34350.69090.8444yesN/A
P54363APT_DROPS2, ., 4, ., 2, ., 70.36460.66810.8121yesN/A
B5ZY62APT_RHILW2, ., 4, ., 2, ., 70.34870.69090.8397yesN/A
Q130R0APT_RHOPS2, ., 4, ., 2, ., 70.35890.69090.8397yesN/A
P47952APT_CRIGR2, ., 4, ., 2, ., 70.37820.70450.8611yesN/A
A7H3C4APT_CAMJD2, ., 4, ., 2, ., 70.37290.650.7857yesN/A
A9WCV7APT_CHLAA2, ., 4, ., 2, ., 70.32530.75900.9653yesN/A

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer2.4.20.766
4th Layer2.4.2.70.824

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query220
PRK02304175 PRK02304, PRK02304, adenine phosphoribosyltransfer 1e-42
TIGR01090169 TIGR01090, apt, adenine phosphoribosyltransferase 3e-38
PLN02293187 PLN02293, PLN02293, adenine phosphoribosyltransfer 1e-33
COG0503179 COG0503, Apt, Adenine/guanine phosphoribosyltransf 1e-27
cd06223130 cd06223, PRTases_typeI, Phosphoribosyl transferase 3e-14
PRK12560187 PRK12560, PRK12560, adenine phosphoribosyltransfer 3e-10
pfam00156123 pfam00156, Pribosyltran, Phosphoribosyl transferas 5e-07
>gnl|CDD|235028 PRK02304, PRK02304, adenine phosphoribosyltransferase; Provisional Back     alignment and domain information 
 Score =  141 bits (359), Expect = 1e-42
 Identities = 68/183 (37%), Positives = 90/183 (49%), Gaps = 39/183 (21%)

Query: 44  RDIFSVYRDQAA-STALHCLLKCYALSLKDKIDVVYAIESRGFLFGPYIGQVLDIPFVPI 102
           RDI  +  D  A    +  L++ Y       ID +  IE+RGF+FG  +   L I FVP+
Sbjct: 24  RDITPLLADPEAFREVIDALVERYK---DADIDKIVGIEARGFIFGAALAYKLGIGFVPV 80

Query: 103 RKKGKLPGVVERLEYGLEYGTVLDIPFVPIRKKGKLPGVVERLEYGLEYGTDCIEVQKDG 162
           RK GKLP             T+                      Y LEYGTD +E+ KD 
Sbjct: 81  RKPGKLPR-----------ETI-------------------SESYELEYGTDTLEIHKDA 110

Query: 163 GKAGKKALIVDDLIATG----ASCQLLTTLGVDVVECFAVMELKDLNGRQKVPS-KVVSL 217
            K G + LIVDDL+ATG    A+ +LL  LG +VV    V+EL DL GR+K+    V SL
Sbjct: 111 IKPGDRVLIVDDLLATGGTLEAAIKLLERLGAEVVGAAFVIELPDLGGREKLEGYPVKSL 170

Query: 218 LEF 220
           ++F
Sbjct: 171 VKF 173

Length = 175
>gnl|CDD|233267 TIGR01090, apt, adenine phosphoribosyltransferase Back     alignment and domain information
>gnl|CDD|177930 PLN02293, PLN02293, adenine phosphoribosyltransferase Back     alignment and domain information
>gnl|CDD|223577 COG0503, Apt, Adenine/guanine phosphoribosyltransferases and related PRPP-binding proteins [Nucleotide transport and metabolism] Back     alignment and domain information
>gnl|CDD|206754 cd06223, PRTases_typeI, Phosphoribosyl transferase (PRT)-type I domain Back     alignment and domain information
>gnl|CDD|183595 PRK12560, PRK12560, adenine phosphoribosyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|215757 pfam00156, Pribosyltran, Phosphoribosyl transferase domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 220
KOG1712|consensus183 100.0
PLN02293187 adenine phosphoribosyltransferase 99.97
COG0503179 Apt Adenine/guanine phosphoribosyltransferases and 99.97
PRK13810187 orotate phosphoribosyltransferase; Provisional 99.96
PRK02304175 adenine phosphoribosyltransferase; Provisional 99.95
PRK09219189 xanthine phosphoribosyltransferase; Validated 99.95
TIGR01744191 XPRTase xanthine phosphoribosyltransferase. This m 99.95
TIGR01090169 apt adenine phosphoribosyltransferase. A phylogene 99.95
PRK12560187 adenine phosphoribosyltransferase; Provisional 99.94
PRK13809206 orotate phosphoribosyltransferase; Provisional 99.94
TIGR01743268 purR_Bsub pur operon repressor, Bacillus subtilis 99.94
PRK05500477 bifunctional orotidine 5'-phosphate decarboxylase/ 99.93
PRK09213271 pur operon repressor; Provisional 99.93
PRK13812176 orotate phosphoribosyltransferase; Provisional 99.93
COG0461201 PyrE Orotate phosphoribosyltransferase [Nucleotide 99.93
TIGR00336173 pyrE orotate phosphoribosyltransferase. The conser 99.92
PRK13811170 orotate phosphoribosyltransferase; Provisional 99.92
PRK08558238 adenine phosphoribosyltransferase; Provisional 99.91
PRK00455202 pyrE orotate phosphoribosyltransferase; Validated 99.9
TIGR01367187 pyrE_Therm orotate phosphoribosyltransferase, Ther 99.89
PRK02277200 orotate phosphoribosyltransferase-like protein; Pr 99.85
PRK07322178 adenine phosphoribosyltransferase; Provisional 99.82
PRK06031233 phosphoribosyltransferase; Provisional 99.8
COG0856203 Orotate phosphoribosyltransferase homologs [Nucleo 99.79
PF00156125 Pribosyltran: Phosphoribosyl transferase domain; I 99.68
PRK09177156 xanthine-guanine phosphoribosyltransferase; Valida 99.27
PLN02238189 hypoxanthine phosphoribosyltransferase 99.18
PRK09162181 hypoxanthine-guanine phosphoribosyltransferase; Pr 99.15
TIGR01203166 HGPRTase hypoxanthine phosphoribosyltransferase. S 99.1
COG2236192 Predicted phosphoribosyltransferases [General func 99.03
PRK00934285 ribose-phosphate pyrophosphokinase; Provisional 99.0
COG1926220 Predicted phosphoribosyltransferases [General func 98.99
PRK15423178 hypoxanthine phosphoribosyltransferase; Provisiona 98.97
PRK07199301 phosphoribosylpyrophosphate synthetase; Provisiona 98.93
PRK01259309 ribose-phosphate pyrophosphokinase; Provisional 98.93
PRK05205176 bifunctional pyrimidine regulatory protein PyrR ur 98.89
PRK02269320 ribose-phosphate pyrophosphokinase; Provisional 98.83
TIGR01251308 ribP_PPkin ribose-phosphate pyrophosphokinase. In 98.82
PRK07349500 amidophosphoribosyltransferase; Provisional 98.79
PTZ00271211 hypoxanthine-guanine phosphoribosyltransferase; Pr 98.78
PRK08525445 amidophosphoribosyltransferase; Provisional 98.74
PRK00553332 ribose-phosphate pyrophosphokinase; Provisional 98.73
PRK09123479 amidophosphoribosyltransferase; Provisional 98.66
PRK06781471 amidophosphoribosyltransferase; Provisional 98.65
PRK05793469 amidophosphoribosyltransferase; Provisional 98.63
PTZ00149241 hypoxanthine phosphoribosyltransferase; Provisiona 98.63
PRK06827382 phosphoribosylpyrophosphate synthetase; Provisiona 98.62
PRK04923319 ribose-phosphate pyrophosphokinase; Provisional 98.58
PRK02458323 ribose-phosphate pyrophosphokinase; Provisional 98.53
PLN02440479 amidophosphoribosyltransferase 98.52
TIGR01134442 purF amidophosphoribosyltransferase. Alternate nam 98.51
COG0634178 Hpt Hypoxanthine-guanine phosphoribosyltransferase 98.47
PRK08341442 amidophosphoribosyltransferase; Provisional 98.46
PRK03092304 ribose-phosphate pyrophosphokinase; Provisional 98.44
COG0462314 PrsA Phosphoribosylpyrophosphate synthetase [Nucle 98.43
PLN02369302 ribose-phosphate pyrophosphokinase 98.42
PRK07272484 amidophosphoribosyltransferase; Provisional 98.42
PRK06388474 amidophosphoribosyltransferase; Provisional 98.41
PRK02812330 ribose-phosphate pyrophosphokinase; Provisional 98.39
PRK07631475 amidophosphoribosyltransferase; Provisional 98.38
PRK09246501 amidophosphoribosyltransferase; Provisional 98.38
TIGR00201190 comF comF family protein. This protein is found in 98.36
PRK07847510 amidophosphoribosyltransferase; Provisional 98.31
PRK11595227 DNA utilization protein GntX; Provisional 98.16
PLN02297326 ribose-phosphate pyrophosphokinase 98.14
PTZ00145439 phosphoribosylpyrophosphate synthetase; Provisiona 98.06
COG1040225 ComFC Predicted amidophosphoribosyltransferases [G 98.05
COG2065179 PyrR Pyrimidine operon attenuation protein/uracil 97.91
COG0034470 PurF Glutamine phosphoribosylpyrophosphate amidotr 97.85
PRK00129209 upp uracil phosphoribosyltransferase; Reviewed 97.72
TIGR01091207 upp uracil phosphoribosyltransferase. that include 97.53
PF14572184 Pribosyl_synth: Phosphoribosyl synthetase-associat 97.52
PF15609191 PRTase_2: Phosphoribosyl transferase 97.34
KOG3367|consensus216 96.94
KOG0572|consensus474 96.72
KOG1377|consensus261 96.5
PLN02541244 uracil phosphoribosyltransferase 95.76
KOG1448|consensus316 95.49
KOG1712|consensus183 90.24
PF14681207 UPRTase: Uracil phosphoribosyltransferase; PDB: 1V 85.37
>KOG1712|consensus Back     alignment and domain information 
Probab=100.00  E-value=3.1e-36  Score=246.99  Aligned_cols=161  Identities=43%  Similarity=0.657  Sum_probs=154.7

Q ss_pred             cCCCCcccCCCcccCceeccCCCCCHHHHHHHHHHHHHHHhhcC-CCccEEEeecccCcchHHHHhhhcCCCeEEEeeCC
Q psy6201          28 RNGPATYSTPGFLSPPRDIFSVYRDQAASTALHCLLKCYALSLK-DKIDVVYAIESRGFLFGPYIGQVLDIPFVPIRKKG  106 (220)
Q Consensus        28 ~~~~~~~~~~G~~s~~~D~~~~l~~p~~~~~l~~~la~~~~~~~-~~~D~Ivgie~~Gi~la~~lA~~lg~p~V~vRK~~  106 (220)
                      -|.+||||+.|+.  |.|+..++.||..|..+.+.+++++++.. .++|+|+|+|++|+.+|..+|.++|++||++||.+
T Consensus        15 ir~~pdFPk~GI~--F~Di~pll~dP~af~~lidlf~~h~~~~~~~~Id~iaGlEaRGFLFGP~iAlalG~~fVPiRK~g   92 (183)
T KOG1712|consen   15 IRVVPDFPKKGIM--FQDITPLLLDPKAFKKLIDLFVDHYRETFEMKIDVIAGLEARGFLFGPSIALALGAGFVPIRKPG   92 (183)
T ss_pred             heeCCCCCCCcee--hhhhhhhhcCHHHHHHHHHHHHHHHHHHhcCcceEEEeeeecceecCcHHHHHhCCCeeecccCC
Confidence            6899999999999  99999999999999999999999999742 46999999999999999999999999999999999


Q ss_pred             CCCCchhhhhhccccceeccCCccccccCCCCCceeeeeeeeeeeeceEEEEecCCCCCCCEEEEEecccCCC----hHH
Q psy6201         107 KLPGVVERLEYGLEYGTVLDIPFVPIRKKGKLPGVVERLEYGLEYGTDCIEVQKDGGKAGKKALIVDDLIATG----ASC  182 (220)
Q Consensus       107 k~~g~~~~~~~~~~~~~v~~~~~~~~~~~~~~~~~~~~~~~~~~y~~~~le~~~~~l~~G~rVLIVDDvi~TG----a~i  182 (220)
                      |+||                              ++.+.+|+.+||++.+|++.+++.+|+||+||||+++||    ++.
T Consensus        93 KLPG------------------------------~~i~~~Y~lEYg~d~~Emq~~Ai~~g~rvvvVDDllATGGTl~AA~  142 (183)
T KOG1712|consen   93 KLPG------------------------------EVISESYELEYGEDRFEMQKGAIKPGQRVVVVDDLLATGGTLAAAT  142 (183)
T ss_pred             CCCC------------------------------ceeEEEEeeecCccceeeeccccCCCCeEEEEechhhcCccHHHHH
Confidence            9999                              888999999999999999999999999999999999999    889


Q ss_pred             HHHHhcCCeEEEEEEEEEecCcCCceeec-eeeEEeeeC
Q psy6201         183 QLLTTLGVDVVECFAVMELKDLNGRQKVP-SKVVSLLEF  220 (220)
Q Consensus       183 ~ll~~~Ga~v~~v~vli~~~~~~g~~~l~-~~v~sL~~~  220 (220)
                      +|+++.||+|+.++|+++..++.|+++|. .|++||++|
T Consensus       143 ~Ll~r~ga~vvE~~~vieL~~LkGr~kL~~~pl~~Ll~~  181 (183)
T KOG1712|consen  143 ELLERVGAEVVECACVIELPELKGREKLKGKPLFSLLEY  181 (183)
T ss_pred             HHHHHhccEEEEEEEEEEccccCCccccCCCccEEEeec
Confidence            99999999999999999999999999999 899999986

>PLN02293 adenine phosphoribosyltransferase Back     alignment and domain information
>COG0503 Apt Adenine/guanine phosphoribosyltransferases and related PRPP-binding proteins [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK13810 orotate phosphoribosyltransferase; Provisional Back     alignment and domain information
>PRK02304 adenine phosphoribosyltransferase; Provisional Back     alignment and domain information
>PRK09219 xanthine phosphoribosyltransferase; Validated Back     alignment and domain information
>TIGR01744 XPRTase xanthine phosphoribosyltransferase Back     alignment and domain information
>TIGR01090 apt adenine phosphoribosyltransferase Back     alignment and domain information
>PRK12560 adenine phosphoribosyltransferase; Provisional Back     alignment and domain information
>PRK13809 orotate phosphoribosyltransferase; Provisional Back     alignment and domain information
>TIGR01743 purR_Bsub pur operon repressor, Bacillus subtilis type Back     alignment and domain information
>PRK05500 bifunctional orotidine 5'-phosphate decarboxylase/orotate phosphoribosyltransferase protein; Validated Back     alignment and domain information
>PRK09213 pur operon repressor; Provisional Back     alignment and domain information
>PRK13812 orotate phosphoribosyltransferase; Provisional Back     alignment and domain information
>COG0461 PyrE Orotate phosphoribosyltransferase [Nucleotide transport and metabolism] Back     alignment and domain information
>TIGR00336 pyrE orotate phosphoribosyltransferase Back     alignment and domain information
>PRK13811 orotate phosphoribosyltransferase; Provisional Back     alignment and domain information
>PRK08558 adenine phosphoribosyltransferase; Provisional Back     alignment and domain information
>PRK00455 pyrE orotate phosphoribosyltransferase; Validated Back     alignment and domain information
>TIGR01367 pyrE_Therm orotate phosphoribosyltransferase, Thermus family Back     alignment and domain information
>PRK02277 orotate phosphoribosyltransferase-like protein; Provisional Back     alignment and domain information
>PRK07322 adenine phosphoribosyltransferase; Provisional Back     alignment and domain information
>PRK06031 phosphoribosyltransferase; Provisional Back     alignment and domain information
>COG0856 Orotate phosphoribosyltransferase homologs [Nucleotide transport and metabolism] Back     alignment and domain information
>PF00156 Pribosyltran: Phosphoribosyl transferase domain; InterPro: IPR000836 The name PRT comes from phosphoribosyltransferase (PRTase) enzymes, which carry out phosphoryl transfer reactions on 5-phosphoribosyl-alpha1-pyrophosphate PRPP, an activated form of ribose-5-phosphate Back     alignment and domain information
>PRK09177 xanthine-guanine phosphoribosyltransferase; Validated Back     alignment and domain information
>PLN02238 hypoxanthine phosphoribosyltransferase Back     alignment and domain information
>PRK09162 hypoxanthine-guanine phosphoribosyltransferase; Provisional Back     alignment and domain information
>TIGR01203 HGPRTase hypoxanthine phosphoribosyltransferase Back     alignment and domain information
>COG2236 Predicted phosphoribosyltransferases [General function prediction only] Back     alignment and domain information
>PRK00934 ribose-phosphate pyrophosphokinase; Provisional Back     alignment and domain information
>COG1926 Predicted phosphoribosyltransferases [General function prediction only] Back     alignment and domain information
>PRK15423 hypoxanthine phosphoribosyltransferase; Provisional Back     alignment and domain information
>PRK07199 phosphoribosylpyrophosphate synthetase; Provisional Back     alignment and domain information
>PRK01259 ribose-phosphate pyrophosphokinase; Provisional Back     alignment and domain information
>PRK05205 bifunctional pyrimidine regulatory protein PyrR uracil phosphoribosyltransferase; Provisional Back     alignment and domain information
>PRK02269 ribose-phosphate pyrophosphokinase; Provisional Back     alignment and domain information
>TIGR01251 ribP_PPkin ribose-phosphate pyrophosphokinase Back     alignment and domain information
>PRK07349 amidophosphoribosyltransferase; Provisional Back     alignment and domain information
>PTZ00271 hypoxanthine-guanine phosphoribosyltransferase; Provisional Back     alignment and domain information
>PRK08525 amidophosphoribosyltransferase; Provisional Back     alignment and domain information
>PRK00553 ribose-phosphate pyrophosphokinase; Provisional Back     alignment and domain information
>PRK09123 amidophosphoribosyltransferase; Provisional Back     alignment and domain information
>PRK06781 amidophosphoribosyltransferase; Provisional Back     alignment and domain information
>PRK05793 amidophosphoribosyltransferase; Provisional Back     alignment and domain information
>PTZ00149 hypoxanthine phosphoribosyltransferase; Provisional Back     alignment and domain information
>PRK06827 phosphoribosylpyrophosphate synthetase; Provisional Back     alignment and domain information
>PRK04923 ribose-phosphate pyrophosphokinase; Provisional Back     alignment and domain information
>PRK02458 ribose-phosphate pyrophosphokinase; Provisional Back     alignment and domain information
>PLN02440 amidophosphoribosyltransferase Back     alignment and domain information
>TIGR01134 purF amidophosphoribosyltransferase Back     alignment and domain information
>COG0634 Hpt Hypoxanthine-guanine phosphoribosyltransferase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK08341 amidophosphoribosyltransferase; Provisional Back     alignment and domain information
>PRK03092 ribose-phosphate pyrophosphokinase; Provisional Back     alignment and domain information
>COG0462 PrsA Phosphoribosylpyrophosphate synthetase [Nucleotide transport and metabolism / Amino acid transport and metabolism] Back     alignment and domain information
>PLN02369 ribose-phosphate pyrophosphokinase Back     alignment and domain information
>PRK07272 amidophosphoribosyltransferase; Provisional Back     alignment and domain information
>PRK06388 amidophosphoribosyltransferase; Provisional Back     alignment and domain information
>PRK02812 ribose-phosphate pyrophosphokinase; Provisional Back     alignment and domain information
>PRK07631 amidophosphoribosyltransferase; Provisional Back     alignment and domain information
>PRK09246 amidophosphoribosyltransferase; Provisional Back     alignment and domain information
>TIGR00201 comF comF family protein Back     alignment and domain information
>PRK07847 amidophosphoribosyltransferase; Provisional Back     alignment and domain information
>PRK11595 DNA utilization protein GntX; Provisional Back     alignment and domain information
>PLN02297 ribose-phosphate pyrophosphokinase Back     alignment and domain information
>PTZ00145 phosphoribosylpyrophosphate synthetase; Provisional Back     alignment and domain information
>COG1040 ComFC Predicted amidophosphoribosyltransferases [General function prediction only] Back     alignment and domain information
>COG2065 PyrR Pyrimidine operon attenuation protein/uracil phosphoribosyltransferase [Nucleotide transport and metabolism] Back     alignment and domain information
>COG0034 PurF Glutamine phosphoribosylpyrophosphate amidotransferase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK00129 upp uracil phosphoribosyltransferase; Reviewed Back     alignment and domain information
>TIGR01091 upp uracil phosphoribosyltransferase Back     alignment and domain information
>PF14572 Pribosyl_synth: Phosphoribosyl synthetase-associated domain; PDB: 2H07_B 2H06_B 3S5J_B 2HCR_A 3EFH_A 2H08_A 1DKR_B 1DKU_B 1IBS_B 2JI4_A Back     alignment and domain information
>PF15609 PRTase_2: Phosphoribosyl transferase Back     alignment and domain information
>KOG3367|consensus Back     alignment and domain information
>KOG0572|consensus Back     alignment and domain information
>KOG1377|consensus Back     alignment and domain information
>PLN02541 uracil phosphoribosyltransferase Back     alignment and domain information
>KOG1448|consensus Back     alignment and domain information
>KOG1712|consensus Back     alignment and domain information
>PF14681 UPRTase: Uracil phosphoribosyltransferase; PDB: 1V9S_B 1UPF_A 1UPU_D 1JLR_B 1BD4_A 1BD3_C 1JLS_D 1XTV_C 1XTU_H 3G6W_C Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query220
1ore_A180 Human Adenine Phosphoribosyltransferase Length = 18 7e-21
1g2q_A187 Crystal Structure Of Adenine Phosphoribosyltransfer 7e-16
2dy0_A190 Crystal Structure Of Project Jw0458 From Escherichi 1e-14
1l1q_A186 Crystal Structure Of Aprtase From Giardia Lamblia C 1e-07
1qb7_A236 Crystal Structures Of Adenine Phosphoribosyltransfe 6e-07
1mzv_A235 Crystal Structure Of Adenine Phosphoribosyltransfer 2e-05
>pdb|1ORE|A Chain A, Human Adenine Phosphoribosyltransferase Length = 180 Back     alignment and structure 
Iteration: 1

 Score = 97.1 bits (240), Expect = 7e-21,   Method: Compositional matrix adjust.
 Identities = 69/193 (35%), Positives = 102/193 (52%), Gaps = 38/193 (19%)
Query: 34  YSTPGFLSPPRDIFSVYRDQAA-STALHCLLKCYALSLKDKIDVVYAIESRGFLFGPYIG 92
           + TPG +   RDI  V +D A+   A+  L +    +   +ID +  ++SRGFLFGP + 
Sbjct: 19  FPTPGVVF--RDISPVLKDPASFRAAIGLLARHLKATHGGRIDYIAGLDSRGFLFGPSLA 76
Query: 93  QVLDIPFVPIRKKGKLPGVVERLEYGLEYGTVLDIPFVPIRKKGKLPGVVERLEYGLEYG 152
           Q L +  V IRK+GKLPG      Y LEYG            K +L              
Sbjct: 77  QELGLGCVLIRKRGKLPGPTLWASYSLEYG------------KAEL-------------- 110
Query: 153 TDCIEVQKDGGKAGKKALIVDDLIATG----ASCQLLTTLGVDVVECFAVMELKDLNGRQ 208
               E+QKD  + G++ ++VDDL+ATG    A+C+LL  L  +V+EC +++EL  L GR+
Sbjct: 111 ----EIQKDALEPGQRVVVVDDLLATGGTMNAACELLGRLQAEVLECVSLVELTSLKGRE 166
Query: 209 KV-PSKVVSLLEF 220
           K+ P    SLL++
Sbjct: 167 KLAPVPFFSLLQY 179
>pdb|1G2Q|A Chain A, Crystal Structure Of Adenine Phosphoribosyltransferase Length = 187 Back     alignment and structure
>pdb|2DY0|A Chain A, Crystal Structure Of Project Jw0458 From Escherichia Coli Length = 190 Back     alignment and structure
>pdb|1L1Q|A Chain A, Crystal Structure Of Aprtase From Giardia Lamblia Complexed With 9- Deazaadenine Length = 186 Back     alignment and structure
>pdb|1QB7|A Chain A, Crystal Structures Of Adenine Phosphoribosyltransferase From Leishmania Donovani. Length = 236 Back     alignment and structure
>pdb|1MZV|A Chain A, Crystal Structure Of Adenine Phosphoribosyltransferase (Aprt) From Leishmania Tarentolae Length = 235 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query220
1g2q_A187 Adenine phosphoribosyltransferase 1; dimer, single 2e-49
1zn8_A180 APRT, adenine phosphoribosyltransferase; glycosylt 2e-48
2dy0_A190 APRT, adenine phosphoribosyltransferase; structura 3e-45
1qb7_A236 APRT, adenine phosphoribosyltransferase; dinucleot 6e-45
1l1q_A186 Adenine phosphoribosyltransferase; aprtase, giardi 1e-42
1y0b_A197 Xanthine phosphoribosyltransferase; purine metabol 7e-30
1o57_A291 PUR operon repressor; purine operon repressor, hel 3e-28
1vch_A175 Phosphoribosyltransferase-related protein; structu 7e-15
2wns_A205 Orotate phosphoribosyltransferase; alternative spl 5e-05
2yzk_A178 OPRT, oprtase, orotate phosphoribosyltransferase; 1e-04
2aee_A211 OPRT, oprtase, orotate phosphoribosyltransferase; 2e-04
2p1z_A180 Phosphoribosyltransferase; STRU genomics, PSI-2, p 2e-04
3m3h_A234 OPRT, oprtase, orotate phosphoribosyltransferase; 6e-04
>1g2q_A Adenine phosphoribosyltransferase 1; dimer, single domain, catalytic loop; 1.50A {Saccharomyces cerevisiae} SCOP: c.61.1.1 PDB: 1g2p_A Length = 187 Back     alignment and structure
 Score =  158 bits (403), Expect = 2e-49
 Identities = 58/183 (31%), Positives = 84/183 (45%), Gaps = 36/183 (19%)

Query: 44  RDIFSVYRDQAA-STALHCLLKCYALSLKD-KIDVVYAIESRGFLFGPYIGQVLDIPFVP 101
            D   ++R+       +         +  + KID +  +ESRGFLFGP            
Sbjct: 28  EDFLPIFRNPGLFQKLIDAFKLHLEEAFPEVKIDYIVGLESRGFLFGP-----------T 76

Query: 102 IRKKGKLPGVVERLEYGLEYGTVLDIPFVPIRKKGKLPGVVERLEYGLEYGTDCIEVQKD 161
           +                      L + FVP+RK GKLPG   +  Y  EYG+D  E+QK+
Sbjct: 77  LALA-------------------LGVGFVPVRKAGKLPGECFKATYEKEYGSDLFEIQKN 117

Query: 162 GGKAGKKALIVDDLIATG----ASCQLLTTLGVDVVECFAVMELKDLNGRQKVPSKVVSL 217
              AG   +IVDD+IATG    A+ +L+  L  +++E   VMEL  L GR K+ + V +L
Sbjct: 118 AIPAGSNVIIVDDIIATGGSAAAAGELVEQLEANLLEYNFVMELDFLKGRSKLNAPVFTL 177

Query: 218 LEF 220
           L  
Sbjct: 178 LNA 180
>1zn8_A APRT, adenine phosphoribosyltransferase; glycosyltransferase, purine salvage; HET: AMP; 1.76A {Homo sapiens} SCOP: c.61.1.1 PDB: 1ore_A* 1zn7_A* 1zn9_A* Length = 180 Back     alignment and structure
>2dy0_A APRT, adenine phosphoribosyltransferase; structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.25A {Escherichia coli K12} Length = 190 Back     alignment and structure
>1qb7_A APRT, adenine phosphoribosyltransferase; dinucleotide binding fold; HET: ADE CIT; 1.50A {Leishmania donovani} SCOP: c.61.1.1 PDB: 1qb8_A* 1qcc_A* 1qcd_A 1mzv_A* Length = 236 Back     alignment and structure
>1l1q_A Adenine phosphoribosyltransferase; aprtase, giardia lamblia, purine metabolism, cataly transferase; HET: 9DA; 1.85A {Giardia intestinalis} SCOP: c.61.1.1 PDB: 1l1r_A* Length = 186 Back     alignment and structure
>1y0b_A Xanthine phosphoribosyltransferase; purine metabolism, STRU genomics, PSI, protein structure initative, midwest center structural genomics; HET: G4P; 1.80A {Bacillus subtilis} SCOP: c.61.1.1 PDB: 2fxv_A* Length = 197 Back     alignment and structure
>1o57_A PUR operon repressor; purine operon repressor, helix-turn-helix domain, phosphoribosyltranseferases, domain recombination, DNA binding; HET: EPE P6G 2PE PG4 1PE; 2.20A {Bacillus subtilis} SCOP: a.4.5.40 c.61.1.1 PDB: 1p4a_A* Length = 291 Back     alignment and structure
>1vch_A Phosphoribosyltransferase-related protein; structural genomics, riken structural genomics/proteomics initiative, RSGI; 1.94A {Thermus thermophilus} SCOP: c.61.1.1 Length = 175 Back     alignment and structure
>2wns_A Orotate phosphoribosyltransferase; alternative splicing, multifunctional enzyme, lyase, polymorphism, decarboxylase, phosphoprotein; HET: OMP; 1.90A {Homo sapiens} Length = 205 Back     alignment and structure
>2yzk_A OPRT, oprtase, orotate phosphoribosyltransferase; rossmann fold, glycosyltransferase, magnesium, pyrimidine biosynthesis, structural genomics; 1.80A {Aeropyrum pernix} Length = 178 Back     alignment and structure
>2aee_A OPRT, oprtase, orotate phosphoribosyltransferase; structural genomics, PSI, structure initiative; 1.95A {Streptococcus pyogenes} SCOP: c.61.1.1 Length = 211 Back     alignment and structure
>2p1z_A Phosphoribosyltransferase; STRU genomics, PSI-2, protein structure initiative, midwest CENT structural genomics, MCSG; 2.44A {Corynebacterium diphtheriae} Length = 180 Back     alignment and structure
>3m3h_A OPRT, oprtase, orotate phosphoribosyltransferase; pyrimidine ribonucleotide biosynthesis, structural genomics, infectious diseases; 1.75A {Bacillus anthracis} PDB: 3osc_A* Length = 234 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query220
1qb7_A236 APRT, adenine phosphoribosyltransferase; dinucleot 99.94
2dy0_A190 APRT, adenine phosphoribosyltransferase; structura 99.94
1g2q_A187 Adenine phosphoribosyltransferase 1; dimer, single 99.93
3m3h_A234 OPRT, oprtase, orotate phosphoribosyltransferase; 99.93
3dez_A243 OPRT, oprtase, orotate phosphoribosyltransferase; 99.92
1zn8_A180 APRT, adenine phosphoribosyltransferase; glycosylt 99.92
3mjd_A232 Orotate phosphoribosyltransferase; IDP02311, csgid 99.92
1l1q_A186 Adenine phosphoribosyltransferase; aprtase, giardi 99.91
3n2l_A238 OPRT, oprtase, orotate phosphoribosyltransferase; 99.91
3qw4_B453 UMP synthase; N-terminal orotidine monophosphate d 99.9
2wns_A205 Orotate phosphoribosyltransferase; alternative spl 99.88
1lh0_A213 OMP synthase; loop closure, monomer closure, orota 99.87
2yzk_A178 OPRT, oprtase, orotate phosphoribosyltransferase; 99.87
2ps1_A226 Orotate phosphoribosyltransferase 1; alpha beta, o 99.85
2p1z_A180 Phosphoribosyltransferase; STRU genomics, PSI-2, p 99.85
2aee_A211 OPRT, oprtase, orotate phosphoribosyltransferase; 99.84
1o57_A291 PUR operon repressor; purine operon repressor, hel 99.84
1vch_A175 Phosphoribosyltransferase-related protein; structu 99.82
1y0b_A197 Xanthine phosphoribosyltransferase; purine metabol 99.8
3hvu_A204 Hypoxanthine phosphoribosyltransferase; hypoxanthi 99.65
3ozf_A250 Hypoxanthine-guanine-xanthine phosphoribosyltrans; 99.6
1fsg_A233 HGPRTASE, hypoxanthine-guanine phosphoribosyltrans 99.59
1hgx_A183 HGXPRTASE, hypoxanthine-guanine-xanthine phosphori 99.54
1vdm_A153 Purine phosphoribosyltransferase; structural genom 99.5
1z7g_A217 HGPRT, HGPRTASE, hypoxanthine-guanine phosphoribos 99.46
3o7m_A186 Hypoxanthine phosphoribosyltransferase; hypoxanthi 99.45
2jbh_A225 Phosphoribosyltransferase domain-containing prote; 99.44
2ywu_A181 Hypoxanthine-guanine phosphoribosyltransferase; ro 99.42
2geb_A185 Hypoxanthine-guanine phosphoribosyltransferase; HG 99.42
3lrt_A286 Ribose-phosphate pyrophosphokinase; phosphoribosyl 99.4
1yfz_A205 Hypoxanthine-guanine phosphoribosyltransferase; pr 99.38
1pzm_A211 HGPRT, hypoxanthine-guanine phosphoribosyltransfer 99.38
1nul_A152 XPRT, xanthine-guanine phosphoribosyltransferase; 99.32
3ohp_A177 Hypoxanthine phosphoribosyltransferase; structural 99.31
1a3c_A181 PYRR, pyrimidine operon regulatory protein PYRR; t 99.3
1tc1_A220 Protein (hypoxanthine phosphoribosyltransferase); 99.29
1wd5_A208 Hypothetical protein TT1426; structural genomics, 99.28
1u9y_A284 RPPK;, ribose-phosphate pyrophosphokinase; PRPP sy 99.2
2xbu_A221 Hypoxanthine-guanine phosphoribosyltransferase; gl 99.16
1ufr_A181 TT1027, PYR mRNA-binding attenuation protein; pyri 99.15
1w30_A201 PYRR bifunctional protein; transferase, glycosyltr 99.12
3dah_A319 Ribose-phosphate pyrophosphokinase; pyrophosphoki 99.11
3s5j_B326 Ribose-phosphate pyrophosphokinase 1; nucleotide s 99.1
2ji4_A379 Phosphoribosyl pyrophosphate synthetase-associated 99.08
1dku_A317 Protein (phosphoribosyl pyrophosphate synthetase); 98.96
1ecf_A504 Glutamine phosphoribosylpyrophosphate amidotransf; 98.74
3acd_A181 Hypoxanthine-guanine phosphoribosyltransferase; ro 98.7
1ao0_A459 Glutamine phosphoribosylpyrophosphate amidotransfe 98.59
1dqn_A230 Guanine phosphoribosyltransferase; protein-inhibit 98.39
1i5e_A209 Uracil phosphoribosyltransferase; salvage pathway; 97.71
1o5o_A221 Uracil phosphoribosyltransferase; TM0721, structur 97.46
2e55_A208 Uracil phosphoribosyltransferase; structural genom 97.0
2ehj_A208 Uracil phosphoribosyltransferase; structural genom 96.97
1v9s_A208 Uracil phosphoribosyltransferase; pyrimidine salva 96.43
1bd3_D243 Uprtase, uracil phosphoribosyltransferase; glycosy 96.29
3dmp_A217 Uracil phosphoribosyltransferase; structural genom 95.63
1xtt_A216 Probable uracil phosphoribosyltransferase; tetrame 95.11
>1qb7_A APRT, adenine phosphoribosyltransferase; dinucleotide binding fold; HET: ADE CIT; 1.50A {Leishmania donovani} SCOP: c.61.1.1 PDB: 1qb8_A* 1qcc_A* 1qcd_A 1mzv_A* Back     alignment and structure
Probab=99.94  E-value=1.4e-26  Score=199.91  Aligned_cols=161  Identities=26%  Similarity=0.400  Sum_probs=136.8

Q ss_pred             cCCC-CcccCCCc-ccCceeccCCCCCHHHHHHHHHHHHHHHhhcCCCccEEEeecccCcchHHHHhhhcCCCeEEEeeC
Q psy6201          28 RNGP-ATYSTPGF-LSPPRDIFSVYRDQAASTALHCLLKCYALSLKDKIDVVYAIESRGFLFGPYIGQVLDIPFVPIRKK  105 (220)
Q Consensus        28 ~~~~-~~~~~~G~-~s~~~D~~~~l~~p~~~~~l~~~la~~~~~~~~~~D~Ivgie~~Gi~la~~lA~~lg~p~V~vRK~  105 (220)
                      -+.+ |+||++|+ .  |+|++.++.+|+.++.+++.|++.+...+.++|+|++++++|+++|..+|..+|+|++++||+
T Consensus        26 i~~~~~dfp~~gip~--~~D~~~ll~~~~~~~~~~~~la~~i~~~~~~~d~Ivgv~~gG~~~a~~lA~~L~~p~~~~rk~  103 (236)
T 1qb7_A           26 YRWYSPVFSPRNVPR--FADVSSITESPETLKAIRDFLVQRYRAMSPAPTHILGFDARGFLFGPMIAVELEIPFVLMRKA  103 (236)
T ss_dssp             CCEECGGGSSSCSSS--EECTHHHHTCHHHHHHHHHHHHHHHHHCSSCCSEEEEETTGGGGTHHHHHHHHTCCEEEEBCG
T ss_pred             hcccCCCCCCCCCEe--EEEhHhhcCCHHHHHHHHHHHHHHHHhhCCCCCEEEEECcCcHHHHHHHHHHhCCCEEEEEEe
Confidence            4566 99999999 7  899999999999999999999999987333799999999999999999999999999999998


Q ss_pred             CCCCCchhhhhhccccceeccCCccccccCCCCCceee-eeeeeeee---eceEEEEecCCCCCCCEEEEEecccCCC--
Q psy6201         106 GKLPGVVERLEYGLEYGTVLDIPFVPIRKKGKLPGVVE-RLEYGLEY---GTDCIEVQKDGGKAGKKALIVDDLIATG--  179 (220)
Q Consensus       106 ~k~~g~~~~~~~~~~~~~v~~~~~~~~~~~~~~~~~~~-~~~~~~~y---~~~~le~~~~~l~~G~rVLIVDDvi~TG--  179 (220)
                      ++.++                              ... +.++..+|   ++..+++..+.+.+|++||||||+++||  
T Consensus       104 ~k~~~------------------------------~~~~s~~~~~~~~~~~~~~~~i~~~~~~~Gk~VLIVDDvitTG~T  153 (236)
T 1qb7_A          104 DKNAG------------------------------LLIRSEPYEKEYKEAAPEVMTIRYGSIGKGSRVVLIDDVLATGGT  153 (236)
T ss_dssp             GGCCS------------------------------SEEECCCCCCCTTSCCCCCCEEETTSSCTTCEEEEEEEEESSCHH
T ss_pred             cCCCC------------------------------cceeceeccchhhhcCcceEEEecCCCCCcCEEEEEecccccHHH
Confidence            77665                              221 22333444   4445666667777999999999999999  


Q ss_pred             --hHHHHHHhcCCeEEEEEEEEEecCcCCceeec---------eeeEEeeeC
Q psy6201         180 --ASCQLLTTLGVDVVECFAVMELKDLNGRQKVP---------SKVVSLLEF  220 (220)
Q Consensus       180 --a~i~ll~~~Ga~v~~v~vli~~~~~~g~~~l~---------~~v~sL~~~  220 (220)
                        +++++++++|++++++++++++.+++|++++.         +|++||+++
T Consensus       154 l~~a~~~L~~~Ga~~v~v~~l~~~~~~~g~~~l~~~~~~~~~g~~v~sl~~~  205 (236)
T 1qb7_A          154 ALSGLQLVEASDAVVVEMVSILSIPFLKAAEKIHSTANSRYKDIKFISLLSD  205 (236)
T ss_dssp             HHHHHHHHHHTTCEEEEEEEEEECGGGCHHHHHHHHHHHTTTTCCEEEEEEG
T ss_pred             HHHHHHHHHHcCCeEEEEEEEEEcccccHHHHHhhhcccccCCCcEEEEEEc
Confidence              88899999999999999999999877888873         899999864
>2dy0_A APRT, adenine phosphoribosyltransferase; structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.25A {Escherichia coli K12} Back     alignment and structure
>1g2q_A Adenine phosphoribosyltransferase 1; dimer, single domain, catalytic loop; 1.50A {Saccharomyces cerevisiae} SCOP: c.61.1.1 PDB: 1g2p_A Back     alignment and structure
>3m3h_A OPRT, oprtase, orotate phosphoribosyltransferase; pyrimidine ribonucleotide biosynthesis, structural genomics, infectious diseases; 1.75A {Bacillus anthracis} PDB: 3osc_A* Back     alignment and structure
>3dez_A OPRT, oprtase, orotate phosphoribosyltransferase; glycosyltransferase, MAGN pyrimidine biosynthesis; 2.40A {Streptococcus mutans} Back     alignment and structure
>1zn8_A APRT, adenine phosphoribosyltransferase; glycosyltransferase, purine salvage; HET: AMP; 1.76A {Homo sapiens} SCOP: c.61.1.1 PDB: 1ore_A* 1zn7_A* 1zn9_A* Back     alignment and structure
>3mjd_A Orotate phosphoribosyltransferase; IDP02311, csgid, structural genomics, center for structural genomics of infectious diseases; 1.90A {Francisella tularensis} Back     alignment and structure
>1l1q_A Adenine phosphoribosyltransferase; aprtase, giardia lamblia, purine metabolism, cataly transferase; HET: 9DA; 1.85A {Giardia intestinalis} SCOP: c.61.1.1 PDB: 1l1r_A* Back     alignment and structure
>3n2l_A OPRT, oprtase, orotate phosphoribosyltransferase; pyrimidine ribonucleotide biosynthesis, infectious diseases; 2.10A {Vibrio cholerae} Back     alignment and structure
>3qw4_B UMP synthase; N-terminal orotidine monophosphate decarboxylase domain C-TE orotate phosphoribosyltransferase domain, transferase, LYAS; HET: U5P; 3.00A {Leishmania donovani} Back     alignment and structure
>2wns_A Orotate phosphoribosyltransferase; alternative splicing, multifunctional enzyme, lyase, polymorphism, decarboxylase, phosphoprotein; HET: OMP; 1.90A {Homo sapiens} Back     alignment and structure
>1lh0_A OMP synthase; loop closure, monomer closure, orotate phosphoribosyltransferase; HET: ORO PRP; 2.00A {Salmonella typhimurium} SCOP: c.61.1.1 PDB: 1opr_A* 1sto_A* 1oro_A Back     alignment and structure
>2yzk_A OPRT, oprtase, orotate phosphoribosyltransferase; rossmann fold, glycosyltransferase, magnesium, pyrimidine biosynthesis, structural genomics; 1.80A {Aeropyrum pernix} Back     alignment and structure
>2ps1_A Orotate phosphoribosyltransferase 1; alpha beta, oprtase-OA-PRPP complex; HET: ORO PRP; 1.75A {Saccharomyces cerevisiae} PDB: 2pry_A* 2prz_A* Back     alignment and structure
>2p1z_A Phosphoribosyltransferase; STRU genomics, PSI-2, protein structure initiative, midwest CENT structural genomics, MCSG; 2.44A {Corynebacterium diphtheriae} Back     alignment and structure
>2aee_A OPRT, oprtase, orotate phosphoribosyltransferase; structural genomics, PSI, structure initiative; 1.95A {Streptococcus pyogenes} SCOP: c.61.1.1 Back     alignment and structure
>1o57_A PUR operon repressor; purine operon repressor, helix-turn-helix domain, phosphoribosyltranseferases, domain recombination, DNA binding; HET: EPE P6G 2PE PG4 1PE; 2.20A {Bacillus subtilis} SCOP: a.4.5.40 c.61.1.1 PDB: 1p4a_A* Back     alignment and structure
>1vch_A Phosphoribosyltransferase-related protein; structural genomics, riken structural genomics/proteomics initiative, RSGI; 1.94A {Thermus thermophilus} SCOP: c.61.1.1 Back     alignment and structure
>1y0b_A Xanthine phosphoribosyltransferase; purine metabolism, STRU genomics, PSI, protein structure initative, midwest center structural genomics; HET: G4P; 1.80A {Bacillus subtilis} SCOP: c.61.1.1 PDB: 2fxv_A* Back     alignment and structure
>3hvu_A Hypoxanthine phosphoribosyltransferase; hypoxanthine-guanine phosphoribosyltransferase, 2-(N-morphol ethanesulfonic acid (MES), IDP01892; HET: MES; 1.95A {Bacillus anthracis str} PDB: 3h83_A* 3kb8_A* Back     alignment and structure
>3ozf_A Hypoxanthine-guanine-xanthine phosphoribosyltrans; transferase-transferase inhibitor complex; HET: HPA; 1.94A {Plasmodium falciparum fcr-3} PDB: 3ozg_A* 1cjb_A* Back     alignment and structure
>1fsg_A HGPRTASE, hypoxanthine-guanine phosphoribosyltransferase; glycosyltransferase, purine salvage; HET: PRP 9DG; 1.05A {Toxoplasma gondii} SCOP: c.61.1.1 PDB: 1qk3_A* 1qk4_A* 1qk5_A* 1dbr_A Back     alignment and structure
>1hgx_A HGXPRTASE, hypoxanthine-guanine-xanthine phosphoribosyltransferase; glycosyltransferase, purine salvage, transferase (glycosyltransferase); HET: 5GP; 1.90A {Tritrichomonas foetus} SCOP: c.61.1.1 Back     alignment and structure
>1vdm_A Purine phosphoribosyltransferase; structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.50A {Pyrococcus horikoshii} SCOP: c.61.1.1 Back     alignment and structure
>1z7g_A HGPRT, HGPRTASE, hypoxanthine-guanine phosphoribosyltransferase; flexibility, trans CIS peptide bond isomerization, nucleotide binding; 1.90A {Homo sapiens} SCOP: c.61.1.1 PDB: 1hmp_A* 1bzy_A 3gep_A* 3ggc_A* 3ggj_A* 1d6n_A* 2vfa_A* Back     alignment and structure
>3o7m_A Hypoxanthine phosphoribosyltransferase; hypoxanthine-guanine phosphoribosyltransferase, salvage of nucleosides and nucleotides; HET: GOL; 1.98A {Bacillus anthracis} SCOP: c.61.1.0 Back     alignment and structure
>2jbh_A Phosphoribosyltransferase domain-containing prote; glycosyltransferase, purine salvage; HET: 5GP; 1.7A {Homo sapiens} Back     alignment and structure
>2geb_A Hypoxanthine-guanine phosphoribosyltransferase; HGPRT, mutant, inhibitor design, selectivity; 1.70A {Thermoanaerobacter tengcongensis} Back     alignment and structure
>3lrt_A Ribose-phosphate pyrophosphokinase; phosphoribosyl transferase, ATP analog binding, ATP-binding, metal-binding, nucleotide biosynthesis; HET: ADP; 1.53A {Thermoplasma volcanium} PDB: 3lpn_A* 3nag_A* 3mbi_A* Back     alignment and structure
>1yfz_A Hypoxanthine-guanine phosphoribosyltransferase; protein-nucleotide complex; HET: IMP; 2.20A {Thermoanaerobacter tengcongensis} SCOP: c.61.1.1 PDB: 1r3u_A* Back     alignment and structure
>1pzm_A HGPRT, hypoxanthine-guanine phosphoribosyltransferase; HET: 5GP; 2.10A {Leishmania tarentolae} SCOP: c.61.1.1 Back     alignment and structure
>1nul_A XPRT, xanthine-guanine phosphoribosyltransferase; purine salvage enzym; 1.80A {Escherichia coli} SCOP: c.61.1.1 PDB: 1a96_A* 1a95_A 1a98_A 1a97_A* Back     alignment and structure
>3ohp_A Hypoxanthine phosphoribosyltransferase; structural genomics, PSI-2, protein structure initiative, NE SGX research center for structural genomics; 2.04A {Vibrio cholerae} SCOP: c.61.1.1 PDB: 1g9s_A* 1g9t_A* 1grv_A 1j7j_A Back     alignment and structure
>1a3c_A PYRR, pyrimidine operon regulatory protein PYRR; transcription regulation, attenuation protein, RNA-binding P pyrimidine biosynthesis; 1.60A {Bacillus subtilis} SCOP: c.61.1.1 PDB: 1a4x_A 2igb_A* 1xz8_A* 1non_A 1xzn_A* Back     alignment and structure
>1tc1_A Protein (hypoxanthine phosphoribosyltransferase); transferase,phosphoribosyltransferase, purine salvage, nucleotide metabolism; HET: FMB MES; 1.41A {Trypanosoma cruzi} SCOP: c.61.1.1 PDB: 1tc2_A* 1p19_A* 1p18_A* 1p17_A* 1i0l_A* 1i14_A* 1i0i_A* 1i13_A* Back     alignment and structure
>1wd5_A Hypothetical protein TT1426; structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; HET: MES; 2.00A {Thermus thermophilus} SCOP: c.61.1.1 Back     alignment and structure
>1u9y_A RPPK;, ribose-phosphate pyrophosphokinase; PRPP synthase, transferase; 2.65A {Methanocaldococcus jannaschii} SCOP: c.61.1.2 c.61.1.2 PDB: 1u9z_A* Back     alignment and structure
>2xbu_A Hypoxanthine-guanine phosphoribosyltransferase; glycosyltransferase, purine salvage, FLIP pepti; HET: 5GP; 1.80A {Saccharomyces cerevisiae} PDB: 2jkz_A* 2jky_A* Back     alignment and structure
>1ufr_A TT1027, PYR mRNA-binding attenuation protein; pyrimidine nucleotide biosynthesis, transcriptional attenuation, RNA-binding protein; 2.60A {Thermus thermophilus} SCOP: c.61.1.1 Back     alignment and structure
>1w30_A PYRR bifunctional protein; transferase, glycosyltransferase, PSI, protein structure initiative, TB structural genomics consortium, TB; 1.9A {Mycobacterium tuberculosis} SCOP: c.61.1.1 Back     alignment and structure
>3dah_A Ribose-phosphate pyrophosphokinase; pyrophosphoki seattle structural genomics center for infectious disease, magnesium, metal binding; HET: AMP; 2.30A {Burkholderia pseudomallei} Back     alignment and structure
>3s5j_B Ribose-phosphate pyrophosphokinase 1; nucleotide synthesis, transferase; 2.02A {Homo sapiens} PDB: 2hcr_A* 3efh_A 2h06_A 2h07_A 2h08_A Back     alignment and structure
>2ji4_A Phosphoribosyl pyrophosphate synthetase-associated protein 2; phosphorylation, nucleotide biosynthesis, transferase; 2.55A {Homo sapiens} PDB: 2c4k_A* Back     alignment and structure
>1dku_A Protein (phosphoribosyl pyrophosphate synthetase); open alpha-beta structure, domain duplication, phosphoribosyltransferase type I fold; HET: AP2 ABM; 2.20A {Bacillus subtilis} SCOP: c.61.1.2 c.61.1.2 PDB: 1dkr_A* 1ibs_A* Back     alignment and structure
>1ecf_A Glutamine phosphoribosylpyrophosphate amidotransf; purine biosynthesis, transferase, glycosyltransferase, gluta amidotransferase; HET: PIN; 2.00A {Escherichia coli} SCOP: c.61.1.1 d.153.1.1 PDB: 1ecb_A* 1ecc_A* 1ecg_A* 1ecj_A* Back     alignment and structure
>3acd_A Hypoxanthine-guanine phosphoribosyltransferase; rossmann fold, structural genomics, NPPSFA; HET: IMP; 1.89A {Thermus thermophilus} PDB: 3acc_A* 3acb_A* Back     alignment and structure
>1ao0_A Glutamine phosphoribosylpyrophosphate amidotransferase; glutamine amidotransferase, prtase, purine biosynthesis, phosphoribosyltransferase; HET: 5GP ADP; 2.80A {Bacillus subtilis} SCOP: c.61.1.1 d.153.1.1 PDB: 1gph_1* Back     alignment and structure
>1dqn_A Guanine phosphoribosyltransferase; protein-inhibitor complex, Mg IONS, pyrophosphate, transition state analogue; HET: IMU; 1.75A {Giardia intestinalis} SCOP: c.61.1.1 PDB: 1dqp_A* Back     alignment and structure
>1i5e_A Uracil phosphoribosyltransferase; salvage pathway; HET: U5P; 3.00A {Bacillus caldolyticus} SCOP: c.61.1.1 Back     alignment and structure
>1o5o_A Uracil phosphoribosyltransferase; TM0721, structural genomic PSI, protein structure initiative, joint center for structu genomics; HET: U5P; 2.30A {Thermotoga maritima} SCOP: c.61.1.1 Back     alignment and structure
>2e55_A Uracil phosphoribosyltransferase; structural genomics; 2.15A {Aquifex aeolicus} Back     alignment and structure
>2ehj_A Uracil phosphoribosyltransferase; structural genomics; 2.80A {Escherichia coli} Back     alignment and structure
>1v9s_A Uracil phosphoribosyltransferase; pyrimidine salvage, oligomerization, structural genomics, RI structural genomics/proteomics initiative; 2.10A {Thermus thermophilus} SCOP: c.61.1.1 Back     alignment and structure
>1bd3_D Uprtase, uracil phosphoribosyltransferase; glycosyltransferase; 1.93A {Toxoplasma gondii} SCOP: c.61.1.1 PDB: 1bd4_D 1jlr_A* 1jls_B* 1upf_D 1upu_D* Back     alignment and structure
>3dmp_A Uracil phosphoribosyltransferase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 2.60A {Burkholderia pseudomallei} SCOP: c.61.1.1 Back     alignment and structure
>1xtt_A Probable uracil phosphoribosyltransferase; tetramer, type 1 phosphoribosyltransferase, UMP complex; HET: U5P; 1.80A {Sulfolobus solfataricus} SCOP: c.61.1.1 PDB: 1vst_A* 1xtu_A* 1xtv_A* 3g6w_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 220
d1zn7a1178 c.61.1.1 (A:3-180) Adenine PRTase {Human (Homo sap 1e-19
d1y0ba1191 c.61.1.1 (A:1-191) Xanthine phosphoribosyltransfer 2e-17
d1g2qa_178 c.61.1.1 (A:) Adenine PRTase {Baker's yeast (Sacch 2e-17
d1qb7a_236 c.61.1.1 (A:) Adenine PRTase {Leishmania donovani 1e-16
d1o57a2202 c.61.1.1 (A:75-276) Pur operon repressor (PurR), C 2e-13
d1vcha1174 c.61.1.1 (A:2-175) Putative phosphoribosyltransfer 4e-13
d1l1qa_181 c.61.1.1 (A:) Adenine PRTase {Giardia lamblia [Tax 1e-12
>d1zn7a1 c.61.1.1 (A:3-180) Adenine PRTase {Human (Homo sapiens) [TaxId: 9606]} Length = 178 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: PRTase-like
superfamily: PRTase-like
family: Phosphoribosyltransferases (PRTases)
domain: Adenine PRTase
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 80.1 bits (197), Expect = 1e-19
 Identities = 64/183 (34%), Positives = 94/183 (51%), Gaps = 36/183 (19%)

Query: 44  RDIFSVYRDQAASTALHCLLKCYALSLKD-KIDVVYAIESRGFLFGPYIGQVLDIPFVPI 102
           RDI  V +D A+  A   LL  +  +    +ID +  ++SRGFLFGP + Q L +  V I
Sbjct: 25  RDISPVLKDPASFRAAIGLLARHLKATHGGRIDYIAGLDSRGFLFGPSLAQELGLGCVLI 84

Query: 103 RKKGKLPGVVERLEYGLEYGTVLDIPFVPIRKKGKLPGVVERLEYGLEYGTDCIEVQKDG 162
           RK+GKLPG      Y LEYG                                 +E+QKD 
Sbjct: 85  RKRGKLPGPTLWASYSLEYGK------------------------------AELEIQKDA 114

Query: 163 GKAGKKALIVDDLIATG----ASCQLLTTLGVDVVECFAVMELKDLNGRQKVPS-KVVSL 217
            + G++ ++VDDL+ATG    A+C+LL  L  +V+EC +++EL  L GR+K+      SL
Sbjct: 115 LEPGQRVVVVDDLLATGGTMNAACELLGRLQAEVLECVSLVELTSLKGREKLAPVPFFSL 174

Query: 218 LEF 220
           L++
Sbjct: 175 LQY 177
>d1y0ba1 c.61.1.1 (A:1-191) Xanthine phosphoribosyltransferase {Bacillus subtilis [TaxId: 1423]} Length = 191 Back     information, alignment and structure
>d1g2qa_ c.61.1.1 (A:) Adenine PRTase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 178 Back     information, alignment and structure
>d1qb7a_ c.61.1.1 (A:) Adenine PRTase {Leishmania donovani [TaxId: 5661]} Length = 236 Back     information, alignment and structure
>d1o57a2 c.61.1.1 (A:75-276) Pur operon repressor (PurR), C-terminal domain {Bacillus subtilis [TaxId: 1423]} Length = 202 Back     information, alignment and structure
>d1vcha1 c.61.1.1 (A:2-175) Putative phosphoribosyltransferase TTHA1613 {Thermus thermophilus [TaxId: 274]} Length = 174 Back     information, alignment and structure
>d1l1qa_ c.61.1.1 (A:) Adenine PRTase {Giardia lamblia [TaxId: 5741]} Length = 181 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query220
d1zn7a1178 Adenine PRTase {Human (Homo sapiens) [TaxId: 9606] 100.0
d1g2qa_178 Adenine PRTase {Baker's yeast (Saccharomyces cerev 100.0
d1l1qa_181 Adenine PRTase {Giardia lamblia [TaxId: 5741]} 100.0
d1qb7a_236 Adenine PRTase {Leishmania donovani [TaxId: 5661]} 99.97
d1o57a2202 Pur operon repressor (PurR), C-terminal domain {Ba 99.95
d2aeea1208 Orotate PRTase {Streptococcus pyogenes [TaxId: 131 99.94
d1y0ba1191 Xanthine phosphoribosyltransferase {Bacillus subti 99.94
d1vcha1174 Putative phosphoribosyltransferase TTHA1613 {Therm 99.9
d1lh0a_213 Orotate PRTase {Salmonella typhimurium [TaxId: 903 99.88
d1vdma1153 Pprobable purine phosphoribosyltransferase PH0095 99.53
d1wd5a_208 Putative phosphoribosyltransferase TT1426 (TTHA146 99.04
d1hgxa_173 Hypoxanthine-guanine-xanthine PRTase {Tritrichomon 98.96
d1nula_150 Xanthine-guanine PRTase (XPRTase) {Escherichia col 98.96
d1yfza1178 Xanthine-guanine PRTase (XPRTase) {Thermoanaerobac 98.95
d1u9ya2129 Phosphoribosylpyrophosphate synthetase {Methanocal 98.83
d1tc1a_184 Hypoxanthine PRTase {Trypanosoma cruzi [TaxId: 569 98.59
d1ufra_178 Pyrimidine operon regulator PyrR {Thermus thermoph 98.59
d1dkua2149 Phosphoribosylpyrophosphate synthetase {Bacillus s 98.59
d1cjba_228 Hypoxanthine-guanine PRTase (HGPRTase) {Plasmodium 98.56
d1j7ja_172 Hypoxanthine PRTase {Salmonella typhimurium [TaxId 98.53
d1pzma_183 Hypoxanthine-guanine-xanthine PRTase {Leishmania t 98.53
d2c4ka2184 PRPP synthetase-associated protein 1 {Human (Homo 98.47
d1fsga_233 Hypoxanthine-guanine-xanthine PRTase {Toxoplasma g 98.44
d1z7ga1214 Hypoxanthine-guanine PRTase (HGPRTase) {Human (Hom 98.41
d1a3ca_178 Pyrimidine operon regulator PyrR {Bacillus subtili 98.34
d1w30a_182 Pyrimidine operon regulator PyrR {Mycobacterium tu 98.19
d1gph11231 Glutamine PRPP amidotransferase, C-terminal domain 97.99
d1ecfa1243 Glutamine PRPP amidotransferase, C-terminal domain 97.91
d1dqna_230 Guanine PRTase {Giardia lamblia [TaxId: 5741]} 97.88
d1bd3a_224 Uracil PRTase, Upp {Toxoplasma gondii [TaxId: 5811 81.85
>d1zn7a1 c.61.1.1 (A:3-180) Adenine PRTase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: PRTase-like
superfamily: PRTase-like
family: Phosphoribosyltransferases (PRTases)
domain: Adenine PRTase
species: Human (Homo sapiens) [TaxId: 9606]

Probab=100.00  E-value=1.9e-36  Score=250.63  Aligned_cols=161  Identities=42%  Similarity=0.687  Sum_probs=147.4

Q ss_pred             cCCCCcccCCCcccCceeccCCCCCHHHHHHHHHHHHHHHhhc-CCCccEEEeecccCcchHHHHhhhcCCCeEEEeeCC
Q psy6201          28 RNGPATYSTPGFLSPPRDIFSVYRDQAASTALHCLLKCYALSL-KDKIDVVYAIESRGFLFGPYIGQVLDIPFVPIRKKG  106 (220)
Q Consensus        28 ~~~~~~~~~~G~~s~~~D~~~~l~~p~~~~~l~~~la~~~~~~-~~~~D~Ivgie~~Gi~la~~lA~~lg~p~V~vRK~~  106 (220)
                      .|.+||||++|+.  |+|++.++.||++++.+.+.|++++++. +.++|+|+|+|++|||+|+++|..||+|++++||++
T Consensus        11 i~~~pd~P~~Gi~--f~Di~~il~~P~~~~~~~~~la~~~~~~~~~~~D~Iv~~e~~Gi~la~~lA~~l~~p~v~~Rk~~   88 (178)
T d1zn7a1          11 IRSFPDFPTPGVV--FRDISPVLKDPASFRAAIGLLARHLKATHGGRIDYIAGLDSRGFLFGPSLAQELGLGCVLIRKRG   88 (178)
T ss_dssp             CEEEETSSSTTCE--EEECHHHHHSHHHHHHHHHHHHHHHHHHHTTCCCEEEEETTGGGGTHHHHHHHHTCEEEEEEETT
T ss_pred             ccccCCCCCCCCe--EEECchhhhCHHHHHHHHHHHHhhhhhhcCCCcceEEEeccccchhhhhhHHHcCCCceEeeecC
Confidence            4678999999999  9999999999999999999999998753 358999999999999999999999999999999998


Q ss_pred             CCCCchhhhhhccccceeccCCccccccCCCCCceeeeeeeeeeeeceEEEEecCCCCCCCEEEEEecccCCC----hHH
Q psy6201         107 KLPGVVERLEYGLEYGTVLDIPFVPIRKKGKLPGVVERLEYGLEYGTDCIEVQKDGGKAGKKALIVDDLIATG----ASC  182 (220)
Q Consensus       107 k~~g~~~~~~~~~~~~~v~~~~~~~~~~~~~~~~~~~~~~~~~~y~~~~le~~~~~l~~G~rVLIVDDvi~TG----a~i  182 (220)
                      +.|+                              ......++.+|+..+++++++.+.+|+|||||||+++||    +++
T Consensus        89 ~~~~------------------------------~~~~~~~~~~~~~~~~~~~~~~i~~g~rVlIVDDviaTGgT~~a~~  138 (178)
T d1zn7a1          89 KLPG------------------------------PTLWASYSLEYGKAELEIQKDALEPGQRVVVVDDLLATGGTMNAAC  138 (178)
T ss_dssp             CCCS------------------------------SEEEEEEEETTEEEEEEEETTSSCTTCEEEEEEEEESSSHHHHHHH
T ss_pred             CCCc------------------------------cceeEEeeccccccceeeccCcccCCCeEEEehhhhhhchHHHHHH
Confidence            8877                              344455667788778899999999999999999999999    889


Q ss_pred             HHHHhcCCeEEEEEEEEEecCcCCceeec-eeeEEeeeC
Q psy6201         183 QLLTTLGVDVVECFAVMELKDLNGRQKVP-SKVVSLLEF  220 (220)
Q Consensus       183 ~ll~~~Ga~v~~v~vli~~~~~~g~~~l~-~~v~sL~~~  220 (220)
                      ++++++||+|+++++++++.+++|++++. +|++||++|
T Consensus       139 ~ll~~~Ga~vvg~~~ii~~~~~~g~~~l~~~pv~SL~~~  177 (178)
T d1zn7a1         139 ELLGRLQAEVLECVSLVELTSLKGREKLAPVPFFSLLQY  177 (178)
T ss_dssp             HHHHHTTCEEEEEEEEEEEGGGCHHHHHTTSCEEEEEEE
T ss_pred             HHHHHCCCEEEEEEEEEEcCcCCHHHhcCCCCeEEEEEe
Confidence            99999999999999999999888999997 999999986
>d1g2qa_ c.61.1.1 (A:) Adenine PRTase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1l1qa_ c.61.1.1 (A:) Adenine PRTase {Giardia lamblia [TaxId: 5741]} Back     information, alignment and structure
>d1qb7a_ c.61.1.1 (A:) Adenine PRTase {Leishmania donovani [TaxId: 5661]} Back     information, alignment and structure
>d1o57a2 c.61.1.1 (A:75-276) Pur operon repressor (PurR), C-terminal domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2aeea1 c.61.1.1 (A:1-208) Orotate PRTase {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1y0ba1 c.61.1.1 (A:1-191) Xanthine phosphoribosyltransferase {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1vcha1 c.61.1.1 (A:2-175) Putative phosphoribosyltransferase TTHA1613 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1lh0a_ c.61.1.1 (A:) Orotate PRTase {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1vdma1 c.61.1.1 (A:1-153) Pprobable purine phosphoribosyltransferase PH0095 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1wd5a_ c.61.1.1 (A:) Putative phosphoribosyltransferase TT1426 (TTHA1462) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1hgxa_ c.61.1.1 (A:) Hypoxanthine-guanine-xanthine PRTase {Tritrichomonas foetus [TaxId: 5724]} Back     information, alignment and structure
>d1nula_ c.61.1.1 (A:) Xanthine-guanine PRTase (XPRTase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1yfza1 c.61.1.1 (A:3-180) Xanthine-guanine PRTase (XPRTase) {Thermoanaerobacter tengcongensis [TaxId: 119072]} Back     information, alignment and structure
>d1u9ya2 c.61.1.2 (A:156-284) Phosphoribosylpyrophosphate synthetase {Methanocaldococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1tc1a_ c.61.1.1 (A:) Hypoxanthine PRTase {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1ufra_ c.61.1.1 (A:) Pyrimidine operon regulator PyrR {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1dkua2 c.61.1.2 (A:167-315) Phosphoribosylpyrophosphate synthetase {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1cjba_ c.61.1.1 (A:) Hypoxanthine-guanine PRTase (HGPRTase) {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1j7ja_ c.61.1.1 (A:) Hypoxanthine PRTase {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1pzma_ c.61.1.1 (A:) Hypoxanthine-guanine-xanthine PRTase {Leishmania tarentolae [TaxId: 5689]} Back     information, alignment and structure
>d2c4ka2 c.61.1.2 (A:167-350) PRPP synthetase-associated protein 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fsga_ c.61.1.1 (A:) Hypoxanthine-guanine-xanthine PRTase {Toxoplasma gondii [TaxId: 5811]} Back     information, alignment and structure
>d1z7ga1 c.61.1.1 (A:4-217) Hypoxanthine-guanine PRTase (HGPRTase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a3ca_ c.61.1.1 (A:) Pyrimidine operon regulator PyrR {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1w30a_ c.61.1.1 (A:) Pyrimidine operon regulator PyrR {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1gph11 c.61.1.1 (1:235-465) Glutamine PRPP amidotransferase, C-terminal domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1ecfa1 c.61.1.1 (A:250-492) Glutamine PRPP amidotransferase, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1dqna_ c.61.1.1 (A:) Guanine PRTase {Giardia lamblia [TaxId: 5741]} Back     information, alignment and structure
>d1bd3a_ c.61.1.1 (A:) Uracil PRTase, Upp {Toxoplasma gondii [TaxId: 5811]} Back     information, alignment and structure