Diaphorina citri psyllid: psy6205

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220----

MARYPLIGDVRGIGLFVGVELVTCRKQKTPATSEAQHVITRPPVRMSTEAPCPDVYRGKYPADKYPDEDLGVKYAQDVQDLIEAMGRNGKRPCAFFAESLQSCGGQIIPPANYLREVYKHVQVGFGRVGTHWWAFQLQGDDIIPDIVTVGKPMGNGHPVAAVITTKEIAKSFQETGVEYFNTYGGNPVSCAVANAVMEVLETENLREHALDVGNQLHTPKKENN

cccccCEEEEEEEEEEEEEEEECcccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHccccccEEEEEEccccccccCECcccccHHHHHcHHcccccccccccHHHHHccccccccEEEEccccccccccEEEEccHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHccc

*ARYPLIGDVRGIGLFVGVELVTCRKQKTPATSEAQHVITRPPVRMSTEAPCPDVYRGKYPADKYPDEDLGVKYAQDVQDLIEAMGRNGKRPCAFFAESLQSCGGQIIPPANYLREVYKHVQVGFGRVGTHWWAFQLQGDDIIPDIVTVGKPMGNGHPVAAVITTKEIAKSFQETGVEYFNTYGGNPVSCAVANAVMEVLETENLREHALDVGNQLHTPKKE**

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Ethanolamine-phosphate phospho-lyase		confident	Q7SY54
Ethanolamine-phosphate phospho-lyase		confident	Q8TBG4
Ethanolamine-phosphate phospho-lyase		confident	Q8BWU8

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0008483 [MF]	transaminase activity	probable	GO:0003824, GO:0016740, GO:0003674, GO:0016769
GO:0005829 [CC]	cytosol	probable	GO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0046914 [MF]	transition metal ion binding	probable	GO:0043169, GO:0046872, GO:0003674, GO:0005488, GO:0043167
GO:0044699 [BP]	single-organism process	probable	GO:0008150
GO:0042221 [BP]	response to chemical stimulus	probable	GO:0050896, GO:0008150
GO:0005739 [CC]	mitochondrion	probable	GO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:1901606 [BP]	alpha-amino acid catabolic process	probable	GO:0019752, GO:0009063, GO:0006807, GO:0044281, GO:0044282, GO:0044712, GO:1901575, GO:0006520, GO:0071704, GO:1901605, GO:0009987, GO:0044710, GO:0008150, GO:0008152, GO:0043436, GO:0009056, GO:0044248, GO:0044238, GO:1901564, GO:1901565, GO:0006082, GO:0046395, GO:0016054, GO:0044237

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3GJU, chain A
Confidence level:very confident
Coverage over the Query: 40-222
View the alignment between query and template
View the model in PyMOL

Template: 4A6R, chain A
Confidence level:very confident
Coverage over the Query: 2-85
View the alignment between query and template
View the model in PyMOL