Diaphorina citri psyllid: psy6206


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80---
MSLPVGHCHPAVVKAACTQLALLNTNNRFLHDNLVLCARKLASLLPDPLSVCFFVNSGSEANDLALRLARVHTNNDDVITQDQ
cccccccccHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHccccccEEEEEcccHHHHHHHHHHHHHHcccccEEEccc
MSLPVGHCHPAVVKAACTQLALLNTNNRFLHDNLVLCARKLASLLPDPLSVCFFVNSGSEANDLALRLARVHTNNDDVITQD*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSLPVGHCHPAVVKAACTQLALLNTNNRFLHDNLVLCARKLASLLPDPLSVCFFVNSGSEANDLALRLARVHTNNDDVITQDQ

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Alanine--glyoxylate aminotransferase 2-like confidentQ9VU95
Ethanolamine-phosphate phospho-lyase confidentQ7SY54
Ethanolamine-phosphate phospho-lyase confidentQ8TBG4

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0045429 [BP]positive regulation of nitric oxide biosynthetic processprobableGO:0009889, GO:0009893, GO:0019222, GO:0009891, GO:0031326, GO:0031325, GO:0031328, GO:0031323, GO:0050794, GO:0045428, GO:0065007, GO:0051171, GO:0051173, GO:0048518, GO:0008150, GO:0050789, GO:0048522
GO:0019481 [BP]L-alanine catabolic process, by transaminationprobableGO:0044237, GO:0019752, GO:0009063, GO:0006807, GO:0044281, GO:0044282, GO:0044712, GO:1901575, GO:0006522, GO:0006520, GO:0006524, GO:0071704, GO:1901605, GO:1901606, GO:0009987, GO:0044710, GO:0009078, GO:0008152, GO:0043436, GO:0009056, GO:0044248, GO:0044238, GO:1901564, GO:1901565, GO:0006082, GO:0046395, GO:0016054, GO:0042853, GO:0042851, GO:0008150, GO:0009080
GO:0008483 [MF]transaminase activityprobableGO:0003824, GO:0016740, GO:0003674, GO:0016769
GO:0035094 [BP]response to nicotineprobableGO:0009719, GO:0050896, GO:0010243, GO:0010033, GO:0008150, GO:0042221, GO:0043279, GO:1901698, GO:0014070
GO:0005739 [CC]mitochondrionprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0019265 [BP]glycine biosynthetic process, by transamination of glyoxylateprobableGO:0019752, GO:0044249, GO:0006807, GO:0044281, GO:0044283, GO:0009069, GO:1901576, GO:0044710, GO:0044711, GO:0006545, GO:0006544, GO:0006520, GO:0071704, GO:1901605, GO:1901607, GO:0044238, GO:0009987, GO:0009058, GO:0008150, GO:0008152, GO:0043436, GO:0009070, GO:0008652, GO:1901564, GO:1901566, GO:0006082, GO:0046394, GO:0016053, GO:0044237
GO:0030170 [MF]pyridoxal phosphate bindingprobableGO:0043168, GO:0003674, GO:0048037, GO:0005488, GO:0043167
GO:0009436 [BP]glyoxylate catabolic processprobableGO:0019752, GO:0044248, GO:0044281, GO:0044282, GO:0044712, GO:1901575, GO:0071704, GO:0046185, GO:0009987, GO:0044710, GO:0032787, GO:0008150, GO:0008152, GO:0072329, GO:0043436, GO:0046487, GO:0009056, GO:0006081, GO:0006082, GO:0046395, GO:0016054, GO:0044237

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3HMU, chain A
Confidence level:very confident
Coverage over the Query: 1-83
View the alignment between query and template
View the model in PyMOL