Psyllid ID: psy6206
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 83 | ||||||
| 383855028 | 484 | PREDICTED: alanine--glyoxylate aminotran | 0.951 | 0.163 | 0.772 | 4e-30 | |
| 242012375 | 440 | alanine-glyoxylate aminotransferase, put | 0.951 | 0.179 | 0.759 | 4e-30 | |
| 332020516 | 485 | Alanine--glyoxylate aminotransferase 2-l | 0.951 | 0.162 | 0.772 | 1e-29 | |
| 322778710 | 498 | hypothetical protein SINV_00178 [Solenop | 0.951 | 0.158 | 0.772 | 2e-29 | |
| 340713065 | 485 | PREDICTED: alanine--glyoxylate aminotran | 0.951 | 0.162 | 0.734 | 5e-29 | |
| 350419709 | 485 | PREDICTED: alanine--glyoxylate aminotran | 0.951 | 0.162 | 0.734 | 5e-29 | |
| 91091742 | 472 | PREDICTED: similar to AGAP000313-PA isof | 0.915 | 0.161 | 0.723 | 4e-28 | |
| 307174361 | 483 | Alanine--glyoxylate aminotransferase 2-l | 0.951 | 0.163 | 0.746 | 8e-28 | |
| 66560647 | 140 | PREDICTED: alanine--glyoxylate aminotran | 0.951 | 0.564 | 0.734 | 1e-27 | |
| 328779867 | 536 | PREDICTED: alanine--glyoxylate aminotran | 0.951 | 0.147 | 0.721 | 2e-27 |
| >gi|383855028|ref|XP_003703021.1| PREDICTED: alanine--glyoxylate aminotransferase 2-like [Megachile rotundata] | Back alignment and taxonomy information |
|---|
Score = 135 bits (339), Expect = 4e-30, Method: Composition-based stats.
Identities = 61/79 (77%), Positives = 68/79 (86%)
Query: 5 VGHCHPAVVKAACTQLALLNTNNRFLHDNLVLCARKLASLLPDPLSVCFFVNSGSEANDL 64
VGHCHP VV+A Q+ALL+TNNRFLHDNLVLCAR+L SLLP+PLSVCF VNSGSEANDL
Sbjct: 62 VGHCHPTVVRAGQEQMALLSTNNRFLHDNLVLCARRLTSLLPEPLSVCFLVNSGSEANDL 121
Query: 65 ALRLARVHTNNDDVITQDQ 83
ALRLA+ HT N D+IT D
Sbjct: 122 ALRLAQTHTKNKDIITLDH 140
|
Source: Megachile rotundata Species: Megachile rotundata Genus: Megachile Family: Megachilidae Order: Hymenoptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|242012375|ref|XP_002426908.1| alanine-glyoxylate aminotransferase, putative [Pediculus humanus corporis] gi|212511137|gb|EEB14170.1| alanine-glyoxylate aminotransferase, putative [Pediculus humanus corporis] | Back alignment and taxonomy information |
|---|
| >gi|332020516|gb|EGI60931.1| Alanine--glyoxylate aminotransferase 2-like protein [Acromyrmex echinatior] | Back alignment and taxonomy information |
|---|
| >gi|322778710|gb|EFZ09126.1| hypothetical protein SINV_00178 [Solenopsis invicta] | Back alignment and taxonomy information |
|---|
| >gi|340713065|ref|XP_003395072.1| PREDICTED: alanine--glyoxylate aminotransferase 2-like [Bombus terrestris] | Back alignment and taxonomy information |
|---|
| >gi|350419709|ref|XP_003492276.1| PREDICTED: alanine--glyoxylate aminotransferase 2-like [Bombus impatiens] | Back alignment and taxonomy information |
|---|
| >gi|91091742|ref|XP_966408.1| PREDICTED: similar to AGAP000313-PA isoform 1 [Tribolium castaneum] gi|270001093|gb|EEZ97540.1| hypothetical protein TcasGA2_TC011390 [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
| >gi|307174361|gb|EFN64903.1| Alanine--glyoxylate aminotransferase 2-like [Camponotus floridanus] | Back alignment and taxonomy information |
|---|
| >gi|66560647|ref|XP_624323.1| PREDICTED: alanine--glyoxylate aminotransferase 2-like [Apis mellifera] | Back alignment and taxonomy information |
|---|
| >gi|328779867|ref|XP_392348.2| PREDICTED: alanine--glyoxylate aminotransferase 2-like [Apis mellifera] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 83 | ||||||
| FB|FBgn0036381 | 494 | CG8745 [Drosophila melanogaste | 0.939 | 0.157 | 0.717 | 2.5e-25 | |
| UNIPROTKB|E7ENR6 | 459 | AGXT2L1 "Ethanolamine-phosphat | 0.939 | 0.169 | 0.679 | 1.4e-23 | |
| UNIPROTKB|Q5E9S4 | 497 | AGXT2L1 "Ethanolamine-phosphat | 0.939 | 0.156 | 0.692 | 2e-23 | |
| UNIPROTKB|Q8TBG4 | 499 | AGXT2L1 "Ethanolamine-phosphat | 0.939 | 0.156 | 0.679 | 2e-23 | |
| UNIPROTKB|F1S126 | 488 | AGXT2L1 "Uncharacterized prote | 0.939 | 0.159 | 0.679 | 4e-23 | |
| UNIPROTKB|F1S127 | 495 | AGXT2L1 "Uncharacterized prote | 0.939 | 0.157 | 0.679 | 4.2e-23 | |
| MGI|MGI:1919010 | 499 | Agxt2l1 "alanine-glyoxylate am | 0.939 | 0.156 | 0.666 | 5.6e-23 | |
| ZFIN|ZDB-GENE-040426-1133 | 492 | agxt2l1 "alanine-glyoxylate am | 0.939 | 0.158 | 0.666 | 8.8e-23 | |
| UNIPROTKB|E1C8Q2 | 501 | AGXT2L1 "Uncharacterized prote | 0.915 | 0.151 | 0.684 | 5.5e-22 | |
| UNIPROTKB|D6RFL9 | 70 | AGXT2L1 "Ethanolamine-phosphat | 0.795 | 0.942 | 0.712 | 1.5e-21 |
| FB|FBgn0036381 CG8745 [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Score = 292 (107.8 bits), Expect = 2.5e-25, P = 2.5e-25
Identities = 56/78 (71%), Positives = 62/78 (79%)
Query: 5 VGHCHPAVVKAACTQLALLNTNNRFLHDNLVLCARKLASLLPDPLSVCFFVNSGSEANDL 64
VGHCHP VV+A Q+A ++TNNRFLHD LV CAR L S +P+PLSVCFFVNSGSEANDL
Sbjct: 70 VGHCHPEVVRAGALQMATISTNNRFLHDELVQCARTLTSKMPEPLSVCFFVNSGSEANDL 129
Query: 65 ALRLARVHTNNDDVITQD 82
ALRLAR T DVIT D
Sbjct: 130 ALRLARNFTKRQDVITLD 147
|
|
| UNIPROTKB|E7ENR6 AGXT2L1 "Ethanolamine-phosphate phospho-lyase" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q5E9S4 AGXT2L1 "Ethanolamine-phosphate phospho-lyase" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q8TBG4 AGXT2L1 "Ethanolamine-phosphate phospho-lyase" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1S126 AGXT2L1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1S127 AGXT2L1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:1919010 Agxt2l1 "alanine-glyoxylate aminotransferase 2-like 1" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-040426-1133 agxt2l1 "alanine-glyoxylate aminotransferase 2-like 1" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E1C8Q2 AGXT2L1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|D6RFL9 AGXT2L1 "Ethanolamine-phosphate phospho-lyase" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 83 | |||
| PRK06148 | 1013 | PRK06148, PRK06148, hypothetical protein; Provisio | 1e-39 | |
| COG0160 | 447 | COG0160, GabT, 4-aminobutyrate aminotransferase an | 2e-27 | |
| PRK06149 | 972 | PRK06149, PRK06149, hypothetical protein; Provisio | 1e-26 | |
| cd00610 | 413 | cd00610, OAT_like, Acetyl ornithine aminotransfera | 2e-26 | |
| pfam00202 | 338 | pfam00202, Aminotran_3, Aminotransferase class-III | 1e-17 | |
| COG0161 | 449 | COG0161, BioA, Adenosylmethionine-8-amino-7-oxonon | 7e-17 | |
| COG4992 | 404 | COG4992, ArgD, Ornithine/acetylornithine aminotran | 2e-16 | |
| PRK03244 | 398 | PRK03244, argD, acetylornithine aminotransferase; | 6e-15 | |
| PRK02627 | 396 | PRK02627, PRK02627, acetylornithine aminotransfera | 1e-14 | |
| PRK08117 | 433 | PRK08117, PRK08117, 4-aminobutyrate aminotransfera | 2e-14 | |
| PRK05769 | 441 | PRK05769, PRK05769, 4-aminobutyrate aminotransfera | 2e-13 | |
| PRK06062 | 451 | PRK06062, PRK06062, hypothetical protein; Provisio | 2e-13 | |
| PRK02936 | 377 | PRK02936, argD, acetylornithine aminotransferase; | 3e-13 | |
| PRK06082 | 459 | PRK06082, PRK06082, 4-aminobutyrate aminotransfera | 5e-12 | |
| PRK11522 | 459 | PRK11522, PRK11522, putrescine--2-oxoglutarate ami | 6e-11 | |
| PRK07480 | 456 | PRK07480, PRK07480, putative aminotransferase; Val | 7e-11 | |
| PRK06105 | 460 | PRK06105, PRK06105, aminotransferase; Provisional | 1e-10 | |
| TIGR00707 | 379 | TIGR00707, argD, transaminase, acetylornithine/suc | 1e-10 | |
| PRK09221 | 445 | PRK09221, PRK09221, beta alanine--pyruvate transam | 1e-09 | |
| PRK05093 | 403 | PRK05093, argD, bifunctional N-succinyldiaminopime | 4e-09 | |
| PRK08360 | 443 | PRK08360, PRK08360, 4-aminobutyrate aminotransfera | 4e-09 | |
| TIGR00508 | 417 | TIGR00508, bioA, adenosylmethionine-8-amino-7-oxon | 4e-09 | |
| PRK08593 | 445 | PRK08593, PRK08593, 4-aminobutyrate aminotransfera | 5e-09 | |
| PTZ00125 | 400 | PTZ00125, PTZ00125, ornithine aminotransferase-lik | 5e-09 | |
| PRK06918 | 451 | PRK06918, PRK06918, 4-aminobutyrate aminotransfera | 8e-09 | |
| PRK05964 | 423 | PRK05964, PRK05964, adenosylmethionine--8-amino-7- | 1e-08 | |
| COG0001 | 432 | COG0001, HemL, Glutamate-1-semialdehyde aminotrans | 1e-08 | |
| TIGR03372 | 442 | TIGR03372, putres_am_tran, putrescine aminotransfe | 2e-08 | |
| TIGR03246 | 397 | TIGR03246, arg_catab_astC, succinylornithine trans | 2e-08 | |
| PRK13360 | 442 | PRK13360, PRK13360, omega amino acid--pyruvate tra | 3e-08 | |
| PRK07495 | 425 | PRK07495, PRK07495, 4-aminobutyrate aminotransfera | 8e-08 | |
| PRK06541 | 460 | PRK06541, PRK06541, hypothetical protein; Provisio | 2e-07 | |
| PRK00062 | 426 | PRK00062, PRK00062, glutamate-1-semialdehyde amino | 2e-07 | |
| TIGR01885 | 401 | TIGR01885, Orn_aminotrans, ornithine aminotransfer | 2e-07 | |
| TIGR00713 | 423 | TIGR00713, hemL, glutamate-1-semialdehyde-2,1-amin | 2e-07 | |
| PRK12403 | 460 | PRK12403, PRK12403, putative aminotransferase; Pro | 3e-07 | |
| PRK06917 | 447 | PRK06917, PRK06917, hypothetical protein; Provisio | 4e-07 | |
| PRK01278 | 389 | PRK01278, argD, acetylornithine transaminase prote | 4e-07 | |
| PRK12381 | 406 | PRK12381, PRK12381, bifunctional succinylornithine | 4e-07 | |
| PRK03715 | 395 | PRK03715, argD, acetylornithine transaminase prote | 9e-07 | |
| PRK07678 | 451 | PRK07678, PRK07678, aminotransferase; Validated | 1e-06 | |
| PLN00144 | 382 | PLN00144, PLN00144, acetylornithine transaminase | 2e-06 | |
| PRK06058 | 443 | PRK06058, PRK06058, 4-aminobutyrate aminotransfera | 2e-06 | |
| PRK07483 | 443 | PRK07483, PRK07483, hypothetical protein; Provisio | 3e-06 | |
| TIGR00700 | 420 | TIGR00700, GABAtrnsam, 4-aminobutyrate aminotransf | 4e-06 | |
| PRK09792 | 421 | PRK09792, PRK09792, 4-aminobutyrate transaminase; | 6e-06 | |
| PRK12389 | 428 | PRK12389, PRK12389, glutamate-1-semialdehyde amino | 7e-06 | |
| PRK00854 | 401 | PRK00854, rocD, ornithine--oxo-acid transaminase; | 8e-06 | |
| PRK06173 | 429 | PRK06173, PRK06173, adenosylmethionine--8-amino-7- | 1e-05 | |
| PRK04260 | 375 | PRK04260, PRK04260, acetylornithine aminotransfera | 1e-05 | |
| PRK06209 | 431 | PRK06209, PRK06209, glutamate-1-semialdehyde 2,1-a | 6e-05 | |
| PRK05630 | 422 | PRK05630, PRK05630, adenosylmethionine--8-amino-7- | 6e-05 | |
| PRK07036 | 466 | PRK07036, PRK07036, hypothetical protein; Provisio | 7e-05 | |
| PRK07481 | 449 | PRK07481, PRK07481, hypothetical protein; Provisio | 1e-04 | |
| PRK00615 | 433 | PRK00615, PRK00615, glutamate-1-semialdehyde amino | 1e-04 | |
| PRK05639 | 457 | PRK05639, PRK05639, 4-aminobutyrate aminotransfera | 1e-04 | |
| PRK08088 | 425 | PRK08088, PRK08088, 4-aminobutyrate aminotransfera | 1e-04 | |
| PRK07030 | 466 | PRK07030, PRK07030, adenosylmethionine--8-amino-7- | 1e-04 | |
| PLN02760 | 504 | PLN02760, PLN02760, 4-aminobutyrate:pyruvate trans | 2e-04 | |
| PLN02624 | 474 | PLN02624, PLN02624, ornithine-delta-aminotransfera | 3e-04 | |
| PLN02482 | 474 | PLN02482, PLN02482, glutamate-1-semialdehyde 2,1-a | 4e-04 | |
| PRK06777 | 421 | PRK06777, PRK06777, 4-aminobutyrate aminotransfera | 4e-04 | |
| PRK06916 | 460 | PRK06916, PRK06916, adenosylmethionine--8-amino-7- | 0.001 | |
| TIGR00699 | 464 | TIGR00699, GABAtrns_euk, 4-aminobutyrate aminotran | 0.002 | |
| PRK05965 | 459 | PRK05965, PRK05965, hypothetical protein; Provisio | 0.003 | |
| PRK04612 | 408 | PRK04612, argD, acetylornithine transaminase prote | 0.004 |
| >gnl|CDD|180426 PRK06148, PRK06148, hypothetical protein; Provisional | Back alignment and domain information |
|---|
Score = 137 bits (348), Expect = 1e-39
Identities = 49/78 (62%), Positives = 54/78 (69%)
Query: 5 VGHCHPAVVKAACTQLALLNTNNRFLHDNLVLCARKLASLLPDPLSVCFFVNSGSEANDL 64
VGH HP VV AA Q A LNTN R+LHD +V A +L + LPD L+V FFVNSGSEAN L
Sbjct: 636 VGHAHPRVVAAAARQAARLNTNTRYLHDAIVAYAERLTATLPDGLTVAFFVNSGSEANSL 695
Query: 65 ALRLARVHTNNDDVITQD 82
ALRLAR HT D I D
Sbjct: 696 ALRLARAHTGQRDAIVLD 713
|
Length = 1013 |
| >gnl|CDD|223238 COG0160, GabT, 4-aminobutyrate aminotransferase and related aminotransferases [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|235716 PRK06149, PRK06149, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|99735 cd00610, OAT_like, Acetyl ornithine aminotransferase family | Back alignment and domain information |
|---|
| >gnl|CDD|201078 pfam00202, Aminotran_3, Aminotransferase class-III | Back alignment and domain information |
|---|
| >gnl|CDD|223239 COG0161, BioA, Adenosylmethionine-8-amino-7-oxononanoate aminotransferase [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|227325 COG4992, ArgD, Ornithine/acetylornithine aminotransferase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|235112 PRK03244, argD, acetylornithine aminotransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235056 PRK02627, PRK02627, acetylornithine aminotransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|181234 PRK08117, PRK08117, 4-aminobutyrate aminotransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235599 PRK05769, PRK05769, 4-aminobutyrate aminotransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235687 PRK06062, PRK06062, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|179505 PRK02936, argD, acetylornithine aminotransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|180390 PRK06082, PRK06082, 4-aminobutyrate aminotransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|183175 PRK11522, PRK11522, putrescine--2-oxoglutarate aminotransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|180994 PRK07480, PRK07480, putative aminotransferase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|180401 PRK06105, PRK06105, aminotransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|233098 TIGR00707, argD, transaminase, acetylornithine/succinylornithine family | Back alignment and domain information |
|---|
| >gnl|CDD|181707 PRK09221, PRK09221, beta alanine--pyruvate transaminase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|179933 PRK05093, argD, bifunctional N-succinyldiaminopimelate- aminotransferase/acetylornithine transaminase protein; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|181401 PRK08360, PRK08360, 4-aminobutyrate aminotransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|233000 TIGR00508, bioA, adenosylmethionine-8-amino-7-oxononanoate transaminase | Back alignment and domain information |
|---|
| >gnl|CDD|181493 PRK08593, PRK08593, 4-aminobutyrate aminotransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240281 PTZ00125, PTZ00125, ornithine aminotransferase-like protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235885 PRK06918, PRK06918, 4-aminobutyrate aminotransferase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|235656 PRK05964, PRK05964, adenosylmethionine--8-amino-7-oxononanoate transaminase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223080 COG0001, HemL, Glutamate-1-semialdehyde aminotransferase [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|132415 TIGR03372, putres_am_tran, putrescine aminotransferase | Back alignment and domain information |
|---|
| >gnl|CDD|132290 TIGR03246, arg_catab_astC, succinylornithine transaminase family | Back alignment and domain information |
|---|
| >gnl|CDD|183999 PRK13360, PRK13360, omega amino acid--pyruvate transaminase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236032 PRK07495, PRK07495, 4-aminobutyrate aminotransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235823 PRK06541, PRK06541, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|234607 PRK00062, PRK00062, glutamate-1-semialdehyde aminotransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|130940 TIGR01885, Orn_aminotrans, ornithine aminotransferase | Back alignment and domain information |
|---|
| >gnl|CDD|233100 TIGR00713, hemL, glutamate-1-semialdehyde-2,1-aminomutase | Back alignment and domain information |
|---|
| >gnl|CDD|171472 PRK12403, PRK12403, putative aminotransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235884 PRK06917, PRK06917, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|179270 PRK01278, argD, acetylornithine transaminase protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|183486 PRK12381, PRK12381, bifunctional succinylornithine transaminase/acetylornithine transaminase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|179636 PRK03715, argD, acetylornithine transaminase protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|181078 PRK07678, PRK07678, aminotransferase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|177748 PLN00144, PLN00144, acetylornithine transaminase | Back alignment and domain information |
|---|
| >gnl|CDD|235685 PRK06058, PRK06058, 4-aminobutyrate aminotransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236027 PRK07483, PRK07483, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|129783 TIGR00700, GABAtrnsam, 4-aminobutyrate aminotransferase, prokaryotic type | Back alignment and domain information |
|---|
| >gnl|CDD|182078 PRK09792, PRK09792, 4-aminobutyrate transaminase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|183493 PRK12389, PRK12389, glutamate-1-semialdehyde aminotransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|234848 PRK00854, rocD, ornithine--oxo-acid transaminase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|180441 PRK06173, PRK06173, adenosylmethionine--8-amino-7-oxononanoate transaminase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|179803 PRK04260, PRK04260, acetylornithine aminotransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|180471 PRK06209, PRK06209, glutamate-1-semialdehyde 2,1-aminomutase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|180174 PRK05630, PRK05630, adenosylmethionine--8-amino-7-oxononanoate transaminase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235913 PRK07036, PRK07036, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|168967 PRK07481, PRK07481, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|234803 PRK00615, PRK00615, glutamate-1-semialdehyde aminotransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|168145 PRK05639, PRK05639, 4-aminobutyrate aminotransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236149 PRK08088, PRK08088, 4-aminobutyrate aminotransferase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|180800 PRK07030, PRK07030, adenosylmethionine--8-amino-7-oxononanoate transaminase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|215405 PLN02760, PLN02760, 4-aminobutyrate:pyruvate transaminase | Back alignment and domain information |
|---|
| >gnl|CDD|215335 PLN02624, PLN02624, ornithine-delta-aminotransferase | Back alignment and domain information |
|---|
| >gnl|CDD|178100 PLN02482, PLN02482, glutamate-1-semialdehyde 2,1-aminomutase | Back alignment and domain information |
|---|
| >gnl|CDD|180690 PRK06777, PRK06777, 4-aminobutyrate aminotransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|180746 PRK06916, PRK06916, adenosylmethionine--8-amino-7-oxononanoate transaminase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|129782 TIGR00699, GABAtrns_euk, 4-aminobutyrate aminotransferase, eukaryotic type | Back alignment and domain information |
|---|
| >gnl|CDD|180330 PRK05965, PRK05965, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|179868 PRK04612, argD, acetylornithine transaminase protein; Provisional | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 83 | |||
| COG4992 | 404 | ArgD Ornithine/acetylornithine aminotransferase [A | 99.96 | |
| COG0160 | 447 | GabT 4-aminobutyrate aminotransferase and related | 99.93 | |
| KOG1404|consensus | 442 | 99.93 | ||
| PRK06062 | 451 | hypothetical protein; Provisional | 99.93 | |
| COG0161 | 449 | BioA Adenosylmethionine-8-amino-7-oxononanoate ami | 99.92 | |
| PRK06918 | 451 | 4-aminobutyrate aminotransferase; Reviewed | 99.92 | |
| PRK08360 | 443 | 4-aminobutyrate aminotransferase; Provisional | 99.91 | |
| TIGR03372 | 442 | putres_am_tran putrescine aminotransferase. Member | 99.91 | |
| PRK05965 | 459 | hypothetical protein; Provisional | 99.91 | |
| PRK05639 | 457 | 4-aminobutyrate aminotransferase; Provisional | 99.91 | |
| PRK07482 | 461 | hypothetical protein; Provisional | 99.91 | |
| PRK07495 | 425 | 4-aminobutyrate aminotransferase; Provisional | 99.91 | |
| PRK05964 | 423 | adenosylmethionine--8-amino-7-oxononanoate transam | 99.91 | |
| TIGR00700 | 420 | GABAtrnsam 4-aminobutyrate aminotransferase, proka | 99.91 | |
| PRK08593 | 445 | 4-aminobutyrate aminotransferase; Provisional | 99.91 | |
| PRK05769 | 441 | 4-aminobutyrate aminotransferase; Provisional | 99.91 | |
| PRK11522 | 459 | putrescine--2-oxoglutarate aminotransferase; Provi | 99.91 | |
| PRK07986 | 428 | adenosylmethionine--8-amino-7-oxononanoate transam | 99.91 | |
| PRK06173 | 429 | adenosylmethionine--8-amino-7-oxononanoate transam | 99.91 | |
| PRK07483 | 443 | hypothetical protein; Provisional | 99.91 | |
| PRK06777 | 421 | 4-aminobutyrate aminotransferase; Provisional | 99.91 | |
| PRK00615 | 433 | glutamate-1-semialdehyde aminotransferase; Provisi | 99.9 | |
| PRK06082 | 459 | 4-aminobutyrate aminotransferase; Provisional | 99.9 | |
| PRK08117 | 433 | 4-aminobutyrate aminotransferase; Provisional | 99.9 | |
| PRK13360 | 442 | omega amino acid--pyruvate transaminase; Provision | 99.9 | |
| PRK12389 | 428 | glutamate-1-semialdehyde aminotransferase; Provisi | 99.9 | |
| PRK06917 | 447 | hypothetical protein; Provisional | 99.9 | |
| PRK09792 | 421 | 4-aminobutyrate transaminase; Provisional | 99.9 | |
| PRK07030 | 466 | adenosylmethionine--8-amino-7-oxononanoate transam | 99.9 | |
| PRK05630 | 422 | adenosylmethionine--8-amino-7-oxononanoate transam | 99.9 | |
| PLN02482 | 474 | glutamate-1-semialdehyde 2,1-aminomutase | 99.9 | |
| PRK06916 | 460 | adenosylmethionine--8-amino-7-oxononanoate transam | 99.9 | |
| PRK07481 | 449 | hypothetical protein; Provisional | 99.9 | |
| PRK06148 | 1013 | hypothetical protein; Provisional | 99.9 | |
| PRK09221 | 445 | beta alanine--pyruvate transaminase; Provisional | 99.9 | |
| TIGR00709 | 442 | dat 2,4-diaminobutyrate 4-transaminases. This fami | 99.9 | |
| PRK07036 | 466 | hypothetical protein; Provisional | 99.9 | |
| PRK07678 | 451 | aminotransferase; Validated | 99.89 | |
| PRK07480 | 456 | putative aminotransferase; Validated | 99.89 | |
| PRK06541 | 460 | hypothetical protein; Provisional | 99.89 | |
| PRK08742 | 472 | adenosylmethionine--8-amino-7-oxononanoate transam | 99.89 | |
| PF00202 | 339 | Aminotran_3: Aminotransferase class-III; InterPro: | 99.89 | |
| PRK06105 | 460 | aminotransferase; Provisional | 99.89 | |
| PRK06943 | 453 | adenosylmethionine--8-amino-7-oxononanoate transam | 99.89 | |
| PRK07046 | 453 | aminotransferase; Validated | 99.89 | |
| PRK06058 | 443 | 4-aminobutyrate aminotransferase; Provisional | 99.89 | |
| PRK04612 | 408 | argD acetylornithine transaminase protein; Provisi | 99.89 | |
| PRK08297 | 443 | L-lysine aminotransferase; Provisional | 99.88 | |
| PRK04013 | 364 | argD acetylornithine/acetyl-lysine aminotransferas | 99.88 | |
| PRK06931 | 459 | diaminobutyrate--2-oxoglutarate aminotransferase; | 99.88 | |
| PRK09264 | 425 | diaminobutyrate--2-oxoglutarate aminotransferase; | 99.88 | |
| PRK06938 | 464 | diaminobutyrate--2-oxoglutarate aminotransferase; | 99.88 | |
| PLN00144 | 382 | acetylornithine transaminase | 99.88 | |
| PRK06209 | 431 | glutamate-1-semialdehyde 2,1-aminomutase; Provisio | 99.88 | |
| TIGR03251 | 431 | LAT_fam L-lysine 6-transaminase. Characterized mem | 99.87 | |
| TIGR00699 | 464 | GABAtrns_euk 4-aminobutyrate aminotransferase, euk | 99.87 | |
| COG0001 | 432 | HemL Glutamate-1-semialdehyde aminotransferase [Co | 99.87 | |
| TIGR02407 | 412 | ectoine_ectB diaminobutyrate--2-oxoglutarate amino | 99.87 | |
| PRK06149 | 972 | hypothetical protein; Provisional | 99.87 | |
| PLN02760 | 504 | 4-aminobutyrate:pyruvate transaminase | 99.86 | |
| PRK12403 | 460 | putative aminotransferase; Provisional | 99.86 | |
| TIGR00508 | 427 | bioA adenosylmethionine-8-amino-7-oxononanoate tra | 99.85 | |
| KOG1401|consensus | 433 | 99.84 | ||
| PRK12381 | 406 | bifunctional succinylornithine transaminase/acetyl | 99.84 | |
| TIGR03246 | 397 | arg_catab_astC succinylornithine transaminase fami | 99.84 | |
| PLN02974 | 817 | adenosylmethionine-8-amino-7-oxononanoate transami | 99.84 | |
| PRK04073 | 396 | rocD ornithine--oxo-acid transaminase; Provisional | 99.83 | |
| PLN02624 | 474 | ornithine-delta-aminotransferase | 99.83 | |
| PRK08088 | 425 | 4-aminobutyrate aminotransferase; Validated | 99.83 | |
| TIGR00713 | 423 | hemL glutamate-1-semialdehyde-2,1-aminomutase. Thi | 99.82 | |
| KOG1403|consensus | 452 | 99.82 | ||
| PRK00062 | 426 | glutamate-1-semialdehyde aminotransferase; Provisi | 99.81 | |
| PRK03715 | 395 | argD acetylornithine transaminase protein; Provisi | 99.81 | |
| PRK01278 | 389 | argD acetylornithine transaminase protein; Provisi | 99.78 | |
| PRK05093 | 403 | argD bifunctional N-succinyldiaminopimelate-aminot | 99.78 | |
| PRK00854 | 401 | rocD ornithine--oxo-acid transaminase; Reviewed | 99.75 | |
| PRK02936 | 377 | argD acetylornithine aminotransferase; Provisional | 99.73 | |
| TIGR01885 | 401 | Orn_aminotrans ornithine aminotransferase. This mo | 99.73 | |
| PTZ00125 | 400 | ornithine aminotransferase-like protein; Provision | 99.68 | |
| cd00610 | 413 | OAT_like Acetyl ornithine aminotransferase family. | 99.65 | |
| PRK03244 | 398 | argD acetylornithine aminotransferase; Provisional | 99.64 | |
| PRK04260 | 375 | acetylornithine aminotransferase; Provisional | 99.63 | |
| KOG1402|consensus | 427 | 99.62 | ||
| PRK02627 | 396 | acetylornithine aminotransferase; Provisional | 99.59 | |
| TIGR00707 | 379 | argD acetylornithine and succinylornithine aminotr | 99.39 | |
| PRK07505 | 402 | hypothetical protein; Provisional | 99.3 | |
| KOG1405|consensus | 484 | 99.17 | ||
| PRK13393 | 406 | 5-aminolevulinate synthase; Provisional | 98.76 | |
| PRK09064 | 407 | 5-aminolevulinate synthase; Validated | 98.56 | |
| TIGR01821 | 402 | 5aminolev_synth 5-aminolevulinic acid synthase. Th | 98.49 | |
| PRK13520 | 371 | L-tyrosine decarboxylase; Provisional | 98.17 | |
| COG1104 | 386 | NifS Cysteine sulfinate desulfinase/cysteine desul | 98.16 | |
| cd00613 | 398 | GDC-P Glycine cleavage system P-protein, alpha- an | 98.08 | |
| PRK07179 | 407 | hypothetical protein; Provisional | 98.07 | |
| cd06454 | 349 | KBL_like KBL_like; this family belongs to the pyri | 97.86 | |
| PRK05958 | 385 | 8-amino-7-oxononanoate synthase; Reviewed | 97.71 | |
| PRK13392 | 410 | 5-aminolevulinate synthase; Provisional | 97.66 | |
| KOG1549|consensus | 428 | 97.65 | ||
| PLN02822 | 481 | serine palmitoyltransferase | 97.55 | |
| TIGR01825 | 385 | gly_Cac_T_rel pyridoxal phosphate-dependent acyltr | 97.5 | |
| TIGR03402 | 379 | FeS_nifS cysteine desulfurase NifS. Members of thi | 97.43 | |
| TIGR00858 | 360 | bioF 8-amino-7-oxononanoate synthase. This model r | 97.41 | |
| PLN03032 | 374 | serine decarboxylase; Provisional | 97.3 | |
| TIGR03235 | 353 | DNA_S_dndA cysteine desulfurase DndA. This model d | 97.22 | |
| PLN02651 | 364 | cysteine desulfurase | 97.14 | |
| PRK05937 | 370 | 8-amino-7-oxononanoate synthase; Provisional | 97.08 | |
| TIGR02006 | 402 | IscS cysteine desulfurase IscS. This model represe | 96.9 | |
| PRK02948 | 381 | cysteine desulfurase; Provisional | 96.82 | |
| PRK06225 | 380 | aspartate aminotransferase; Provisional | 96.76 | |
| PRK06939 | 397 | 2-amino-3-ketobutyrate coenzyme A ligase; Provisio | 96.69 | |
| PF00266 | 371 | Aminotran_5: Aminotransferase class-V; InterPro: I | 96.61 | |
| TIGR03576 | 346 | pyridox_MJ0158 pyridoxal phosphate enzyme, MJ0158 | 96.59 | |
| TIGR01788 | 431 | Glu-decarb-GAD glutamate decarboxylase. This model | 96.52 | |
| cd06502 | 338 | TA_like Low-specificity threonine aldolase (TA). T | 96.45 | |
| PRK09331 | 387 | Sep-tRNA:Cys-tRNA synthetase; Provisional | 96.41 | |
| PRK14012 | 404 | cysteine desulfurase; Provisional | 96.35 | |
| cd01494 | 170 | AAT_I Aspartate aminotransferase (AAT) superfamily | 96.27 | |
| TIGR01822 | 393 | 2am3keto_CoA 2-amino-3-ketobutyrate coenzyme A lig | 96.24 | |
| PRK02769 | 380 | histidine decarboxylase; Provisional | 96.15 | |
| TIGR01437 | 363 | selA_rel uncharacterized pyridoxal phosphate-depen | 96.11 | |
| PRK03158 | 359 | histidinol-phosphate aminotransferase; Provisional | 96.06 | |
| COG2008 | 342 | GLY1 Threonine aldolase [Amino acid transport and | 96.03 | |
| cd06452 | 361 | SepCysS Sep-tRNA:Cys-tRNA synthase. This family be | 95.99 | |
| TIGR01141 | 346 | hisC histidinol-phosphate aminotransferase. Histid | 95.91 | |
| PF01041 | 363 | DegT_DnrJ_EryC1: DegT/DnrJ/EryC1/StrS aminotransfe | 95.72 | |
| cd00616 | 352 | AHBA_syn 3-amino-5-hydroxybenzoic acid synthase fa | 95.71 | |
| cd06453 | 373 | SufS_like Cysteine desulfurase (SufS)-like. This f | 95.59 | |
| PF01212 | 290 | Beta_elim_lyase: Beta-eliminating lyase; InterPro: | 95.55 | |
| cd00611 | 355 | PSAT_like Phosphoserine aminotransferase (PSAT) fa | 95.42 | |
| PLN02721 | 353 | threonine aldolase | 95.31 | |
| PRK10874 | 401 | cysteine sulfinate desulfinase; Provisional | 95.29 | |
| TIGR03812 | 373 | tyr_de_CO2_Arch tyrosine decarboxylase MnfA. Membe | 95.25 | |
| cd00609 | 350 | AAT_like Aspartate aminotransferase family. This f | 95.21 | |
| TIGR01977 | 376 | am_tr_V_EF2568 cysteine desulfurase family protein | 95.21 | |
| PLN00145 | 430 | tyrosine/nicotianamine aminotransferase; Provision | 95.04 | |
| PRK08134 | 433 | O-acetylhomoserine aminocarboxypropyltransferase; | 95.04 | |
| TIGR03392 | 398 | FeS_syn_CsdA cysteine desulfurase, catalytic subun | 95.03 | |
| TIGR03403 | 382 | nifS_epsilon cysteine desulfurase, NifS family, ep | 95.0 | |
| PRK10534 | 333 | L-threonine aldolase; Provisional | 94.82 | |
| TIGR01326 | 418 | OAH_OAS_sulfhy OAH/OAS sulfhydrylase. This model d | 94.81 | |
| TIGR01325 | 380 | O_suc_HS_sulf O-succinylhomoserine sulfhydrylase. | 94.69 | |
| PRK09295 | 406 | bifunctional cysteine desulfurase/selenocysteine l | 94.57 | |
| PRK15407 | 438 | lipopolysaccharide biosynthesis protein RfbH; Prov | 94.54 | |
| PLN02187 | 462 | rooty/superroot1 | 94.52 | |
| PRK01533 | 366 | histidinol-phosphate aminotransferase; Validated | 94.48 | |
| PRK09105 | 370 | putative aminotransferase; Provisional | 94.47 | |
| COG0076 | 460 | GadB Glutamate decarboxylase and related PLP-depen | 94.47 | |
| TIGR01365 | 374 | serC_2 phosphoserine aminotransferase, Methanosarc | 94.3 | |
| PRK03080 | 378 | phosphoserine aminotransferase; Provisional | 94.28 | |
| TIGR01366 | 361 | serC_3 phosphoserine aminotransferase, putative. T | 94.25 | |
| TIGR01979 | 403 | sufS cysteine desulfurases, SufS subfamily. This m | 94.22 | |
| PLN02955 | 476 | 8-amino-7-oxononanoate synthase | 94.18 | |
| PRK07050 | 394 | cystathionine beta-lyase; Provisional | 94.15 | |
| PLN02263 | 470 | serine decarboxylase | 94.08 | |
| PRK02731 | 367 | histidinol-phosphate aminotransferase; Validated | 94.07 | |
| PRK06108 | 382 | aspartate aminotransferase; Provisional | 93.95 | |
| TIGR03301 | 355 | PhnW-AepZ 2-aminoethylphosphonate aminotransferase | 93.89 | |
| PRK00451 | 447 | glycine dehydrogenase subunit 1; Validated | 93.86 | |
| PRK03317 | 368 | histidinol-phosphate aminotransferase; Provisional | 93.85 | |
| PRK11658 | 379 | UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate amin | 93.82 | |
| PLN03227 | 392 | serine palmitoyltransferase-like protein; Provisio | 93.75 | |
| PRK05355 | 360 | 3-phosphoserine/phosphohydroxythreonine aminotrans | 93.71 | |
| TIGR01976 | 397 | am_tr_V_VC1184 cysteine desulfurase family protein | 93.69 | |
| PRK14809 | 357 | histidinol-phosphate aminotransferase; Provisional | 93.66 | |
| PRK13034 | 416 | serine hydroxymethyltransferase; Reviewed | 93.6 | |
| PRK14807 | 351 | histidinol-phosphate aminotransferase; Provisional | 93.56 | |
| PLN02855 | 424 | Bifunctional selenocysteine lyase/cysteine desulfu | 93.54 | |
| cd06450 | 345 | DOPA_deC_like DOPA decarboxylase family. This fami | 93.32 | |
| TIGR02379 | 376 | ECA_wecE TDP-4-keto-6-deoxy-D-glucose transaminase | 93.28 | |
| PRK00950 | 361 | histidinol-phosphate aminotransferase; Validated | 93.18 | |
| PRK06358 | 354 | threonine-phosphate decarboxylase; Provisional | 93.16 | |
| cd00614 | 369 | CGS_like CGS_like: Cystathionine gamma-synthase is | 93.09 | |
| PRK07682 | 378 | hypothetical protein; Validated | 92.95 | |
| KOG0259|consensus | 447 | 92.94 | ||
| COG0156 | 388 | BioF 7-keto-8-aminopelargonate synthetase and rela | 92.89 | |
| PRK07812 | 436 | O-acetylhomoserine aminocarboxypropyltransferase; | 92.76 | |
| TIGR00474 | 454 | selA seryl-tRNA(sec) selenium transferase. In bact | 92.66 | |
| PRK08248 | 431 | O-acetylhomoserine aminocarboxypropyltransferase; | 92.62 | |
| PRK02610 | 374 | histidinol-phosphate aminotransferase; Provisional | 92.55 | |
| PRK08861 | 388 | cystathionine gamma-synthase; Provisional | 92.49 | |
| PRK03967 | 337 | histidinol-phosphate aminotransferase; Provisional | 92.47 | |
| PRK08133 | 390 | O-succinylhomoserine sulfhydrylase; Validated | 92.45 | |
| PRK14808 | 335 | histidinol-phosphate aminotransferase; Provisional | 92.41 | |
| PRK11706 | 375 | TDP-4-oxo-6-deoxy-D-glucose transaminase; Provisio | 92.37 | |
| TIGR01265 | 403 | tyr_nico_aTase tyrosine/nicotianamine aminotransfe | 92.33 | |
| PRK05387 | 353 | histidinol-phosphate aminotransferase; Provisional | 92.22 | |
| TIGR01364 | 349 | serC_1 phosphoserine aminotransferase. This model | 92.18 | |
| PRK06702 | 432 | O-acetylhomoserine aminocarboxypropyltransferase; | 92.16 | |
| TIGR01814 | 406 | kynureninase kynureninase. This model describes ky | 92.13 | |
| PRK08056 | 356 | threonine-phosphate decarboxylase; Provisional | 92.08 | |
| TIGR02326 | 363 | transamin_PhnW 2-aminoethylphosphonate--pyruvate t | 91.89 | |
| cd06451 | 356 | AGAT_like Alanine-glyoxylate aminotransferase (AGA | 91.71 | |
| COG0399 | 374 | WecE Predicted pyridoxal phosphate-dependent enzym | 91.71 | |
| PRK07908 | 349 | hypothetical protein; Provisional | 91.62 | |
| TIGR02080 | 382 | O_succ_thio_ly O-succinylhomoserine (thiol)-lyase. | 91.44 | |
| PRK04311 | 464 | selenocysteine synthase; Provisional | 91.39 | |
| PRK08153 | 369 | histidinol-phosphate aminotransferase; Provisional | 91.38 | |
| PLN02409 | 401 | serine--glyoxylate aminotransaminase | 91.14 | |
| PLN03026 | 380 | histidinol-phosphate aminotransferase; Provisional | 91.05 | |
| PRK07392 | 360 | threonine-phosphate decarboxylase; Validated | 90.92 | |
| PRK06767 | 386 | methionine gamma-lyase; Provisional | 90.76 | |
| PRK07269 | 364 | cystathionine gamma-synthase; Reviewed | 90.53 | |
| PLN02242 | 418 | methionine gamma-lyase | 90.53 | |
| PRK06084 | 425 | O-acetylhomoserine aminocarboxypropyltransferase; | 90.51 | |
| PRK05994 | 427 | O-acetylhomoserine aminocarboxypropyltransferase; | 90.46 | |
| COG0520 | 405 | csdA Selenocysteine lyase/Cysteine desulfurase [Po | 90.37 | |
| PLN02452 | 365 | phosphoserine transaminase | 90.29 | |
| PLN02880 | 490 | tyrosine decarboxylase | 90.2 | |
| PRK00011 | 416 | glyA serine hydroxymethyltransferase; Reviewed | 90.13 | |
| PRK05166 | 371 | histidinol-phosphate aminotransferase; Provisional | 90.1 | |
| TIGR03588 | 380 | PseC UDP-4-keto-6-deoxy-N-acetylglucosamine 4-amin | 89.98 | |
| PTZ00094 | 452 | serine hydroxymethyltransferase; Provisional | 89.95 | |
| PRK07503 | 403 | methionine gamma-lyase; Provisional | 89.66 | |
| TIGR01328 | 391 | met_gam_lyase methionine gamma-lyase. This model d | 89.5 | |
| PLN02656 | 409 | tyrosine transaminase | 89.3 | |
| TIGR01264 | 401 | tyr_amTase_E tyrosine aminotransferase, eukaryotic | 89.27 | |
| PRK05764 | 393 | aspartate aminotransferase; Provisional | 89.19 | |
| PRK04870 | 356 | histidinol-phosphate aminotransferase; Provisional | 89.19 | |
| PRK12462 | 364 | phosphoserine aminotransferase; Provisional | 89.14 | |
| PF00282 | 373 | Pyridoxal_deC: Pyridoxal-dependent decarboxylase c | 89.13 | |
| TIGR01324 | 377 | cysta_beta_ly_B cystathionine beta-lyase, bacteria | 88.72 | |
| PRK13479 | 368 | 2-aminoethylphosphonate--pyruvate transaminase; Pr | 88.33 | |
| PRK08363 | 398 | alanine aminotransferase; Validated | 88.18 | |
| PRK08960 | 387 | hypothetical protein; Provisional | 88.16 | |
| PRK07568 | 397 | aspartate aminotransferase; Provisional | 87.99 | |
| PRK08361 | 391 | aspartate aminotransferase; Provisional | 87.9 | |
| PRK09082 | 386 | methionine aminotransferase; Validated | 87.85 | |
| PLN02590 | 539 | probable tyrosine decarboxylase | 87.84 | |
| PRK05968 | 389 | hypothetical protein; Provisional | 87.78 | |
| TIGR03811 | 608 | tyr_de_CO2_Ent tyrosine decarboxylase, Enterococcu | 87.76 | |
| PRK07810 | 403 | O-succinylhomoserine sulfhydrylase; Provisional | 87.62 | |
| PRK12414 | 384 | putative aminotransferase; Provisional | 87.58 | |
| PRK06434 | 384 | cystathionine gamma-lyase; Validated | 87.46 | |
| TIGR02539 | 370 | SepCysS Sep-tRNA:Cys-tRNA synthase. Aminoacylation | 86.83 | |
| PRK01688 | 351 | histidinol-phosphate aminotransferase; Provisional | 86.78 | |
| PRK03321 | 352 | putative aminotransferase; Provisional | 86.54 | |
| PRK05613 | 437 | O-acetylhomoserine aminocarboxypropyltransferase; | 86.38 | |
| PRK09028 | 394 | cystathionine beta-lyase; Provisional | 86.33 | |
| PRK07582 | 366 | cystathionine gamma-lyase; Validated | 86.27 | |
| COG0075 | 383 | Serine-pyruvate aminotransferase/archaeal aspartat | 86.13 | |
| PRK08247 | 366 | cystathionine gamma-synthase; Reviewed | 85.85 | |
| PRK05939 | 397 | hypothetical protein; Provisional | 85.75 | |
| PRK05957 | 389 | aspartate aminotransferase; Provisional | 85.75 | |
| PRK07683 | 387 | aminotransferase A; Validated | 85.7 | |
| PRK06107 | 402 | aspartate aminotransferase; Provisional | 85.31 | |
| PLN00143 | 409 | tyrosine/nicotianamine aminotransferase; Provision | 85.31 | |
| PRK08249 | 398 | cystathionine gamma-synthase; Provisional | 85.19 | |
| KOG2433|consensus | 577 | 85.14 | ||
| cd00378 | 402 | SHMT Serine-glycine hydroxymethyltransferase (SHMT | 85.06 | |
| PRK13355 | 517 | bifunctional HTH-domain containing protein/aminotr | 85.01 | |
| COG0079 | 356 | HisC Histidinol-phosphate/aromatic aminotransferas | 84.94 | |
| PRK08574 | 385 | cystathionine gamma-synthase; Provisional | 84.75 | |
| cd00615 | 294 | Orn_deC_like Ornithine decarboxylase family. This | 84.56 | |
| PRK06234 | 400 | methionine gamma-lyase; Provisional | 84.55 | |
| PRK08045 | 386 | cystathionine gamma-synthase; Provisional | 84.48 | |
| PTZ00433 | 412 | tyrosine aminotransferase; Provisional | 83.98 | |
| PLN02483 | 489 | serine palmitoyltransferase | 83.88 | |
| PRK06176 | 380 | cystathionine gamma-synthase/cystathionine beta-ly | 83.67 | |
| PRK06207 | 405 | aspartate aminotransferase; Provisional | 83.31 | |
| PRK07777 | 387 | aminotransferase; Validated | 83.17 | |
| PRK07811 | 388 | cystathionine gamma-synthase; Provisional | 83.03 | |
| PRK09265 | 404 | aminotransferase AlaT; Validated | 82.74 | |
| PRK07504 | 398 | O-succinylhomoserine sulfhydrylase; Reviewed | 82.65 | |
| PRK06425 | 332 | histidinol-phosphate aminotransferase; Validated | 82.27 | |
| PRK07324 | 373 | transaminase; Validated | 82.15 | |
| PRK08354 | 311 | putative aminotransferase; Provisional | 81.75 | |
| PRK13238 | 460 | tnaA tryptophanase/L-cysteine desulfhydrase, PLP-d | 81.53 | |
| TIGR03799 | 522 | NOD_PanD_pyr putative pyridoxal-dependent aspartat | 81.52 | |
| PRK08114 | 395 | cystathionine beta-lyase; Provisional | 81.51 | |
| PRK04366 | 481 | glycine dehydrogenase subunit 2; Validated | 80.7 | |
| TIGR01329 | 378 | cysta_beta_ly_E cystathionine beta-lyase, eukaryot | 80.68 | |
| PRK08776 | 405 | cystathionine gamma-synthase; Provisional | 80.14 |
| >COG4992 ArgD Ornithine/acetylornithine aminotransferase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
Probab=99.96 E-value=1.8e-28 Score=166.25 Aligned_cols=82 Identities=39% Similarity=0.546 Sum_probs=77.5
Q ss_pred CccCCCCCCHHHHHHHHHHHHhh-ccCCCCcchHHHHHHHHHHhhCCCCCCeEEeeCChHHHHHHHHHHHHhhcC---CC
Q psy6206 1 MSLPVGHCHPAVVKAACTQLALL-NTNNRFLHDNLVLCARKLASLLPDPLSVCFFVNSGSEANDLALRLARVHTN---ND 76 (83)
Q Consensus 1 ~~~~lGh~~p~i~~a~~~~~~~~-~~~~~~~~~~~~~la~~l~~~~p~~~~~v~f~~sGseA~e~Alk~ar~~~~---r~ 76 (83)
+++++||+||.|++++.+|++++ +.++.|.+++..+|+++|++.+| ..++|||+|||+||||+|||+||+|++ |.
T Consensus 52 av~~lGH~hP~iv~al~~Q~~kl~h~sn~~~~~~~~~la~~L~~~s~-~~d~vff~NSGaEA~EaAiKlARk~~~~~~k~ 130 (404)
T COG4992 52 AVNNLGHCHPALVEALKEQAEKLWHVSNLFYNEPQAELAEKLVELSP-FADRVFFCNSGAEANEAALKLARKYTGDPEKS 130 (404)
T ss_pred eeeccCCCCHHHHHHHHHHHHHhhhcccccCChHHHHHHHHHHhhCc-cccEEEEcCCcHHHHHHHHHHHHHHcCCCCCc
Confidence 47899999999999999999999 66788999999999999999999 789999999999999999999999998 88
Q ss_pred ceEEecC
Q psy6206 77 DVITQDQ 83 (83)
Q Consensus 77 ~ii~~~~ 83 (83)
+||+|+|
T Consensus 131 ~Iia~~n 137 (404)
T COG4992 131 KIIAFEN 137 (404)
T ss_pred EEEEEcC
Confidence 9999986
|
|
| >COG0160 GabT 4-aminobutyrate aminotransferase and related aminotransferases [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >KOG1404|consensus | Back alignment and domain information |
|---|
| >PRK06062 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >COG0161 BioA Adenosylmethionine-8-amino-7-oxononanoate aminotransferase [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >PRK06918 4-aminobutyrate aminotransferase; Reviewed | Back alignment and domain information |
|---|
| >PRK08360 4-aminobutyrate aminotransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR03372 putres_am_tran putrescine aminotransferase | Back alignment and domain information |
|---|
| >PRK05965 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK05639 4-aminobutyrate aminotransferase; Provisional | Back alignment and domain information |
|---|
| >PRK07482 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK07495 4-aminobutyrate aminotransferase; Provisional | Back alignment and domain information |
|---|
| >PRK05964 adenosylmethionine--8-amino-7-oxononanoate transaminase; Provisional | Back alignment and domain information |
|---|
| >TIGR00700 GABAtrnsam 4-aminobutyrate aminotransferase, prokaryotic type | Back alignment and domain information |
|---|
| >PRK08593 4-aminobutyrate aminotransferase; Provisional | Back alignment and domain information |
|---|
| >PRK05769 4-aminobutyrate aminotransferase; Provisional | Back alignment and domain information |
|---|
| >PRK11522 putrescine--2-oxoglutarate aminotransferase; Provisional | Back alignment and domain information |
|---|
| >PRK07986 adenosylmethionine--8-amino-7-oxononanoate transaminase; Validated | Back alignment and domain information |
|---|
| >PRK06173 adenosylmethionine--8-amino-7-oxononanoate transaminase; Provisional | Back alignment and domain information |
|---|
| >PRK07483 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK06777 4-aminobutyrate aminotransferase; Provisional | Back alignment and domain information |
|---|
| >PRK00615 glutamate-1-semialdehyde aminotransferase; Provisional | Back alignment and domain information |
|---|
| >PRK06082 4-aminobutyrate aminotransferase; Provisional | Back alignment and domain information |
|---|
| >PRK08117 4-aminobutyrate aminotransferase; Provisional | Back alignment and domain information |
|---|
| >PRK13360 omega amino acid--pyruvate transaminase; Provisional | Back alignment and domain information |
|---|
| >PRK12389 glutamate-1-semialdehyde aminotransferase; Provisional | Back alignment and domain information |
|---|
| >PRK06917 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK09792 4-aminobutyrate transaminase; Provisional | Back alignment and domain information |
|---|
| >PRK07030 adenosylmethionine--8-amino-7-oxononanoate transaminase; Provisional | Back alignment and domain information |
|---|
| >PRK05630 adenosylmethionine--8-amino-7-oxononanoate transaminase; Provisional | Back alignment and domain information |
|---|
| >PLN02482 glutamate-1-semialdehyde 2,1-aminomutase | Back alignment and domain information |
|---|
| >PRK06916 adenosylmethionine--8-amino-7-oxononanoate transaminase; Provisional | Back alignment and domain information |
|---|
| >PRK07481 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK06148 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK09221 beta alanine--pyruvate transaminase; Provisional | Back alignment and domain information |
|---|
| >TIGR00709 dat 2,4-diaminobutyrate 4-transaminases | Back alignment and domain information |
|---|
| >PRK07036 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK07678 aminotransferase; Validated | Back alignment and domain information |
|---|
| >PRK07480 putative aminotransferase; Validated | Back alignment and domain information |
|---|
| >PRK06541 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK08742 adenosylmethionine--8-amino-7-oxononanoate transaminase; Provisional | Back alignment and domain information |
|---|
| >PF00202 Aminotran_3: Aminotransferase class-III; InterPro: IPR005814 Aminotransferases share certain mechanistic features with other pyridoxalphosphate-dependent enzymes, such as the covalent binding of the pyridoxalphosphate group to a lysine residue | Back alignment and domain information |
|---|
| >PRK06105 aminotransferase; Provisional | Back alignment and domain information |
|---|
| >PRK06943 adenosylmethionine--8-amino-7-oxononanoate transaminase; Provisional | Back alignment and domain information |
|---|
| >PRK07046 aminotransferase; Validated | Back alignment and domain information |
|---|
| >PRK06058 4-aminobutyrate aminotransferase; Provisional | Back alignment and domain information |
|---|
| >PRK04612 argD acetylornithine transaminase protein; Provisional | Back alignment and domain information |
|---|
| >PRK08297 L-lysine aminotransferase; Provisional | Back alignment and domain information |
|---|
| >PRK04013 argD acetylornithine/acetyl-lysine aminotransferase; Provisional | Back alignment and domain information |
|---|
| >PRK06931 diaminobutyrate--2-oxoglutarate aminotransferase; Provisional | Back alignment and domain information |
|---|
| >PRK09264 diaminobutyrate--2-oxoglutarate aminotransferase; Validated | Back alignment and domain information |
|---|
| >PRK06938 diaminobutyrate--2-oxoglutarate aminotransferase; Provisional | Back alignment and domain information |
|---|
| >PLN00144 acetylornithine transaminase | Back alignment and domain information |
|---|
| >PRK06209 glutamate-1-semialdehyde 2,1-aminomutase; Provisional | Back alignment and domain information |
|---|
| >TIGR03251 LAT_fam L-lysine 6-transaminase | Back alignment and domain information |
|---|
| >TIGR00699 GABAtrns_euk 4-aminobutyrate aminotransferase, eukaryotic type | Back alignment and domain information |
|---|
| >COG0001 HemL Glutamate-1-semialdehyde aminotransferase [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >TIGR02407 ectoine_ectB diaminobutyrate--2-oxoglutarate aminotransferase | Back alignment and domain information |
|---|
| >PRK06149 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PLN02760 4-aminobutyrate:pyruvate transaminase | Back alignment and domain information |
|---|
| >PRK12403 putative aminotransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR00508 bioA adenosylmethionine-8-amino-7-oxononanoate transaminase | Back alignment and domain information |
|---|
| >KOG1401|consensus | Back alignment and domain information |
|---|
| >PRK12381 bifunctional succinylornithine transaminase/acetylornithine transaminase; Provisional | Back alignment and domain information |
|---|
| >TIGR03246 arg_catab_astC succinylornithine transaminase family | Back alignment and domain information |
|---|
| >PLN02974 adenosylmethionine-8-amino-7-oxononanoate transaminase | Back alignment and domain information |
|---|
| >PRK04073 rocD ornithine--oxo-acid transaminase; Provisional | Back alignment and domain information |
|---|
| >PLN02624 ornithine-delta-aminotransferase | Back alignment and domain information |
|---|
| >PRK08088 4-aminobutyrate aminotransferase; Validated | Back alignment and domain information |
|---|
| >TIGR00713 hemL glutamate-1-semialdehyde-2,1-aminomutase | Back alignment and domain information |
|---|
| >KOG1403|consensus | Back alignment and domain information |
|---|
| >PRK00062 glutamate-1-semialdehyde aminotransferase; Provisional | Back alignment and domain information |
|---|
| >PRK03715 argD acetylornithine transaminase protein; Provisional | Back alignment and domain information |
|---|
| >PRK01278 argD acetylornithine transaminase protein; Provisional | Back alignment and domain information |
|---|
| >PRK05093 argD bifunctional N-succinyldiaminopimelate-aminotransferase/acetylornithine transaminase protein; Reviewed | Back alignment and domain information |
|---|
| >PRK00854 rocD ornithine--oxo-acid transaminase; Reviewed | Back alignment and domain information |
|---|
| >PRK02936 argD acetylornithine aminotransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR01885 Orn_aminotrans ornithine aminotransferase | Back alignment and domain information |
|---|
| >PTZ00125 ornithine aminotransferase-like protein; Provisional | Back alignment and domain information |
|---|
| >cd00610 OAT_like Acetyl ornithine aminotransferase family | Back alignment and domain information |
|---|
| >PRK03244 argD acetylornithine aminotransferase; Provisional | Back alignment and domain information |
|---|
| >PRK04260 acetylornithine aminotransferase; Provisional | Back alignment and domain information |
|---|
| >KOG1402|consensus | Back alignment and domain information |
|---|
| >PRK02627 acetylornithine aminotransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR00707 argD acetylornithine and succinylornithine aminotransferases | Back alignment and domain information |
|---|
| >PRK07505 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >KOG1405|consensus | Back alignment and domain information |
|---|
| >PRK13393 5-aminolevulinate synthase; Provisional | Back alignment and domain information |
|---|
| >PRK09064 5-aminolevulinate synthase; Validated | Back alignment and domain information |
|---|
| >TIGR01821 5aminolev_synth 5-aminolevulinic acid synthase | Back alignment and domain information |
|---|
| >PRK13520 L-tyrosine decarboxylase; Provisional | Back alignment and domain information |
|---|
| >COG1104 NifS Cysteine sulfinate desulfinase/cysteine desulfurase and related enzymes [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >cd00613 GDC-P Glycine cleavage system P-protein, alpha- and beta-subunits | Back alignment and domain information |
|---|
| >PRK07179 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >cd06454 KBL_like KBL_like; this family belongs to the pyridoxal phosphate (PLP)-dependent aspartate aminotransferase superfamily (fold I) | Back alignment and domain information |
|---|
| >PRK05958 8-amino-7-oxononanoate synthase; Reviewed | Back alignment and domain information |
|---|
| >PRK13392 5-aminolevulinate synthase; Provisional | Back alignment and domain information |
|---|
| >KOG1549|consensus | Back alignment and domain information |
|---|
| >PLN02822 serine palmitoyltransferase | Back alignment and domain information |
|---|
| >TIGR01825 gly_Cac_T_rel pyridoxal phosphate-dependent acyltransferase, putative | Back alignment and domain information |
|---|
| >TIGR03402 FeS_nifS cysteine desulfurase NifS | Back alignment and domain information |
|---|
| >TIGR00858 bioF 8-amino-7-oxononanoate synthase | Back alignment and domain information |
|---|
| >PLN03032 serine decarboxylase; Provisional | Back alignment and domain information |
|---|
| >TIGR03235 DNA_S_dndA cysteine desulfurase DndA | Back alignment and domain information |
|---|
| >PLN02651 cysteine desulfurase | Back alignment and domain information |
|---|
| >PRK05937 8-amino-7-oxononanoate synthase; Provisional | Back alignment and domain information |
|---|
| >TIGR02006 IscS cysteine desulfurase IscS | Back alignment and domain information |
|---|
| >PRK02948 cysteine desulfurase; Provisional | Back alignment and domain information |
|---|
| >PRK06225 aspartate aminotransferase; Provisional | Back alignment and domain information |
|---|
| >PRK06939 2-amino-3-ketobutyrate coenzyme A ligase; Provisional | Back alignment and domain information |
|---|
| >PF00266 Aminotran_5: Aminotransferase class-V; InterPro: IPR000192 Aminotransferases share certain mechanistic features with other pyridoxal- phosphate dependent enzymes, such as the covalent binding of the pyridoxal- phosphate group to a lysine residue | Back alignment and domain information |
|---|
| >TIGR03576 pyridox_MJ0158 pyridoxal phosphate enzyme, MJ0158 family | Back alignment and domain information |
|---|
| >TIGR01788 Glu-decarb-GAD glutamate decarboxylase | Back alignment and domain information |
|---|
| >cd06502 TA_like Low-specificity threonine aldolase (TA) | Back alignment and domain information |
|---|
| >PRK09331 Sep-tRNA:Cys-tRNA synthetase; Provisional | Back alignment and domain information |
|---|
| >PRK14012 cysteine desulfurase; Provisional | Back alignment and domain information |
|---|
| >cd01494 AAT_I Aspartate aminotransferase (AAT) superfamily (fold type I) of pyridoxal phosphate (PLP)-dependent enzymes | Back alignment and domain information |
|---|
| >TIGR01822 2am3keto_CoA 2-amino-3-ketobutyrate coenzyme A ligase | Back alignment and domain information |
|---|
| >PRK02769 histidine decarboxylase; Provisional | Back alignment and domain information |
|---|
| >TIGR01437 selA_rel uncharacterized pyridoxal phosphate-dependent enzyme | Back alignment and domain information |
|---|
| >PRK03158 histidinol-phosphate aminotransferase; Provisional | Back alignment and domain information |
|---|
| >COG2008 GLY1 Threonine aldolase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >cd06452 SepCysS Sep-tRNA:Cys-tRNA synthase | Back alignment and domain information |
|---|
| >TIGR01141 hisC histidinol-phosphate aminotransferase | Back alignment and domain information |
|---|
| >PF01041 DegT_DnrJ_EryC1: DegT/DnrJ/EryC1/StrS aminotransferase family; InterPro: IPR000653 This entry represents a family that are probably all pyridoxal-phosphate-dependent aminotransferase enzymes with a variety of molecular functions | Back alignment and domain information |
|---|
| >cd00616 AHBA_syn 3-amino-5-hydroxybenzoic acid synthase family (AHBA_syn) | Back alignment and domain information |
|---|
| >cd06453 SufS_like Cysteine desulfurase (SufS)-like | Back alignment and domain information |
|---|
| >PF01212 Beta_elim_lyase: Beta-eliminating lyase; InterPro: IPR001597 This domain is found in many tryptophanases (tryptophan indole-lyase, TNase), tyrosine phenol-lyases (TPL) and threonine aldolases | Back alignment and domain information |
|---|
| >cd00611 PSAT_like Phosphoserine aminotransferase (PSAT) family | Back alignment and domain information |
|---|
| >PLN02721 threonine aldolase | Back alignment and domain information |
|---|
| >PRK10874 cysteine sulfinate desulfinase; Provisional | Back alignment and domain information |
|---|
| >TIGR03812 tyr_de_CO2_Arch tyrosine decarboxylase MnfA | Back alignment and domain information |
|---|
| >cd00609 AAT_like Aspartate aminotransferase family | Back alignment and domain information |
|---|
| >TIGR01977 am_tr_V_EF2568 cysteine desulfurase family protein | Back alignment and domain information |
|---|
| >PLN00145 tyrosine/nicotianamine aminotransferase; Provisional | Back alignment and domain information |
|---|
| >PRK08134 O-acetylhomoserine aminocarboxypropyltransferase; Validated | Back alignment and domain information |
|---|
| >TIGR03392 FeS_syn_CsdA cysteine desulfurase, catalytic subunit CsdA | Back alignment and domain information |
|---|
| >TIGR03403 nifS_epsilon cysteine desulfurase, NifS family, epsilon proteobacteria type | Back alignment and domain information |
|---|
| >PRK10534 L-threonine aldolase; Provisional | Back alignment and domain information |
|---|
| >TIGR01326 OAH_OAS_sulfhy OAH/OAS sulfhydrylase | Back alignment and domain information |
|---|
| >TIGR01325 O_suc_HS_sulf O-succinylhomoserine sulfhydrylase | Back alignment and domain information |
|---|
| >PRK09295 bifunctional cysteine desulfurase/selenocysteine lyase; Validated | Back alignment and domain information |
|---|
| >PRK15407 lipopolysaccharide biosynthesis protein RfbH; Provisional | Back alignment and domain information |
|---|
| >PLN02187 rooty/superroot1 | Back alignment and domain information |
|---|
| >PRK01533 histidinol-phosphate aminotransferase; Validated | Back alignment and domain information |
|---|
| >PRK09105 putative aminotransferase; Provisional | Back alignment and domain information |
|---|
| >COG0076 GadB Glutamate decarboxylase and related PLP-dependent proteins [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR01365 serC_2 phosphoserine aminotransferase, Methanosarcina type | Back alignment and domain information |
|---|
| >PRK03080 phosphoserine aminotransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR01366 serC_3 phosphoserine aminotransferase, putative | Back alignment and domain information |
|---|
| >TIGR01979 sufS cysteine desulfurases, SufS subfamily | Back alignment and domain information |
|---|
| >PLN02955 8-amino-7-oxononanoate synthase | Back alignment and domain information |
|---|
| >PRK07050 cystathionine beta-lyase; Provisional | Back alignment and domain information |
|---|
| >PLN02263 serine decarboxylase | Back alignment and domain information |
|---|
| >PRK02731 histidinol-phosphate aminotransferase; Validated | Back alignment and domain information |
|---|
| >PRK06108 aspartate aminotransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR03301 PhnW-AepZ 2-aminoethylphosphonate aminotransferase | Back alignment and domain information |
|---|
| >PRK00451 glycine dehydrogenase subunit 1; Validated | Back alignment and domain information |
|---|
| >PRK03317 histidinol-phosphate aminotransferase; Provisional | Back alignment and domain information |
|---|
| >PRK11658 UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase; Provisional | Back alignment and domain information |
|---|
| >PLN03227 serine palmitoyltransferase-like protein; Provisional | Back alignment and domain information |
|---|
| >PRK05355 3-phosphoserine/phosphohydroxythreonine aminotransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR01976 am_tr_V_VC1184 cysteine desulfurase family protein, VC1184 subfamily | Back alignment and domain information |
|---|
| >PRK14809 histidinol-phosphate aminotransferase; Provisional | Back alignment and domain information |
|---|
| >PRK13034 serine hydroxymethyltransferase; Reviewed | Back alignment and domain information |
|---|
| >PRK14807 histidinol-phosphate aminotransferase; Provisional | Back alignment and domain information |
|---|
| >PLN02855 Bifunctional selenocysteine lyase/cysteine desulfurase | Back alignment and domain information |
|---|
| >cd06450 DOPA_deC_like DOPA decarboxylase family | Back alignment and domain information |
|---|
| >TIGR02379 ECA_wecE TDP-4-keto-6-deoxy-D-glucose transaminase | Back alignment and domain information |
|---|
| >PRK00950 histidinol-phosphate aminotransferase; Validated | Back alignment and domain information |
|---|
| >PRK06358 threonine-phosphate decarboxylase; Provisional | Back alignment and domain information |
|---|
| >cd00614 CGS_like CGS_like: Cystathionine gamma-synthase is a PLP dependent enzyme and catalyzes the committed step of methionine biosynthesis | Back alignment and domain information |
|---|
| >PRK07682 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >KOG0259|consensus | Back alignment and domain information |
|---|
| >COG0156 BioF 7-keto-8-aminopelargonate synthetase and related enzymes [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >PRK07812 O-acetylhomoserine aminocarboxypropyltransferase; Validated | Back alignment and domain information |
|---|
| >TIGR00474 selA seryl-tRNA(sec) selenium transferase | Back alignment and domain information |
|---|
| >PRK08248 O-acetylhomoserine aminocarboxypropyltransferase; Validated | Back alignment and domain information |
|---|
| >PRK02610 histidinol-phosphate aminotransferase; Provisional | Back alignment and domain information |
|---|
| >PRK08861 cystathionine gamma-synthase; Provisional | Back alignment and domain information |
|---|
| >PRK03967 histidinol-phosphate aminotransferase; Provisional | Back alignment and domain information |
|---|
| >PRK08133 O-succinylhomoserine sulfhydrylase; Validated | Back alignment and domain information |
|---|
| >PRK14808 histidinol-phosphate aminotransferase; Provisional | Back alignment and domain information |
|---|
| >PRK11706 TDP-4-oxo-6-deoxy-D-glucose transaminase; Provisional | Back alignment and domain information |
|---|
| >TIGR01265 tyr_nico_aTase tyrosine/nicotianamine aminotransferases | Back alignment and domain information |
|---|
| >PRK05387 histidinol-phosphate aminotransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR01364 serC_1 phosphoserine aminotransferase | Back alignment and domain information |
|---|
| >PRK06702 O-acetylhomoserine aminocarboxypropyltransferase; Validated | Back alignment and domain information |
|---|
| >TIGR01814 kynureninase kynureninase | Back alignment and domain information |
|---|
| >PRK08056 threonine-phosphate decarboxylase; Provisional | Back alignment and domain information |
|---|
| >TIGR02326 transamin_PhnW 2-aminoethylphosphonate--pyruvate transaminase | Back alignment and domain information |
|---|
| >cd06451 AGAT_like Alanine-glyoxylate aminotransferase (AGAT) family | Back alignment and domain information |
|---|
| >COG0399 WecE Predicted pyridoxal phosphate-dependent enzyme apparently involved in regulation of cell wall biogenesis [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >PRK07908 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >TIGR02080 O_succ_thio_ly O-succinylhomoserine (thiol)-lyase | Back alignment and domain information |
|---|
| >PRK04311 selenocysteine synthase; Provisional | Back alignment and domain information |
|---|
| >PRK08153 histidinol-phosphate aminotransferase; Provisional | Back alignment and domain information |
|---|
| >PLN02409 serine--glyoxylate aminotransaminase | Back alignment and domain information |
|---|
| >PLN03026 histidinol-phosphate aminotransferase; Provisional | Back alignment and domain information |
|---|
| >PRK07392 threonine-phosphate decarboxylase; Validated | Back alignment and domain information |
|---|
| >PRK06767 methionine gamma-lyase; Provisional | Back alignment and domain information |
|---|
| >PRK07269 cystathionine gamma-synthase; Reviewed | Back alignment and domain information |
|---|
| >PLN02242 methionine gamma-lyase | Back alignment and domain information |
|---|
| >PRK06084 O-acetylhomoserine aminocarboxypropyltransferase; Validated | Back alignment and domain information |
|---|
| >PRK05994 O-acetylhomoserine aminocarboxypropyltransferase; Validated | Back alignment and domain information |
|---|
| >COG0520 csdA Selenocysteine lyase/Cysteine desulfurase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PLN02452 phosphoserine transaminase | Back alignment and domain information |
|---|
| >PLN02880 tyrosine decarboxylase | Back alignment and domain information |
|---|
| >PRK00011 glyA serine hydroxymethyltransferase; Reviewed | Back alignment and domain information |
|---|
| >PRK05166 histidinol-phosphate aminotransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR03588 PseC UDP-4-keto-6-deoxy-N-acetylglucosamine 4-aminotransferase | Back alignment and domain information |
|---|
| >PTZ00094 serine hydroxymethyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK07503 methionine gamma-lyase; Provisional | Back alignment and domain information |
|---|
| >TIGR01328 met_gam_lyase methionine gamma-lyase | Back alignment and domain information |
|---|
| >PLN02656 tyrosine transaminase | Back alignment and domain information |
|---|
| >TIGR01264 tyr_amTase_E tyrosine aminotransferase, eukaryotic | Back alignment and domain information |
|---|
| >PRK05764 aspartate aminotransferase; Provisional | Back alignment and domain information |
|---|
| >PRK04870 histidinol-phosphate aminotransferase; Provisional | Back alignment and domain information |
|---|
| >PRK12462 phosphoserine aminotransferase; Provisional | Back alignment and domain information |
|---|
| >PF00282 Pyridoxal_deC: Pyridoxal-dependent decarboxylase conserved domain; InterPro: IPR002129 Pyridoxal phosphate is the active form of vitamin B6 (pyridoxine or pyridoxal) | Back alignment and domain information |
|---|
| >TIGR01324 cysta_beta_ly_B cystathionine beta-lyase, bacterial | Back alignment and domain information |
|---|
| >PRK13479 2-aminoethylphosphonate--pyruvate transaminase; Provisional | Back alignment and domain information |
|---|
| >PRK08363 alanine aminotransferase; Validated | Back alignment and domain information |
|---|
| >PRK08960 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK07568 aspartate aminotransferase; Provisional | Back alignment and domain information |
|---|
| >PRK08361 aspartate aminotransferase; Provisional | Back alignment and domain information |
|---|
| >PRK09082 methionine aminotransferase; Validated | Back alignment and domain information |
|---|
| >PLN02590 probable tyrosine decarboxylase | Back alignment and domain information |
|---|
| >PRK05968 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >TIGR03811 tyr_de_CO2_Ent tyrosine decarboxylase, Enterococcus type | Back alignment and domain information |
|---|
| >PRK07810 O-succinylhomoserine sulfhydrylase; Provisional | Back alignment and domain information |
|---|
| >PRK12414 putative aminotransferase; Provisional | Back alignment and domain information |
|---|
| >PRK06434 cystathionine gamma-lyase; Validated | Back alignment and domain information |
|---|
| >TIGR02539 SepCysS Sep-tRNA:Cys-tRNA synthase | Back alignment and domain information |
|---|
| >PRK01688 histidinol-phosphate aminotransferase; Provisional | Back alignment and domain information |
|---|
| >PRK03321 putative aminotransferase; Provisional | Back alignment and domain information |
|---|
| >PRK05613 O-acetylhomoserine aminocarboxypropyltransferase; Validated | Back alignment and domain information |
|---|
| >PRK09028 cystathionine beta-lyase; Provisional | Back alignment and domain information |
|---|
| >PRK07582 cystathionine gamma-lyase; Validated | Back alignment and domain information |
|---|
| >COG0075 Serine-pyruvate aminotransferase/archaeal aspartate aminotransferase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK08247 cystathionine gamma-synthase; Reviewed | Back alignment and domain information |
|---|
| >PRK05939 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK05957 aspartate aminotransferase; Provisional | Back alignment and domain information |
|---|
| >PRK07683 aminotransferase A; Validated | Back alignment and domain information |
|---|
| >PRK06107 aspartate aminotransferase; Provisional | Back alignment and domain information |
|---|
| >PLN00143 tyrosine/nicotianamine aminotransferase; Provisional | Back alignment and domain information |
|---|
| >PRK08249 cystathionine gamma-synthase; Provisional | Back alignment and domain information |
|---|
| >KOG2433|consensus | Back alignment and domain information |
|---|
| >cd00378 SHMT Serine-glycine hydroxymethyltransferase (SHMT) | Back alignment and domain information |
|---|
| >PRK13355 bifunctional HTH-domain containing protein/aminotransferase; Provisional | Back alignment and domain information |
|---|
| >COG0079 HisC Histidinol-phosphate/aromatic aminotransferase and cobyric acid decarboxylase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK08574 cystathionine gamma-synthase; Provisional | Back alignment and domain information |
|---|
| >cd00615 Orn_deC_like Ornithine decarboxylase family | Back alignment and domain information |
|---|
| >PRK06234 methionine gamma-lyase; Provisional | Back alignment and domain information |
|---|
| >PRK08045 cystathionine gamma-synthase; Provisional | Back alignment and domain information |
|---|
| >PTZ00433 tyrosine aminotransferase; Provisional | Back alignment and domain information |
|---|
| >PLN02483 serine palmitoyltransferase | Back alignment and domain information |
|---|
| >PRK06176 cystathionine gamma-synthase/cystathionine beta-lyase; Validated | Back alignment and domain information |
|---|
| >PRK06207 aspartate aminotransferase; Provisional | Back alignment and domain information |
|---|
| >PRK07777 aminotransferase; Validated | Back alignment and domain information |
|---|
| >PRK07811 cystathionine gamma-synthase; Provisional | Back alignment and domain information |
|---|
| >PRK09265 aminotransferase AlaT; Validated | Back alignment and domain information |
|---|
| >PRK07504 O-succinylhomoserine sulfhydrylase; Reviewed | Back alignment and domain information |
|---|
| >PRK06425 histidinol-phosphate aminotransferase; Validated | Back alignment and domain information |
|---|
| >PRK07324 transaminase; Validated | Back alignment and domain information |
|---|
| >PRK08354 putative aminotransferase; Provisional | Back alignment and domain information |
|---|
| >PRK13238 tnaA tryptophanase/L-cysteine desulfhydrase, PLP-dependent; Provisional | Back alignment and domain information |
|---|
| >TIGR03799 NOD_PanD_pyr putative pyridoxal-dependent aspartate 1-decarboxylase | Back alignment and domain information |
|---|
| >PRK08114 cystathionine beta-lyase; Provisional | Back alignment and domain information |
|---|
| >PRK04366 glycine dehydrogenase subunit 2; Validated | Back alignment and domain information |
|---|
| >TIGR01329 cysta_beta_ly_E cystathionine beta-lyase, eukaryotic | Back alignment and domain information |
|---|
| >PRK08776 cystathionine gamma-synthase; Provisional | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 83 | ||||
| 2pb0_A | 420 | Structure Of Biosynthetic N-Acetylornithine Aminotr | 4e-06 | ||
| 1vef_A | 395 | Acetylornithine Aminotransferase From Thermus Therm | 1e-05 | ||
| 1z3z_A | 431 | The Crystal Structure Of A Dgd Mutant: Q52a Length | 4e-05 | ||
| 1m0n_A | 433 | Structure Of Dialkylglycine Decarboxylase Complexed | 4e-05 | ||
| 3hmu_A | 472 | Crystal Structure Of A Class Iii Aminotransferase F | 6e-05 | ||
| 1d7r_A | 433 | Crystal Structure Of The Complex Of 2,2-Dialkylglyc | 8e-05 | ||
| 1dgd_A | 432 | An Alkali Metal Ion Size-Dependent Switch In The Ac | 8e-05 | ||
| 3lg0_A | 422 | Structure Of Plasmodium Falciparum Ornithine Delta- | 2e-04 | ||
| 4adb_A | 406 | Structural And Functional Study Of Succinyl-ornithi | 3e-04 | ||
| 1z7d_A | 433 | Ornithine Aminotransferase Py00104 From Plasmodium | 3e-04 |
| >pdb|2PB0|A Chain A, Structure Of Biosynthetic N-Acetylornithine Aminotransferase From Salmonella Typhimurium: Studies On Substrate Specificity And Inhibitor Binding Length = 420 | Back alignment and structure |
|
| >pdb|1VEF|A Chain A, Acetylornithine Aminotransferase From Thermus Thermophilus Hb8 Length = 395 | Back alignment and structure |
| >pdb|1Z3Z|A Chain A, The Crystal Structure Of A Dgd Mutant: Q52a Length = 431 | Back alignment and structure |
| >pdb|1M0N|A Chain A, Structure Of Dialkylglycine Decarboxylase Complexed With 1- Aminocyclopentanephosphonate Length = 433 | Back alignment and structure |
| >pdb|3HMU|A Chain A, Crystal Structure Of A Class Iii Aminotransferase From Silicibacter Pomeroyi Length = 472 | Back alignment and structure |
| >pdb|1D7R|A Chain A, Crystal Structure Of The Complex Of 2,2-Dialkylglycine Decarboxylase With 5pa Length = 433 | Back alignment and structure |
| >pdb|1DGD|A Chain A, An Alkali Metal Ion Size-Dependent Switch In The Active Site Structure Of Dialkylglycine Decarboxylase Length = 432 | Back alignment and structure |
| >pdb|3LG0|A Chain A, Structure Of Plasmodium Falciparum Ornithine Delta-Aminotransferase Length = 422 | Back alignment and structure |
| >pdb|4ADB|A Chain A, Structural And Functional Study Of Succinyl-ornithine Transaminase From E. Coli Length = 406 | Back alignment and structure |
| >pdb|1Z7D|A Chain A, Ornithine Aminotransferase Py00104 From Plasmodium Yoelii Length = 433 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 83 | |||
| 1zod_A | 433 | DGD, 2,2-dialkylglycine decarboxylase; pyridoxal, | 1e-27 | |
| 3dxv_A | 439 | Alpha-amino-epsilon-caprolactam racemase; fold-TYP | 2e-23 | |
| 3oks_A | 451 | 4-aminobutyrate transaminase; ssgcid, transferase, | 2e-20 | |
| 4ffc_A | 453 | 4-aminobutyrate aminotransferase (GABT); structura | 4e-20 | |
| 1sff_A | 426 | 4-aminobutyrate aminotransferase; enzyme complexes | 4e-20 | |
| 1vef_A | 395 | Acetylornithine/acetyl-lysine aminotransferase; PL | 2e-19 | |
| 3nui_A | 478 | Pyruvate transaminase; amino transferase, transfer | 9e-18 | |
| 3gju_A | 460 | Putative aminotransferase; pyridoxal phosphate, PL | 2e-17 | |
| 3hmu_A | 472 | Aminotransferase, class III; structural genomics, | 3e-17 | |
| 1ohv_A | 472 | 4-aminobutyrate aminotransferase; PLP-dependent en | 3e-17 | |
| 3i4j_A | 430 | Aminotransferase, class III; structural GENOMICS,N | 4e-17 | |
| 2cjg_A | 449 | L-lysine-epsilon aminotransferase; internal aldimi | 4e-17 | |
| 4a6r_A | 459 | Omega transaminase; transferase, PLP-binding enzym | 5e-17 | |
| 2eo5_A | 419 | 419AA long hypothetical aminotransferase; PLP enzy | 1e-16 | |
| 3n5m_A | 452 | Adenosylmethionine-8-amino-7-oxononanoate aminotr; | 6e-16 | |
| 3a8u_X | 449 | Omega-amino acid--pyruvate aminotransferase; large | 8e-16 | |
| 3i5t_A | 476 | Aminotransferase; pyridoxal 5'-phosphate, PSI-2, N | 1e-15 | |
| 3ruy_A | 392 | Ornithine aminotransferase; structural genomics, c | 3e-14 | |
| 1z7d_A | 433 | Ornithine aminotransferase; structural genomics co | 8e-14 | |
| 2oat_A | 439 | Ornithine aminotransferase; 5-fluoromethylornithin | 1e-13 | |
| 3dod_A | 448 | Adenosylmethionine-8-amino-7-oxononanoate aminotr; | 2e-13 | |
| 2eh6_A | 375 | Acoat, acetylornithine aminotransferase; ARGD, str | 5e-13 | |
| 2ord_A | 397 | Acoat, acetylornithine aminotransferase; TM1785, a | 3e-12 | |
| 3nx3_A | 395 | Acoat, acetylornithine aminotransferase; csgid, st | 4e-12 | |
| 2pb2_A | 420 | Acetylornithine/succinyldiaminopimelate aminotran; | 7e-12 | |
| 3tfu_A | 457 | Adenosylmethionine-8-amino-7-oxononanoate aminotr; | 5e-11 | |
| 1s0a_A | 429 | Adenosylmethionine-8-amino-7-oxononanoate aminotra | 6e-11 | |
| 4a0g_A | 831 | Adenosylmethionine-8-amino-7-oxononanoate aminotra | 3e-08 | |
| 2yky_A | 465 | Beta-transaminase; transferase; HET: PLP SFE; 1.69 | 3e-08 | |
| 2cy8_A | 453 | D-phgat, D-phenylglycine aminotransferase; structu | 2e-07 | |
| 2e7u_A | 424 | Glutamate-1-semialdehyde 2,1-aminomutase; PLP enzy | 3e-07 | |
| 2epj_A | 434 | Glutamate-1-semialdehyde 2,1-aminomutase; PLP enzy | 3e-07 | |
| 3fq8_A | 427 | Glutamate-1-semialdehyde 2,1-aminomutase; drug res | 4e-07 | |
| 3l44_A | 434 | Glutamate-1-semialdehyde 2,1-aminomutase 1; alpha | 4e-07 | |
| 3k28_A | 429 | Glutamate-1-semialdehyde 2,1-aminomutase 2; biosyn | 4e-07 | |
| 4e77_A | 429 | Glutamate-1-semialdehyde 2,1-aminomutase; structur | 5e-07 |
| >1zod_A DGD, 2,2-dialkylglycine decarboxylase; pyridoxal, cesium, lyase; HET: MES PLP; 1.80A {Burkholderia cepacia} SCOP: c.67.1.4 PDB: 1dka_A* 1m0o_A* 1m0p_A* 1m0n_A* 1zc9_A* 1zob_A* 1m0q_A* 2dkb_A* 1dgd_A* 1dge_A* 1d7u_A* 1d7s_A* 1d7r_A* 1d7v_A* 1z3z_A* Length = 433 | Back alignment and structure |
|---|
Score = 102 bits (256), Expect = 1e-27
Identities = 23/81 (28%), Positives = 44/81 (54%), Gaps = 1/81 (1%)
Query: 1 MSLPVGHCHPAVVKAACTQLALLN-TNNRFLHDNLVLCARKLASLLPDPLSVCFFVNSGS 59
MS +GHCHP +V L+ + L +V A +LA++ P L +++G+
Sbjct: 53 MSAVLGHCHPEIVSVIGEYAGKLDHLFSEMLSRPVVDLATRLANITPPGLDRALLLSTGA 112
Query: 60 EANDLALRLARVHTNNDDVIT 80
E+N+ A+R+A++ T +++
Sbjct: 113 ESNEAAIRMAKLVTGKYEIVG 133
|
| >3dxv_A Alpha-amino-epsilon-caprolactam racemase; fold-TYPE1, pyridoxal-5'-phosphate dependent racemase, pyrid phosphate, isomerase; HET: PLP; 2.21A {Achromobacter obae} PDB: 2zuk_A* 3dxw_A* Length = 439 | Back alignment and structure |
|---|
| >3oks_A 4-aminobutyrate transaminase; ssgcid, transferase, seattle structural genomics center for infectious disease; HET: LLP; 1.80A {Mycobacterium smegmatis} PDB: 3r4t_A* 3q8n_A Length = 451 | Back alignment and structure |
|---|
| >4ffc_A 4-aminobutyrate aminotransferase (GABT); structural genomics, niaid, national institute of allergy AN infectious diseases; HET: LLP; 1.80A {Mycobacterium abscessus} Length = 453 | Back alignment and structure |
|---|
| >1sff_A 4-aminobutyrate aminotransferase; enzyme complexes; HET: IK2; 1.90A {Escherichia coli} SCOP: c.67.1.4 PDB: 1sf2_A* 1szk_A* 1szu_A* 1szs_A* Length = 426 | Back alignment and structure |
|---|
| >1vef_A Acetylornithine/acetyl-lysine aminotransferase; PLP, riken structural genomics/proteomics initiative, RSGI, structural genomics; HET: PLP; 1.35A {Thermus thermophilus} SCOP: c.67.1.4 PDB: 1wkg_A* 1wkh_A* Length = 395 | Back alignment and structure |
|---|
| >3nui_A Pyruvate transaminase; amino transferase, transferase; 2.00A {Vibrio fluvialis} Length = 478 | Back alignment and structure |
|---|
| >3gju_A Putative aminotransferase; pyridoxal phosphate, PLP-dependent transferase-like fold, ST genomics, joint center for structural genomics, JCSG; HET: MSE LLP PLP; 1.55A {Mesorhizobium loti} PDB: 3fcr_A* Length = 460 | Back alignment and structure |
|---|
| >3hmu_A Aminotransferase, class III; structural genomics, pyridoxal phosphate, PSI-2, protein structure initiative; 2.10A {Silicibacter pomeroyi} Length = 472 | Back alignment and structure |
|---|
| >1ohv_A 4-aminobutyrate aminotransferase; PLP-dependent enzyme, 4- AMIN acid, antiepileptic drug target; HET: PLP; 2.3A {Sus scrofa} SCOP: c.67.1.4 PDB: 1ohw_A* 1ohy_A* Length = 472 | Back alignment and structure |
|---|
| >3i4j_A Aminotransferase, class III; structural GENOMICS,NYSGXRC, target 11246C, pyridoxal phosphate, PSI-2, protein structure initiative; 1.70A {Deinococcus radiodurans} Length = 430 | Back alignment and structure |
|---|
| >2cjg_A L-lysine-epsilon aminotransferase; internal aldimine, pyridoxal phosphate, PLP, RV3290C, lysine amino transferase; HET: PMP; 1.95A {Mycobacterium tuberculosis} PDB: 2cjd_A* 2cin_A* 2cjh_A* 2jjg_A* 2jje_A* 2jjh_A* 2jjf_A Length = 449 | Back alignment and structure |
|---|
| >4a6r_A Omega transaminase; transferase, PLP-binding enzyme, transaminase fold type I; HET: TA8; 1.35A {Chromobacterium violaceum} PDB: 4a6t_A* 4a6u_A 4a72_A* 4ah3_A* Length = 459 | Back alignment and structure |
|---|
| >2eo5_A 419AA long hypothetical aminotransferase; PLP enzyme, structural genomics, NPPSFA, N project on protein structural and functional analyses; HET: PLP; 1.90A {Sulfolobus tokodaii} Length = 419 | Back alignment and structure |
|---|
| >3n5m_A Adenosylmethionine-8-amino-7-oxononanoate aminotr; aminotransferase, csgid; 2.05A {Bacillus anthracis} Length = 452 | Back alignment and structure |
|---|
| >3a8u_X Omega-amino acid--pyruvate aminotransferase; large pleated sheet, transaminase, pyridox phosphate; HET: PLP; 1.40A {Pseudomonas putida} Length = 449 | Back alignment and structure |
|---|
| >3i5t_A Aminotransferase; pyridoxal 5'-phosphate, PSI-2, NYSGXRC, ST genomics, protein structure initiative; HET: PLP; 2.00A {Rhodobacter sphaeroides 2} Length = 476 | Back alignment and structure |
|---|
| >3ruy_A Ornithine aminotransferase; structural genomics, csgid, center for structural genomics O infectious diseases, alpha and beta protein; HET: LLP; 2.65A {Bacillus anthracis} Length = 392 | Back alignment and structure |
|---|
| >1z7d_A Ornithine aminotransferase; structural genomics consortium, SGC, malaria; 2.10A {Plasmodium yoelii yoelii} SCOP: c.67.1.4 PDB: 3lg0_A 3ntj_A Length = 433 | Back alignment and structure |
|---|
| >2oat_A Ornithine aminotransferase; 5-fluoromethylornithine, PLP-dependent ENZ pyridoxal phosphate; HET: PFM; 1.95A {Homo sapiens} SCOP: c.67.1.4 PDB: 1oat_A* 2byj_A* 2byl_A* 1gbn_A* 2can_A* Length = 439 | Back alignment and structure |
|---|
| >3dod_A Adenosylmethionine-8-amino-7-oxononanoate aminotr; aminotransferase, biotin biosynthesis, pyridoxal phosphate, adenosyl-L-methionine; HET: PLP; 1.90A {Bacillus subtilis} PDB: 3drd_A 3du4_A* Length = 448 | Back alignment and structure |
|---|
| >2eh6_A Acoat, acetylornithine aminotransferase; ARGD, structural genomics, NPPSFA, national project on prote structural and functional analyses; HET: PLP; 1.90A {Aquifex aeolicus} Length = 375 | Back alignment and structure |
|---|
| >2ord_A Acoat, acetylornithine aminotransferase; TM1785, acetylornithine aminotransferase (EC 2.6.1.11) (ACOA structural genomics; HET: MSE PLP; 1.40A {Thermotoga maritima MSB8} PDB: 2e54_A* Length = 397 | Back alignment and structure |
|---|
| >3nx3_A Acoat, acetylornithine aminotransferase; csgid, structural genomics, center for structural genomics O infectious diseases; 1.80A {Campylobacter jejuni subsp} Length = 395 | Back alignment and structure |
|---|
| >2pb2_A Acetylornithine/succinyldiaminopimelate aminotran; ARGD, pyridoxal 5'-phosphate, arginine metabolism, lysine biosynthesis, gabaculine; HET: PLP; 1.91A {Salmonella typhimurium} PDB: 2pb0_A* Length = 420 | Back alignment and structure |
|---|
| >3tfu_A Adenosylmethionine-8-amino-7-oxononanoate aminotr; transferase, transferase-transferase inhibitor complex; HET: PL8; 1.94A {Mycobacterium tuberculosis} PDB: 3tft_A* 3bv0_A* 3lv2_A* Length = 457 | Back alignment and structure |
|---|
| >1s0a_A Adenosylmethionine-8-amino-7-oxononanoate aminotransferase; fold type I, subclass II, homodimer; HET: LLP; 1.71A {Escherichia coli} SCOP: c.67.1.4 PDB: 1qj5_A* 1mlz_A* 1qj3_A* 1mly_A* 1s06_A* 1s08_A* 1s09_A* 1s07_A* 1mgv_A* 1dty_A* Length = 429 | Back alignment and structure |
|---|
| >4a0g_A Adenosylmethionine-8-amino-7-oxononanoate aminotransferase; BIO3-BIO1, biotin synthesis; HET: PLP; 2.50A {Arabidopsis thaliana} PDB: 4a0h_A* 4a0r_A* 4a0f_A* Length = 831 | Back alignment and structure |
|---|
| >2yky_A Beta-transaminase; transferase; HET: PLP SFE; 1.69A {Mesorhizobium SP} PDB: 2ykv_A* 2yku_A* 2ykx_A* Length = 465 | Back alignment and structure |
|---|
| >2cy8_A D-phgat, D-phenylglycine aminotransferase; structural genomics, NPPSFA, national PROJ protein structural and functional analyses; 2.30A {Pseudomonas stutzeri} Length = 453 | Back alignment and structure |
|---|
| >2e7u_A Glutamate-1-semialdehyde 2,1-aminomutase; PLP enzyme, GSA, structural genomics, NPPSFA; HET: PMP; 1.90A {Thermus thermophilus} Length = 424 | Back alignment and structure |
|---|
| >2epj_A Glutamate-1-semialdehyde 2,1-aminomutase; PLP enzyme, GSA, structural genomics, NPPSFA; HET: PMP; 1.70A {Aeropyrum pernix} PDB: 2zsl_A* 2zsm_A* Length = 434 | Back alignment and structure |
|---|
| >3fq8_A Glutamate-1-semialdehyde 2,1-aminomutase; drug resistance, microev0lution, integrated approach, chlorophyll biosynthesis; HET: PMP; 2.00A {Synechococcus elongatus pcc 6301} PDB: 2hp1_A* 2hoz_A* 2hoy_A* 2hp2_A* 3fq7_A* 2gsa_A* 3gsb_A* 4gsa_A* 3fqa_A* 2cfb_A* Length = 427 | Back alignment and structure |
|---|
| >3l44_A Glutamate-1-semialdehyde 2,1-aminomutase 1; alpha beta class, PLP-dependent transferase-like, bacillus A csgid, porphyrin biosynthesis; HET: LLP; 2.05A {Bacillus anthracis} Length = 434 | Back alignment and structure |
|---|
| >3k28_A Glutamate-1-semialdehyde 2,1-aminomutase 2; biosynthesis of cofactors, prosthetic groups, and carriers, csgid, cytoplasm, isomerase; HET: MSE PLP; 1.95A {Bacillus anthracis str} PDB: 3bs8_A* Length = 429 | Back alignment and structure |
|---|
| >4e77_A Glutamate-1-semialdehyde 2,1-aminomutase; structural genomics, center for structural genomics of infec diseases, csgid, porphyrin biosynthesis; 2.00A {Yersinia pestis} Length = 429 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 83 | |||
| 4e3q_A | 473 | Pyruvate transaminase; aminotransferase, transfera | 99.92 | |
| 4atq_A | 456 | 4-aminobutyrate transaminase; transferase; HET: PL | 99.92 | |
| 4ao9_A | 454 | Beta-phenylalanine aminotransferase; HET: PLP; 1.5 | 99.89 | |
| 4a0g_A | 831 | Adenosylmethionine-8-amino-7-oxononanoate aminotra | 99.87 | |
| 3i5t_A | 476 | Aminotransferase; pyridoxal 5'-phosphate, PSI-2, N | 99.8 | |
| 3hmu_A | 472 | Aminotransferase, class III; structural genomics, | 99.79 | |
| 3tfu_A | 457 | Adenosylmethionine-8-amino-7-oxononanoate aminotr; | 99.78 | |
| 3oks_A | 451 | 4-aminobutyrate transaminase; ssgcid, transferase, | 99.77 | |
| 4ffc_A | 453 | 4-aminobutyrate aminotransferase (GABT); structura | 99.77 | |
| 2yky_A | 465 | Beta-transaminase; transferase; HET: PLP SFE; 1.69 | 99.61 | |
| 4e77_A | 429 | Glutamate-1-semialdehyde 2,1-aminomutase; structur | 99.75 | |
| 3k28_A | 429 | Glutamate-1-semialdehyde 2,1-aminomutase 2; biosyn | 99.74 | |
| 3l44_A | 434 | Glutamate-1-semialdehyde 2,1-aminomutase 1; alpha | 99.73 | |
| 3gju_A | 460 | Putative aminotransferase; pyridoxal phosphate, PL | 99.73 | |
| 3dod_A | 448 | Adenosylmethionine-8-amino-7-oxononanoate aminotr; | 99.72 | |
| 4a6r_A | 459 | Omega transaminase; transferase, PLP-binding enzym | 99.72 | |
| 3fq8_A | 427 | Glutamate-1-semialdehyde 2,1-aminomutase; drug res | 99.71 | |
| 3n5m_A | 452 | Adenosylmethionine-8-amino-7-oxononanoate aminotr; | 99.69 | |
| 1ohv_A | 472 | 4-aminobutyrate aminotransferase; PLP-dependent en | 99.69 | |
| 2cjg_A | 449 | L-lysine-epsilon aminotransferase; internal aldimi | 99.67 | |
| 2e7u_A | 424 | Glutamate-1-semialdehyde 2,1-aminomutase; PLP enzy | 99.64 | |
| 2epj_A | 434 | Glutamate-1-semialdehyde 2,1-aminomutase; PLP enzy | 99.63 | |
| 3i4j_A | 430 | Aminotransferase, class III; structural GENOMICS,N | 99.62 | |
| 1zod_A | 433 | DGD, 2,2-dialkylglycine decarboxylase; pyridoxal, | 99.62 | |
| 3dxv_A | 439 | Alpha-amino-epsilon-caprolactam racemase; fold-TYP | 99.61 | |
| 1z7d_A | 433 | Ornithine aminotransferase; structural genomics co | 99.59 | |
| 3nx3_A | 395 | Acoat, acetylornithine aminotransferase; csgid, st | 99.57 | |
| 2cy8_A | 453 | D-phgat, D-phenylglycine aminotransferase; structu | 99.57 | |
| 2oat_A | 439 | Ornithine aminotransferase; 5-fluoromethylornithin | 99.57 | |
| 2pb2_A | 420 | Acetylornithine/succinyldiaminopimelate aminotran; | 99.54 | |
| 3a8u_X | 449 | Omega-amino acid--pyruvate aminotransferase; large | 99.53 | |
| 1s0a_A | 429 | Adenosylmethionine-8-amino-7-oxononanoate aminotra | 99.49 | |
| 3ruy_A | 392 | Ornithine aminotransferase; structural genomics, c | 99.43 | |
| 2eo5_A | 419 | 419AA long hypothetical aminotransferase; PLP enzy | 99.42 | |
| 4adb_A | 406 | Succinylornithine transaminase; transferase, PLP e | 99.39 | |
| 1sff_A | 426 | 4-aminobutyrate aminotransferase; enzyme complexes | 99.25 | |
| 2ord_A | 397 | Acoat, acetylornithine aminotransferase; TM1785, a | 99.25 | |
| 1vef_A | 395 | Acetylornithine/acetyl-lysine aminotransferase; PL | 99.18 | |
| 2eh6_A | 375 | Acoat, acetylornithine aminotransferase; ARGD, str | 99.07 | |
| 3l8a_A | 421 | METC, putative aminotransferase, probable beta-cys | 98.55 | |
| 1svv_A | 359 | Threonine aldolase; structural genomics, structura | 98.51 | |
| 1elu_A | 390 | L-cysteine/L-cystine C-S lyase; FES cluster biosyn | 98.33 | |
| 1kmj_A | 406 | Selenocysteine lyase; persulfide perselenide NIFS | 98.31 | |
| 3nyt_A | 367 | Aminotransferase WBPE; PLP binding, nucleotide-sug | 98.28 | |
| 3f9t_A | 397 | TDC, L-tyrosine decarboxylase MFNA; NP_247014.1, L | 98.27 | |
| 2w8t_A | 427 | SPT, serine palmitoyltransferase; HET: LLP; 1.25A | 98.25 | |
| 4dq6_A | 391 | Putative pyridoxal phosphate-dependent transferas; | 98.2 | |
| 1lc5_A | 364 | COBD, L-threonine-O-3-phosphate decarboxylase; PLP | 98.18 | |
| 1v72_A | 356 | Aldolase; PLP-dependent enzyme, lyase; HET: PLP; 2 | 98.17 | |
| 3frk_A | 373 | QDTB; aminotransferase, sugar-modification, natura | 98.14 | |
| 3lvm_A | 423 | Cysteine desulfurase; structural genomics, montrea | 98.14 | |
| 1eg5_A | 384 | Aminotransferase; PLP-dependent enzymes, iron-sulf | 98.13 | |
| 3kax_A | 383 | Aminotransferase, classes I and II; PLP, C-S lyase | 98.12 | |
| 1qz9_A | 416 | Kynureninase; kynurenine, tryptophan, PLP, vitamin | 98.09 | |
| 1t3i_A | 420 | Probable cysteine desulfurase; PLP-binding enzyme, | 98.08 | |
| 1v2d_A | 381 | Glutamine aminotransferase; PLP, riken structural | 98.04 | |
| 3dzz_A | 391 | Putative pyridoxal 5'-phosphate-dependent C-S LYA; | 98.03 | |
| 3uwc_A | 374 | Nucleotide-sugar aminotransferase; lipopolysacchar | 98.01 | |
| 3cq5_A | 369 | Histidinol-phosphate aminotransferase; PLP, PMP, a | 98.01 | |
| 3ezs_A | 376 | Aminotransferase ASPB; NP_207418.1, structural gen | 97.98 | |
| 3ftb_A | 361 | Histidinol-phosphate aminotransferase; structural | 97.96 | |
| 4eb5_A | 382 | Probable cysteine desulfurase 2; scaffold, transfe | 97.96 | |
| 1fc4_A | 401 | 2-amino-3-ketobutyrate conenzyme A ligase; 2-amino | 97.91 | |
| 1bs0_A | 384 | Protein (8-amino-7-oxonanoate synthase); PLP-depen | 97.91 | |
| 3tqx_A | 399 | 2-amino-3-ketobutyrate coenzyme A ligase; energy m | 97.9 | |
| 1ax4_A | 467 | Tryptophanase; tryptophan biosynthesis, tryptophan | 97.89 | |
| 3kki_A | 409 | CAI-1 autoinducer synthase; quorum sensing, CQSA, | 97.89 | |
| 3ly1_A | 354 | Putative histidinol-phosphate aminotransferase; st | 97.88 | |
| 2q7w_A | 396 | Aspartate aminotransferase; mechanism-based inhibi | 97.88 | |
| 1ajs_A | 412 | Aspartate aminotransferase; PIG, in the presence o | 97.87 | |
| 2e7j_A | 371 | SEP-tRNA:Cys-tRNA synthase; seven-stranded BETE-st | 97.87 | |
| 3dr4_A | 391 | Putative perosamine synthetase; deoxysugar, pyrido | 97.87 | |
| 3hdo_A | 360 | Histidinol-phosphate aminotransferase; PSI-II, his | 97.87 | |
| 2z61_A | 370 | Probable aspartate aminotransferase 2; amino acid | 97.85 | |
| 1vjo_A | 393 | Alanine--glyoxylate aminotransferase; 17130350, AL | 97.85 | |
| 2cb1_A | 412 | O-acetyl homoserine sulfhydrylase; PLP enzyme, lya | 97.83 | |
| 3a2b_A | 398 | Serine palmitoyltransferase; vitamin B6-dependent | 97.82 | |
| 3cai_A | 406 | Possible aminotransferase; RV3778C; 1.80A {Mycobac | 97.82 | |
| 3ffh_A | 363 | Histidinol-phosphate aminotransferase; APC88260, l | 97.81 | |
| 3get_A | 365 | Histidinol-phosphate aminotransferase; NP_281508.1 | 97.81 | |
| 1yiz_A | 429 | Kynurenine aminotransferase; glutamine transaminas | 97.81 | |
| 1d2f_A | 390 | MALY protein; aminotransferase fold, large PLP-bin | 97.8 | |
| 3vax_A | 400 | Putative uncharacterized protein DNDA; desulfurase | 97.8 | |
| 3jtx_A | 396 | Aminotransferase; NP_283882.1, structural genomics | 97.8 | |
| 2fnu_A | 375 | Aminotransferase; protein-product complex, structu | 97.79 | |
| 3euc_A | 367 | Histidinol-phosphate aminotransferase 2; YP_297314 | 97.78 | |
| 2oqx_A | 467 | Tryptophanase; lyase, pyridoxal phosphate, tryptop | 97.77 | |
| 2zc0_A | 407 | Alanine glyoxylate transaminase; alanine:glyoxylat | 97.77 | |
| 2ay1_A | 394 | Aroat, aromatic amino acid aminotransferase; HET: | 97.76 | |
| 2zyj_A | 397 | Alpha-aminodipate aminotransferase; alpha-aminoadi | 97.76 | |
| 1c7n_A | 399 | Cystalysin; transferase, aminotransferase, pyridox | 97.73 | |
| 2z9v_A | 392 | Aspartate aminotransferase; pyridoxamine, pyruvate | 97.69 | |
| 3fkd_A | 350 | L-threonine-O-3-phosphate decarboxylase; structura | 97.67 | |
| 3b8x_A | 390 | WBDK, pyridoxamine 5-phosphate-dependent dehydrase | 97.67 | |
| 3fdb_A | 377 | Beta C-S lyase, putative PLP-dependent beta-cystat | 97.66 | |
| 4hvk_A | 382 | Probable cysteine desulfurase 2; transferase and I | 97.66 | |
| 1wyu_B | 474 | Glycine dehydrogenase subunit 2 (P-protein); alpha | 97.65 | |
| 3fsl_A | 397 | Aromatic-amino-acid aminotransferase; tyrosine ami | 97.65 | |
| 3dyd_A | 427 | Tyrosine aminotransferase; PLP, SGC, structural ge | 97.63 | |
| 2dou_A | 376 | Probable N-succinyldiaminopimelate aminotransfera; | 97.61 | |
| 1u08_A | 386 | Hypothetical aminotransferase YBDL; alpha beta pro | 97.6 | |
| 3ele_A | 398 | Amino transferase; RER070207001803, structural gen | 97.58 | |
| 2o0r_A | 411 | RV0858C (N-succinyldiaminopimelate aminotransfera; | 97.58 | |
| 3pj0_A | 359 | LMO0305 protein; structural genomics, joint center | 97.55 | |
| 3a9z_A | 432 | Selenocysteine lyase; PLP, cytoplasm, pyridoxal ph | 97.55 | |
| 2x5d_A | 412 | Probable aminotransferase; HET: LLP PLP; 2.25A {Ps | 97.55 | |
| 3p1t_A | 337 | Putative histidinol-phosphate aminotransferase; PL | 97.55 | |
| 4f4e_A | 420 | Aromatic-amino-acid aminotransferase; ssgcid, stru | 97.53 | |
| 3mc6_A | 497 | Sphingosine-1-phosphate lyase; carboxy-lyase activ | 97.53 | |
| 1gd9_A | 389 | Aspartate aminotransferase; pyridoxal enzyme, temp | 97.51 | |
| 1iug_A | 352 | Putative aspartate aminotransferase; wild type, py | 97.5 | |
| 3nra_A | 407 | Aspartate aminotransferase; structural genomics, j | 97.49 | |
| 3bb8_A | 437 | CDP-4-keto-6-deoxy-D-glucose-3-dehydrase; aspartat | 97.48 | |
| 2dr1_A | 386 | PH1308 protein, 386AA long hypothetical serine ami | 97.46 | |
| 1vp4_A | 425 | Aminotransferase, putative; structural genomics, j | 97.45 | |
| 3g7q_A | 417 | Valine-pyruvate aminotransferase; NP_462565.1, str | 97.45 | |
| 1o4s_A | 389 | Aspartate aminotransferase; TM1255, structural gen | 97.44 | |
| 2bwn_A | 401 | 5-aminolevulinate synthase; tetrapyrrole biosynthe | 97.44 | |
| 1j32_A | 388 | Aspartate aminotransferase; HET: PLP; 2.10A {Phorm | 97.44 | |
| 2oga_A | 399 | Transaminase; PLP-dependent enzyme, desosamine, de | 97.43 | |
| 2o1b_A | 404 | Aminotransferase, class I; aminotrasferase; HET: P | 97.43 | |
| 2huf_A | 393 | Alanine glyoxylate aminotransferase; alpha and bet | 97.43 | |
| 3acz_A | 389 | Methionine gamma-lyase; L-methionine; HET: LLP; 1. | 97.42 | |
| 3qhx_A | 392 | Cystathionine gamma-synthase METB (CGS); structura | 97.41 | |
| 3nnk_A | 411 | Ureidoglycine-glyoxylate aminotransferase; PLP-dep | 97.39 | |
| 1mdo_A | 393 | ARNB aminotransferase; type 1 aminotransferase fol | 97.39 | |
| 1b9h_A | 388 | AHBA synthase, protein (3-amino-5-hydroxybenzoic a | 97.35 | |
| 3h14_A | 391 | Aminotransferase, classes I and II; YP_167802.1, S | 97.35 | |
| 2po3_A | 424 | 4-dehydrase; external aldimine, PLP, aminotransfer | 97.35 | |
| 3e2y_A | 410 | Kynurenine-oxoglutarate transaminase 3; alpha beta | 97.34 | |
| 3isl_A | 416 | Purine catabolism protein PUCG; pyridoxalphosphate | 97.33 | |
| 1bw0_A | 416 | TAT, protein (tyrosine aminotransferase); tyrosine | 97.32 | |
| 3kgw_A | 393 | Alanine-glyoxylate aminotransferase; AAH25799.1, p | 97.31 | |
| 3mad_A | 514 | Sphingosine-1-phosphate lyase; carboxy-lyase activ | 97.31 | |
| 3g0t_A | 437 | Putative aminotransferase; NP_905498.1, putative a | 97.29 | |
| 2gb3_A | 409 | Aspartate aminotransferase; TM1698, structural gen | 97.29 | |
| 3b46_A | 447 | Aminotransferase BNA3; kynurenine aminotransferase | 97.27 | |
| 3zrp_A | 384 | Serine-pyruvate aminotransferase (AGXT); HET: PLP; | 97.27 | |
| 3lws_A | 357 | Aromatic amino acid beta-eliminating lyase/threoni | 97.26 | |
| 1xi9_A | 406 | Putative transaminase; alanine aminotransferase, s | 97.2 | |
| 3aow_A | 448 | Putative uncharacterized protein PH0207; protein-P | 97.16 | |
| 3ecd_A | 425 | Serine hydroxymethyltransferase 2; ssgcid, decode, | 97.15 | |
| 2ch1_A | 396 | 3-hydroxykynurenine transaminase; PLP-enzyme, kynu | 97.15 | |
| 3gbx_A | 420 | Serine hydroxymethyltransferase; structural genomi | 97.14 | |
| 2rfv_A | 398 | Methionine gamma-lyase; pyridoxal-5'-phosphate, PL | 97.14 | |
| 3fvs_A | 422 | Kynurenine--oxoglutarate transaminase 1; alpha bet | 97.14 | |
| 2qma_A | 497 | Diaminobutyrate-pyruvate transaminase and L-2,4- d | 97.14 | |
| 3e9k_A | 465 | Kynureninase; kynurenine-L-hydrolase, kynurenine h | 97.13 | |
| 3ke3_A | 379 | Putative serine-pyruvate aminotransferase; structu | 97.12 | |
| 3f0h_A | 376 | Aminotransferase; RER070207000802, structural geno | 97.12 | |
| 1uu1_A | 335 | Histidinol-phosphate aminotransferase; histidine b | 97.11 | |
| 2c81_A | 418 | Glutamine-2-deoxy-scyllo-inosose aminotransferase; | 97.08 | |
| 2yrr_A | 353 | Aminotransferase, class V; structural genomics, NP | 97.04 | |
| 3b1d_A | 392 | Betac-S lyase; HET: PLP PLS EPE; 1.66A {Streptococ | 96.09 | |
| 3qgu_A | 449 | LL-diaminopimelate aminotransferase; L-lysine, pyr | 97.0 | |
| 1yaa_A | 412 | Aspartate aminotransferase; HET: PLP; 2.05A {Sacch | 96.98 | |
| 3h7f_A | 447 | Serine hydroxymethyltransferase 1; cytoplasm, one- | 96.96 | |
| 2dgk_A | 452 | GAD-beta, GADB, glutamate decarboxylase beta; gadb | 96.95 | |
| 1o69_A | 394 | Aminotransferase; structural genomics, unknown fun | 96.95 | |
| 1m32_A | 366 | 2-aminoethylphosphonate-pyruvate aminotransferase; | 96.91 | |
| 3t18_A | 413 | Aminotransferase class I and II; PSI-biology, MCSG | 96.78 | |
| 1gc0_A | 398 | Methionine gamma-lyase; pyridoxal-5'-phosphate; HE | 96.77 | |
| 3asa_A | 400 | LL-diaminopimelate aminotransferase; PLP dependent | 96.76 | |
| 1cs1_A | 386 | CGS, protein (cystathionine gamma-synthase); lyase | 96.68 | |
| 3if2_A | 444 | Aminotransferase; YP_265399.1, structura genomics, | 96.68 | |
| 3n0l_A | 417 | Serine hydroxymethyltransferase; alpha beta class, | 96.6 | |
| 3ndn_A | 414 | O-succinylhomoserine sulfhydrylase; seattle struct | 96.56 | |
| 2ctz_A | 421 | O-acetyl-L-homoserine sulfhydrylase; crystal, O-ac | 96.56 | |
| 3ju7_A | 377 | Putative PLP-dependent aminotransferase; NP_978343 | 96.46 | |
| 3meb_A | 448 | Aspartate aminotransferase; pyridoxal PHOS transfe | 96.46 | |
| 2dkj_A | 407 | Serine hydroxymethyltransferase; PLP dependent enz | 96.42 | |
| 3ei9_A | 432 | LL-diaminopimelate aminotransferase; lysine biosyn | 96.38 | |
| 3nmy_A | 400 | Xometc, cystathionine gamma-lyase-like protein; Cy | 96.32 | |
| 1fg7_A | 356 | Histidinol phosphate aminotransferase; HISC, histi | 96.27 | |
| 3e77_A | 377 | Phosphoserine aminotransferase; SERC, PLP, structu | 96.25 | |
| 3m5u_A | 361 | Phosphoserine aminotransferase; alpha-beta half sa | 96.24 | |
| 3ri6_A | 430 | O-acetylhomoserine sulfhydrylase; PYR 5'-phosphate | 96.22 | |
| 2vi8_A | 405 | Serine hydroxymethyltransferase; SHMT, E53Q, FTHF, | 96.19 | |
| 2bkw_A | 385 | Alanine-glyoxylate aminotransferase 1; analine-gly | 96.17 | |
| 2jis_A | 515 | Cysteine sulfinic acid decarboxylase; pyridoxal ph | 96.12 | |
| 3ffr_A | 362 | Phosphoserine aminotransferase SERC; structural ge | 96.12 | |
| 1n8p_A | 393 | Cystathionine gamma-lyase; three open alpha/beta s | 96.06 | |
| 3piu_A | 435 | 1-aminocyclopropane-1-carboxylate synthase; fruit | 96.06 | |
| 1b5p_A | 385 | Protein (aspartate aminotransferase); pyridoxal en | 96.05 | |
| 3ez1_A | 423 | Aminotransferase MOCR family; YP_604413.1, struct | 96.04 | |
| 3qm2_A | 386 | Phosphoserine aminotransferase; structural genomic | 96.0 | |
| 2okj_A | 504 | Glutamate decarboxylase 1; PLP-dependent decarboxy | 95.92 | |
| 2ez2_A | 456 | Beta-tyrosinase, tyrosine phenol-lyase; PLP-depend | 95.85 | |
| 3op7_A | 375 | Aminotransferase class I and II; PLP-dependent tra | 95.85 | |
| 2x5f_A | 430 | Aspartate_tyrosine_phenylalanine pyridoxal-5' phos | 95.81 | |
| 1iay_A | 428 | ACC synthase 2, 1-aminocyclopropane-1-carboxylate | 95.79 | |
| 3rq1_A | 418 | Aminotransferase class I and II; structural genomi | 95.73 | |
| 7aat_A | 401 | Aspartate aminotransferase; transferase(aminotrans | 95.66 | |
| 1jg8_A | 347 | L-ALLO-threonine aldolase; glycine biosynthesis, p | 95.61 | |
| 2fyf_A | 398 | PSAT, phosphoserine aminotransferase; PLP-dependen | 95.51 | |
| 2c0r_A | 362 | PSAT, phosphoserine aminotransferase; pyridoxal-5' | 95.32 | |
| 2aeu_A | 374 | Hypothetical protein MJ0158; selenocysteine syntha | 95.14 | |
| 3ht4_A | 431 | Aluminum resistance protein; lyase, putative cysta | 95.01 | |
| 3f6t_A | 533 | Aspartate aminotransferase; YP_194538.1, STRU geno | 94.91 | |
| 3vp6_A | 511 | Glutamate decarboxylase 1; catalytic loop SWAP, ly | 94.54 | |
| 1qgn_A | 445 | Protein (cystathionine gamma-synthase); methionine | 94.49 | |
| 2fq6_A | 415 | Cystathionine beta-lyase; protein-inhibitor comple | 93.97 | |
| 2x3l_A | 446 | ORN/Lys/Arg decarboxylase family protein; lyase; H | 93.75 | |
| 3jzl_A | 409 | Putative cystathionine beta-lyase involved in ALU | 93.59 | |
| 3cog_A | 403 | Cystathionine gamma-lyase; CTH, PLP, propargylglyc | 93.52 | |
| 3k40_A | 475 | Aromatic-L-amino-acid decarboxylase; PLP dependent | 93.46 | |
| 1pff_A | 331 | Methionine gamma-lyase; homocysteine; 2.50A {Trich | 93.44 | |
| 4e1o_A | 481 | HDC, histidine decarboxylase; lyase; HET: PLP PVH; | 93.4 | |
| 1w23_A | 360 | Phosphoserine aminotransferase; pyridoxal-5'-phosp | 93.23 | |
| 3hbx_A | 502 | GAD 1, glutamate decarboxylase 1; calmodulin-bindi | 93.09 | |
| 2z67_A | 456 | O-phosphoseryl-tRNA(SEC) selenium transferase; sel | 93.06 | |
| 1js3_A | 486 | DDC;, DOPA decarboxylase; carbidopa, parkinson'S d | 92.55 | |
| 1ibj_A | 464 | CBL, cystathionine beta-lyase; PLP-dependent enzym | 92.3 | |
| 2zy4_A | 546 | L-aspartate beta-decarboxylase; pyridoxal 5'-phosp | 92.17 | |
| 3tcm_A | 500 | Alanine aminotransferase 2; pyridoxal phosphate (P | 92.08 | |
| 2a7v_A | 490 | Serine hydroxymethyltransferase; structural genomi | 91.73 | |
| 4eu1_A | 409 | Mitochondrial aspartate aminotransferase; ssgcid, | 90.96 | |
| 1e5e_A | 404 | MGL, methionine gamma-lyase; methionine biosynthes | 90.91 | |
| 3d6k_A | 422 | Putative aminotransferase; APC82464, corynebacteri | 90.09 | |
| 3ihj_A | 498 | Alanine aminotransferase 2; helix, structural geno | 89.76 | |
| 1wyu_A | 438 | Glycine dehydrogenase (decarboxylating) subunit 1; | 88.66 | |
| 2r2n_A | 425 | Kynurenine/alpha-aminoadipate aminotransferase mit | 88.63 | |
| 3ppl_A | 427 | Aspartate aminotransferase; dimer, PLP-dependent t | 88.22 | |
| 3hvy_A | 427 | Cystathionine beta-lyase family protein, YNBB B.S | 87.71 | |
| 3i16_A | 427 | Aluminum resistance protein; YP_878183.1, carbon-s | 85.17 | |
| 1rv3_A | 483 | Serine hydroxymethyltransferase, cytosolic; one-ca | 83.38 |
| >4e3q_A Pyruvate transaminase; aminotransferase, transferase; HET: PMP; 1.90A {Vibrio fluvialis} PDB: 4e3r_A* 3nui_A | Back alignment and structure |
|---|
Probab=99.92 E-value=5e-25 Score=152.21 Aligned_cols=83 Identities=24% Similarity=0.305 Sum_probs=74.4
Q ss_pred CccCCCCCCHHHHHHHHHHHHhhc-c--CCCCcchHHHHHHHHHHhhCCCCCCeEEeeCChHHHHHHHHHHHHhh-----
Q psy6206 1 MSLPVGHCHPAVVKAACTQLALLN-T--NNRFLHDNLVLCARKLASLLPDPLSVCFFVNSGSEANDLALRLARVH----- 72 (83)
Q Consensus 1 ~~~~lGh~~p~i~~a~~~~~~~~~-~--~~~~~~~~~~~la~~l~~~~p~~~~~v~f~~sGseA~e~Alk~ar~~----- 72 (83)
|++++||+||+|++|+.+|++++. . ....++++..+|+++|++++|.++++|||++|||||||.|||+||+|
T Consensus 77 ~~~~lGh~~p~v~~Ai~~q~~~l~~~~~~~~~~~~~~~~lAe~L~~~~p~~~~~v~f~~sGsEA~e~AiKlAr~~~~~~g 156 (473)
T 4e3q_A 77 WNMVAGFDHKGLIDAAKAQYERFPGYHAFFGRMSDQTVMLSEKLVEVSPFDSGRVFYTNSGSEANDTMVKMLWFLHAAEG 156 (473)
T ss_dssp TTCTTCSCCHHHHHHHHHHHHHCCCCCCCTTEEEHHHHHHHHHHHHHSSCSSCEEEEESSHHHHHHHHHHHHHHHHHHTT
T ss_pred HHhhccCCCHHHHHHHHHHHHhcccccccccccCHHHHHHHHHHHhhCCCCccEEEEeCchHHHHHHHHHHHHHHHHhcC
Confidence 689999999999999999999983 2 23456899999999999999988999999999999999999999987
Q ss_pred -cCCCceEEecC
Q psy6206 73 -TNNDDVITQDQ 83 (83)
Q Consensus 73 -~~r~~ii~~~~ 83 (83)
++|++||+|+|
T Consensus 157 ~~~r~~ii~~~~ 168 (473)
T 4e3q_A 157 KPQKRKILTRWN 168 (473)
T ss_dssp CTTCCEEEEETT
T ss_pred CCCcceEEEeec
Confidence 56789999976
|
| >4atq_A 4-aminobutyrate transaminase; transferase; HET: PLP; 2.75A {Arthrobacter aurescens} PDB: 4atp_A* | Back alignment and structure |
|---|
| >4ao9_A Beta-phenylalanine aminotransferase; HET: PLP; 1.50A {Variovorax paradoxus} PDB: 4aoa_A* | Back alignment and structure |
|---|
| >4a0g_A Adenosylmethionine-8-amino-7-oxononanoate aminotransferase; BIO3-BIO1, biotin synthesis; HET: PLP; 2.50A {Arabidopsis thaliana} PDB: 4a0h_A* 4a0r_A* 4a0f_A* | Back alignment and structure |
|---|
| >3i5t_A Aminotransferase; pyridoxal 5'-phosphate, PSI-2, NYSGXRC, ST genomics, protein structure initiative; HET: PLP; 2.00A {Rhodobacter sphaeroides 2} | Back alignment and structure |
|---|
| >3hmu_A Aminotransferase, class III; structural genomics, pyridoxal phosphate, PSI-2, protein structure initiative; 2.10A {Silicibacter pomeroyi} | Back alignment and structure |
|---|
| >3tfu_A Adenosylmethionine-8-amino-7-oxononanoate aminotr; transferase, transferase-transferase inhibitor complex; HET: PL8; 1.94A {Mycobacterium tuberculosis} PDB: 3tft_A* 3bv0_A* 3lv2_A* | Back alignment and structure |
|---|
| >3oks_A 4-aminobutyrate transaminase; ssgcid, transferase, seattle structural genomics center for infectious disease; HET: LLP; 1.80A {Mycobacterium smegmatis} PDB: 3r4t_A* 3q8n_A | Back alignment and structure |
|---|
| >4ffc_A 4-aminobutyrate aminotransferase (GABT); structural genomics, niaid, national institute of allergy AN infectious diseases; HET: LLP; 1.80A {Mycobacterium abscessus} | Back alignment and structure |
|---|
| >2yky_A Beta-transaminase; transferase; HET: PLP SFE; 1.69A {Mesorhizobium SP} PDB: 2ykv_A* 2yku_A* 2ykx_A* | Back alignment and structure |
|---|
| >4e77_A Glutamate-1-semialdehyde 2,1-aminomutase; structural genomics, center for structural genomics of infec diseases, csgid, porphyrin biosynthesis; 2.00A {Yersinia pestis} | Back alignment and structure |
|---|
| >3k28_A Glutamate-1-semialdehyde 2,1-aminomutase 2; biosynthesis of cofactors, prosthetic groups, and carriers, csgid, cytoplasm, isomerase; HET: MSE PLP; 1.95A {Bacillus anthracis str} SCOP: c.67.1.4 PDB: 3bs8_A* | Back alignment and structure |
|---|
| >3l44_A Glutamate-1-semialdehyde 2,1-aminomutase 1; alpha beta class, PLP-dependent transferase-like, bacillus A csgid, porphyrin biosynthesis; HET: LLP; 2.05A {Bacillus anthracis} SCOP: c.67.1.0 | Back alignment and structure |
|---|
| >3gju_A Putative aminotransferase; pyridoxal phosphate, PLP-dependent transferase-like fold, ST genomics, joint center for structural genomics, JCSG; HET: MSE LLP PLP; 1.55A {Mesorhizobium loti} PDB: 3fcr_A* | Back alignment and structure |
|---|
| >3dod_A Adenosylmethionine-8-amino-7-oxononanoate aminotr; aminotransferase, biotin biosynthesis, pyridoxal phosphate, adenosyl-L-methionine; HET: PLP; 1.90A {Bacillus subtilis} SCOP: c.67.1.0 PDB: 3drd_A 3du4_A* | Back alignment and structure |
|---|
| >4a6r_A Omega transaminase; transferase, PLP-binding enzyme, transaminase fold type I; HET: TA8; 1.35A {Chromobacterium violaceum} PDB: 4a6t_A* 4a6u_A 4a72_A* 4ah3_A* | Back alignment and structure |
|---|
| >3fq8_A Glutamate-1-semialdehyde 2,1-aminomutase; drug resistance, microev0lution, integrated approach, chlorophyll biosynthesis; HET: PMP; 2.00A {Synechococcus elongatus pcc 6301} SCOP: c.67.1.4 PDB: 2hp1_A* 2hoz_A* 2hoy_A* 2hp2_A* 3fq7_A* 3usf_A* 2gsa_A* 3gsb_A* 4gsa_A* 3fqa_A* 2cfb_A* | Back alignment and structure |
|---|
| >3n5m_A Adenosylmethionine-8-amino-7-oxononanoate aminotr; aminotransferase, csgid; 2.05A {Bacillus anthracis} | Back alignment and structure |
|---|
| >1ohv_A 4-aminobutyrate aminotransferase; PLP-dependent enzyme, 4- AMIN acid, antiepileptic drug target; HET: PLP; 2.3A {Sus scrofa} SCOP: c.67.1.4 PDB: 1ohw_A* 1ohy_A* | Back alignment and structure |
|---|
| >2cjg_A L-lysine-epsilon aminotransferase; internal aldimine, pyridoxal phosphate, PLP, RV3290C, lysine amino transferase; HET: PMP; 1.95A {Mycobacterium tuberculosis} PDB: 2cjd_A* 2cin_A* 2cjh_A* 2jjg_A* 2jje_A* 2jjh_A* 2jjf_A | Back alignment and structure |
|---|
| >2e7u_A Glutamate-1-semialdehyde 2,1-aminomutase; PLP enzyme, GSA, structural genomics, NPPSFA; HET: PMP; 1.90A {Thermus thermophilus} | Back alignment and structure |
|---|
| >2epj_A Glutamate-1-semialdehyde 2,1-aminomutase; PLP enzyme, GSA, structural genomics, NPPSFA; HET: PMP; 1.70A {Aeropyrum pernix} PDB: 2zsl_A* 2zsm_A* | Back alignment and structure |
|---|
| >3i4j_A Aminotransferase, class III; structural GENOMICS,NYSGXRC, target 11246C, deino radiodurans, pyridoxal phosphate, transfe PSI-2; 1.70A {Deinococcus radiodurans} | Back alignment and structure |
|---|
| >1zod_A DGD, 2,2-dialkylglycine decarboxylase; pyridoxal, cesium, lyase; HET: MES PLP; 1.80A {Burkholderia cepacia} SCOP: c.67.1.4 PDB: 1dka_A* 1m0o_A* 1m0p_A* 1m0n_A* 1zc9_A* 1zob_A* 1m0q_A* 2dkb_A* 1dgd_A* 1dge_A* 1d7u_A* 1d7s_A* 1d7r_A* 1d7v_A* 1z3z_A* | Back alignment and structure |
|---|
| >3dxv_A Alpha-amino-epsilon-caprolactam racemase; fold-TYPE1, pyridoxal-5'-phosphate dependent racemase, pyrid phosphate, isomerase; HET: PLP; 2.21A {Achromobacter obae} PDB: 2zuk_A* 3dxw_A* | Back alignment and structure |
|---|
| >1z7d_A Ornithine aminotransferase; structural genomics consortium, SGC, malaria; 2.10A {Plasmodium yoelii yoelii} SCOP: c.67.1.4 PDB: 3lg0_A 3ntj_A | Back alignment and structure |
|---|
| >3nx3_A Acoat, acetylornithine aminotransferase; csgid, structural genomics, center for structural genomics O infectious diseases; 1.80A {Campylobacter jejuni subsp} | Back alignment and structure |
|---|
| >2cy8_A D-phgat, D-phenylglycine aminotransferase; structural genomics, NPPSFA, national PROJ protein structural and functional analyses; 2.30A {Pseudomonas stutzeri} | Back alignment and structure |
|---|
| >2oat_A Ornithine aminotransferase; 5-fluoromethylornithine, PLP-dependent ENZ pyridoxal phosphate; HET: PFM; 1.95A {Homo sapiens} SCOP: c.67.1.4 PDB: 1oat_A* 2byj_A* 2byl_A* 1gbn_A* 2can_A* | Back alignment and structure |
|---|
| >2pb2_A Acetylornithine/succinyldiaminopimelate aminotran; ARGD, pyridoxal 5'-phosphate, arginine metabolism, lysine biosynthesis, gabaculine; HET: PLP; 1.91A {Salmonella typhimurium} PDB: 2pb0_A* | Back alignment and structure |
|---|
| >3a8u_X Omega-amino acid--pyruvate aminotransferase; large pleated sheet, transaminase, pyridox phosphate; HET: PLP; 1.40A {Pseudomonas putida} | Back alignment and structure |
|---|
| >1s0a_A Adenosylmethionine-8-amino-7-oxononanoate aminotransferase; fold type I, subclass II, homodimer; HET: LLP; 1.71A {Escherichia coli} SCOP: c.67.1.4 PDB: 1qj5_A* 1mlz_A* 1qj3_A* 1mly_A* 1s06_A* 1s08_A* 1s09_A* 1s07_A* 1mgv_A* 1dty_A* | Back alignment and structure |
|---|
| >3ruy_A Ornithine aminotransferase; structural genomics, csgid, center for structural genomics O infectious diseases, alpha and beta protein; HET: LLP; 2.65A {Bacillus anthracis} SCOP: c.67.1.0 | Back alignment and structure |
|---|
| >2eo5_A 419AA long hypothetical aminotransferase; PLP enzyme, structural genomics, NPPSFA, N project on protein structural and functional analyses; HET: PLP; 1.90A {Sulfolobus tokodaii} | Back alignment and structure |
|---|
| >4adb_A Succinylornithine transaminase; transferase, PLP enzymes, aminotransferase; HET: PLP; 2.20A {Escherichia coli} PDB: 4adc_A* 4add_A* 4ade_A | Back alignment and structure |
|---|
| >1sff_A 4-aminobutyrate aminotransferase; enzyme complexes; HET: IK2; 1.90A {Escherichia coli} SCOP: c.67.1.4 PDB: 1sf2_A* 1szk_A* 1szu_A* 1szs_A* | Back alignment and structure |
|---|
| >2ord_A Acoat, acetylornithine aminotransferase; TM1785, acetylornithine aminotransferase (EC 2.6.1.11) (ACOA structural genomics; HET: MSE PLP; 1.40A {Thermotoga maritima MSB8} PDB: 2e54_A* | Back alignment and structure |
|---|
| >1vef_A Acetylornithine/acetyl-lysine aminotransferase; PLP, riken structural genomics/proteomics initiative, RSGI, structural genomics; HET: PLP; 1.35A {Thermus thermophilus} SCOP: c.67.1.4 PDB: 1wkg_A* 1wkh_A* | Back alignment and structure |
|---|
| >2eh6_A Acoat, acetylornithine aminotransferase; ARGD, structural genomics, NPPSFA, national project on prote structural and functional analyses; HET: PLP; 1.90A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >3l8a_A METC, putative aminotransferase, probable beta-cystathi; beta-cystathionase, lyase; HET: PLP; 1.54A {Streptococcus mutans} | Back alignment and structure |
|---|
| >1svv_A Threonine aldolase; structural genomics, structural genomics of pathogenic proto SGPP, protein structure initiative, PSI; 2.10A {Leishmania major} SCOP: c.67.1.1 | Back alignment and structure |
|---|
| >1elu_A L-cysteine/L-cystine C-S lyase; FES cluster biosynthesis, pyridoxal 5'-phosphate, thiocystei aminoacrylate, enzyme-product complex; HET: PDA; 1.55A {Synechocystis SP} SCOP: c.67.1.3 PDB: 1elq_A* 1n2t_A* 1n31_A* | Back alignment and structure |
|---|
| >1kmj_A Selenocysteine lyase; persulfide perselenide NIFS pyridoxal phosphate, structural PSI, protein structure initiative; HET: PLP; 2.00A {Escherichia coli} SCOP: c.67.1.3 PDB: 1i29_A* 1jf9_A* 1kmk_A* 1c0n_A* | Back alignment and structure |
|---|
| >3nyt_A Aminotransferase WBPE; PLP binding, nucleotide-sugar binding; HET: ULP; 1.30A {Pseudomonas aeruginosa} PDB: 3nys_A* 3nyu_A* 3nu8_A* 3nu7_A* 3nub_A* | Back alignment and structure |
|---|
| >3f9t_A TDC, L-tyrosine decarboxylase MFNA; NP_247014.1, L-tyrosine decarboxylase MFNA (EC 4.1.1.25), ST genomics; HET: PLP; 2.11A {Methanocaldococcus jannaschii} | Back alignment and structure |
|---|
| >2w8t_A SPT, serine palmitoyltransferase; HET: LLP; 1.25A {Sphingomonas paucimobilis} PDB: 2w8u_A* 2w8w_A* 2xbn_A* 2w8j_A* 2w8v_A* 2jg2_A* 2jgt_A 2x8u_A* | Back alignment and structure |
|---|
| >4dq6_A Putative pyridoxal phosphate-dependent transferas; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: PLP; 1.50A {Clostridium difficile} PDB: 4dgt_A* | Back alignment and structure |
|---|
| >1lc5_A COBD, L-threonine-O-3-phosphate decarboxylase; PLP-dependent decarboxylase cobalamin, lyase; 1.46A {Salmonella enterica} SCOP: c.67.1.1 PDB: 1lc7_A* 1lc8_A* 1lkc_A* | Back alignment and structure |
|---|
| >1v72_A Aldolase; PLP-dependent enzyme, lyase; HET: PLP; 2.05A {Pseudomonas putida} SCOP: c.67.1.1 | Back alignment and structure |
|---|
| >3frk_A QDTB; aminotransferase, sugar-modification, natural porduct; HET: TQP; 2.15A {Thermoanaerobacteriumthermosaccharolyticum} | Back alignment and structure |
|---|
| >3lvm_A Cysteine desulfurase; structural genomics, montreal-kingston bacterial structural genomics initiative, BSGI, transferase; HET: PLP; 2.05A {Escherichia coli} PDB: 3lvk_A* 3lvl_B* 3lvj_A* 1p3w_B* | Back alignment and structure |
|---|
| >1eg5_A Aminotransferase; PLP-dependent enzymes, iron-sulfur-cluster synthesis, C-S BE transferase; HET: PLP; 2.00A {Thermotoga maritima} SCOP: c.67.1.3 PDB: 1ecx_A* | Back alignment and structure |
|---|
| >1qz9_A Kynureninase; kynurenine, tryptophan, PLP, vitamin B6, pyridoxal-5'-phosph hydrolase; HET: PLP P3G; 1.85A {Pseudomonas fluorescens} SCOP: c.67.1.3 | Back alignment and structure |
|---|
| >1t3i_A Probable cysteine desulfurase; PLP-binding enzyme, transferase; HET: 2OS PLP; 1.80A {Synechocystis SP} SCOP: c.67.1.3 | Back alignment and structure |
|---|
| >1v2d_A Glutamine aminotransferase; PLP, riken structural genomics/proteomics initi RSGI, structural genomics; HET: PLP; 1.90A {Thermus thermophilus} SCOP: c.67.1.1 PDB: 1v2e_A* 1v2f_A* | Back alignment and structure |
|---|
| >3dzz_A Putative pyridoxal 5'-phosphate-dependent C-S LYA; putative PLP-dependent aminotransferase; HET: MSE LLP PG4; 1.61A {Lactobacillus delbrueckii subsp} SCOP: c.67.1.0 | Back alignment and structure |
|---|
| >3uwc_A Nucleotide-sugar aminotransferase; lipopolysaccharide biosynthesis; HET: MSE PMP; 1.80A {Coxiella burnetii} | Back alignment and structure |
|---|
| >3cq5_A Histidinol-phosphate aminotransferase; PLP, PMP, amino-acid biosynthesis, histidine biosynthesis, pyridoxal phosphate; HET: PMP; 1.80A {Corynebacterium glutamicum} PDB: 3cq6_A* 3cq4_A | Back alignment and structure |
|---|
| >3ezs_A Aminotransferase ASPB; NP_207418.1, structural genomics, JOI for structural genomics, JCSG; HET: MSE; 2.19A {Helicobacter pylori 26695} SCOP: c.67.1.0 | Back alignment and structure |
|---|
| >3ftb_A Histidinol-phosphate aminotransferase; structural genomics, PSI, MCSG, protein structure initiative; 2.00A {Clostridium acetobutylicum} SCOP: c.67.1.0 | Back alignment and structure |
|---|
| >4eb5_A Probable cysteine desulfurase 2; scaffold, transferase-metal binding protein complex; HET: PLP EPE; 2.53A {Archaeoglobus fulgidus} PDB: 4eb7_A* | Back alignment and structure |
|---|
| >1fc4_A 2-amino-3-ketobutyrate conenzyme A ligase; 2-amino-3-ketobutyrate COA ligase, pyridoxal phosphate, COEN transferase, structural genomics; HET: PLP; 2.00A {Escherichia coli} SCOP: c.67.1.4 | Back alignment and structure |
|---|
| >1bs0_A Protein (8-amino-7-oxonanoate synthase); PLP-dependent acyl-COA synthase, biotin biosynthesis, 8-AMIN oxonanoate synthase; 1.65A {Escherichia coli} SCOP: c.67.1.4 PDB: 2g6w_A* 1dje_A* 1dj9_A* | Back alignment and structure |
|---|
| >3tqx_A 2-amino-3-ketobutyrate coenzyme A ligase; energy metabolism, transferase; HET: PLP; 2.30A {Coxiella burnetii} | Back alignment and structure |
|---|
| >1ax4_A Tryptophanase; tryptophan biosynthesis, tryptophan indole-lyase, pyridoxal 5'-phosphate, monovalent cation binding site; HET: LLP; 2.10A {Proteus vulgaris} SCOP: c.67.1.2 | Back alignment and structure |
|---|
| >3kki_A CAI-1 autoinducer synthase; quorum sensing, CQSA, P virulence, acyltransferase, aminotransferase, pyridoxal PHO transferase; HET: PLP; 1.80A {Vibrio cholerae} PDB: 3hqt_A* 2wk9_A* 2wk8_A* 2wka_A* 2wk7_A | Back alignment and structure |
|---|
| >3ly1_A Putative histidinol-phosphate aminotransferase; structural G joint center for structural genomics, JCSG; HET: MSE PLP CIT; 1.80A {Erwinia carotovora atroseptica} | Back alignment and structure |
|---|
| >2q7w_A Aspartate aminotransferase; mechanism-based inhibitor, PLP, sadta, PH dependence; HET: KST PSZ PMP GOL; 1.40A {Escherichia coli} SCOP: c.67.1.1 PDB: 2qa3_A* 2qb2_A* 2qb3_A* 2qbt_A* 3qn6_A* 3pa9_A* 1aaw_A* 1amq_A* 1ams_A* 1arg_A* 1amr_A* 1art_A* 1asa_A* 1asd_A* 1ase_A* 1asl_A* 1asm_A* 1asn_A* 1c9c_A* 1cq6_A* ... | Back alignment and structure |
|---|
| >1ajs_A Aspartate aminotransferase; PIG, in the presence of ligand 2-methylaspartate; HET: LLP PLA; 1.60A {Sus scrofa} SCOP: c.67.1.1 PDB: 1ajr_A* 3ii0_A* 1aat_A 2cst_A* | Back alignment and structure |
|---|
| >2e7j_A SEP-tRNA:Cys-tRNA synthase; seven-stranded BETE-strand, lyase, structural genomics; HET: PLP; 2.40A {Archaeoglobus fulgidus} SCOP: c.67.1.9 PDB: 2e7i_A* | Back alignment and structure |
|---|
| >3dr4_A Putative perosamine synthetase; deoxysugar, pyridoxal phosphate, aspartate aminotransferase, O-antigen; HET: G4M; 1.60A {Caulobacter crescentus} PDB: 3dr7_A* 3bn1_A* | Back alignment and structure |
|---|
| >3hdo_A Histidinol-phosphate aminotransferase; PSI-II, histidinol-phosphate aminotrans structural genomics, protein structure initiative; 1.61A {Geobacter metallireducens gs-15} | Back alignment and structure |
|---|
| >2z61_A Probable aspartate aminotransferase 2; amino acid aminotransferase, kynurenine aminotransferase, MJ0684, cytoplasm; HET: LLP; 2.20A {Methanococcus jannaschii} | Back alignment and structure |
|---|
| >1vjo_A Alanine--glyoxylate aminotransferase; 17130350, ALR1004, STR genomics, JCSG, PSI, protein structure initiative, joint CE structural genomics; HET: PLP; 1.70A {Nostoc SP} SCOP: c.67.1.3 | Back alignment and structure |
|---|
| >2cb1_A O-acetyl homoserine sulfhydrylase; PLP enzyme, lyase, riken structural genomics/proteomics initiative, RSGI, structural genomics; HET: LLP; 2.0A {Thermus thermophilus} | Back alignment and structure |
|---|
| >3a2b_A Serine palmitoyltransferase; vitamin B6-dependent enzyme fold type I, acyltransferase, PY phosphate; HET: PLP; 2.30A {Sphingobacterium multivorum} | Back alignment and structure |
|---|
| >3cai_A Possible aminotransferase; RV3778C; 1.80A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >3ffh_A Histidinol-phosphate aminotransferase; APC88260, listeria in CLIP11262, structural genomics, PSI-2; 2.31A {Listeria innocua} SCOP: c.67.1.0 | Back alignment and structure |
|---|
| >3get_A Histidinol-phosphate aminotransferase; NP_281508.1, structural genomics, joint center for structural genomics; HET: LLP MSE; 2.01A {Campylobacter jejuni subsp} | Back alignment and structure |
|---|
| >1yiz_A Kynurenine aminotransferase; glutamine transaminase; kynurenic acid, mosquito, PLP-enzyme, pyridoxal phosphate, PLP; HET: LLP; 1.55A {Aedes aegypti} SCOP: c.67.1.1 PDB: 1yiy_A* 2r5c_A* 2r5e_A* | Back alignment and structure |
|---|
| >1d2f_A MALY protein; aminotransferase fold, large PLP-binding domain, small C-TER domain, open alpha-beta structure., transferase; HET: PLP; 2.50A {Escherichia coli} SCOP: c.67.1.3 | Back alignment and structure |
|---|
| >3vax_A Putative uncharacterized protein DNDA; desulfurase, transferase; HET: PLP; 2.40A {Streptomyces lividans} | Back alignment and structure |
|---|
| >3jtx_A Aminotransferase; NP_283882.1, structural genomics, joint CE structural genomics, JCSG, protein structure initiative; HET: LLP MES; 1.91A {Neisseria meningitidis Z2491} | Back alignment and structure |
|---|
| >2fnu_A Aminotransferase; protein-product complex, structural genomics, montreal-kings bacterial structural genomics initiative, BSGI; HET: PMP UD1; 1.50A {Helicobacter pylori} SCOP: c.67.1.4 PDB: 2fni_A* 2fn6_A* | Back alignment and structure |
|---|
| >3euc_A Histidinol-phosphate aminotransferase 2; YP_297314.1, structur genomics, joint center for structural genomics, JCSG; HET: MSE; 2.05A {Ralstonia eutropha JMP134} SCOP: c.67.1.0 | Back alignment and structure |
|---|
| >2oqx_A Tryptophanase; lyase, pyridoxal phosphate, tryptophan catabolism; HET: CME EPE; 1.90A {Escherichia coli} SCOP: c.67.1.2 PDB: 2c44_A 2v1p_A* 2v0y_A* | Back alignment and structure |
|---|
| >2zc0_A Alanine glyoxylate transaminase; alanine:glyoxylate aminotransferase, archaea, thermococcus L transferase; HET: PMP; 2.30A {Thermococcus litoralis} | Back alignment and structure |
|---|
| >2ay1_A Aroat, aromatic amino acid aminotransferase; HET: PLP AHC; 2.20A {Paracoccus denitrificans} SCOP: c.67.1.1 PDB: 1ay5_A* 1ay4_A* 1ay8_A* 2ay2_A* 2ay3_A* 2ay4_A* 2ay5_A* 2ay6_A* 2ay7_A* 2ay8_A* 2ay9_A* | Back alignment and structure |
|---|
| >2zyj_A Alpha-aminodipate aminotransferase; alpha-aminoadipate aminotransferase; HET: PGU; 1.67A {Thermus thermophilus} PDB: 2egy_A* 2dtv_A* 2zg5_A* 2zp7_A* 2z1y_A* 3cbf_A* | Back alignment and structure |
|---|
| >1c7n_A Cystalysin; transferase, aminotransferase, pyridoxal phosphate; HET: PLP; 1.90A {Treponema denticola} SCOP: c.67.1.3 PDB: 1c7o_A* | Back alignment and structure |
|---|
| >2z9v_A Aspartate aminotransferase; pyridoxamine, pyruvate; HET: PXM; 1.70A {Mesorhizobium loti} PDB: 2z9u_A* 2z9w_A* 2z9x_A* | Back alignment and structure |
|---|
| >3fkd_A L-threonine-O-3-phosphate decarboxylase; structural genomic, , structural genomics, PSI-2, protein structure initiative; 2.50A {Porphyromonas gingivalis} | Back alignment and structure |
|---|
| >3b8x_A WBDK, pyridoxamine 5-phosphate-dependent dehydrase; aspartate aminotransferase, colitose, perosamine, O-antigen, pyridoxal phosphate,; HET: G4M; 1.70A {Escherichia coli} PDB: 2gms_A* 2gmu_A* 2r0t_A* 3gr9_A* | Back alignment and structure |
|---|
| >3fdb_A Beta C-S lyase, putative PLP-dependent beta-cystathionase; PLP-dependent transferase-like fold, structural genomics; HET: LLP; 1.99A {Corynebacterium diphtheriae} | Back alignment and structure |
|---|
| >4hvk_A Probable cysteine desulfurase 2; transferase and ISCS, transferase; HET: PMP PG4; 1.43A {Archaeoglobus fulgidus} PDB: 4eb7_A* 4eb5_A* | Back alignment and structure |
|---|
| >1wyu_B Glycine dehydrogenase subunit 2 (P-protein); alpha(2)beta(2) tetramer, riken structural genomics/proteomi initiative, RSGI; HET: PLP; 2.10A {Thermus thermophilus} SCOP: c.67.1.7 PDB: 1wyt_B* 1wyv_B* | Back alignment and structure |
|---|
| >3fsl_A Aromatic-amino-acid aminotransferase; tyrosine aminotransferase, pyridoxal phosphate, internal ALD schiff base, amino-acid biosynthesis; HET: PLR; 2.35A {Escherichia coli k-12} SCOP: c.67.1.1 PDB: 3tat_A* | Back alignment and structure |
|---|
| >3dyd_A Tyrosine aminotransferase; PLP, SGC, structural genomics, structural genomics consortium, disease mutation, phenylalani catabolism; HET: PLP; 2.30A {Homo sapiens} PDB: 3pdx_A* | Back alignment and structure |
|---|
| >2dou_A Probable N-succinyldiaminopimelate aminotransfera; PLP-dependent enzyme, structural genomics, NPPSFA; HET: EPE; 2.30A {Thermus thermophilus} | Back alignment and structure |
|---|
| >1u08_A Hypothetical aminotransferase YBDL; alpha beta protein; HET: PLP; 2.35A {Escherichia coli} SCOP: c.67.1.1 | Back alignment and structure |
|---|
| >3ele_A Amino transferase; RER070207001803, structural genomics, JOI for structural genomics, JCSG; HET: MSE PLP; 2.10A {Eubacterium rectale} | Back alignment and structure |
|---|
| >2o0r_A RV0858C (N-succinyldiaminopimelate aminotransfera; PLP-binding enzyme, lysine biosynthesis, aminotransferase, S genomics; HET: LLP; 2.00A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >3pj0_A LMO0305 protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-biology, lyase; HET: LLP MSE; 1.80A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >3a9z_A Selenocysteine lyase; PLP, cytoplasm, pyridoxal phosphate, transferase; HET: PLP SLP; 1.55A {Rattus norvegicus} PDB: 3a9x_A* 3a9y_A* 3gzd_A* 3gzc_A* 2hdy_A* | Back alignment and structure |
|---|
| >2x5d_A Probable aminotransferase; HET: LLP PLP; 2.25A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >3p1t_A Putative histidinol-phosphate aminotransferase; PLP-dependent transferase-like, structural genomics, joint C structural genomics, JCSG; HET: TLA; 2.60A {Burkholderia pseudomallei} | Back alignment and structure |
|---|
| >4f4e_A Aromatic-amino-acid aminotransferase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; HET: LLP; 1.80A {Burkholderia pseudomallei} PDB: 4eff_A* | Back alignment and structure |
|---|
| >3mc6_A Sphingosine-1-phosphate lyase; carboxy-lyase activity, pyridoxyl phosphate; HET: LLP; 3.15A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1gd9_A Aspartate aminotransferase; pyridoxal enzyme, temperature dependence O substrate recognition; HET: PLP; 1.80A {Pyrococcus horikoshii} SCOP: c.67.1.1 PDB: 1gde_A* 1dju_A* | Back alignment and structure |
|---|
| >1iug_A Putative aspartate aminotransferase; wild type, pyridoxal-5'-phosphate form, riken structural genomics/proteomics initiative, RSGI; HET: LLP; 2.20A {Thermus thermophilus} SCOP: c.67.1.3 | Back alignment and structure |
|---|
| >3nra_A Aspartate aminotransferase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: LLP; 2.15A {Rhodobacter sphaeroides} | Back alignment and structure |
|---|
| >2dr1_A PH1308 protein, 386AA long hypothetical serine aminotransferase; PLP, structural genomics, NPPSFA; HET: PLP; 1.90A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >1vp4_A Aminotransferase, putative; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; HET: MSE PLP; 1.82A {Thermotoga maritima} SCOP: c.67.1.1 | Back alignment and structure |
|---|
| >3g7q_A Valine-pyruvate aminotransferase; NP_462565.1, structur genomics, joint center for structural genomics, JCSG, prote structure initiative; HET: MSE; 1.80A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >1o4s_A Aspartate aminotransferase; TM1255, structural genomics, JCS protein structure initiative, joint center for structural G transferase; HET: PLP; 1.90A {Thermotoga maritima} SCOP: c.67.1.1 | Back alignment and structure |
|---|
| >2bwn_A 5-aminolevulinate synthase; tetrapyrrole biosynthesis, heme biosynthesis, pyridoxal PHOS dependent, transferase, acyltransferase; HET: LLP; 2.1A {Rhodobacter capsulatus} SCOP: c.67.1.4 PDB: 2bwo_A* 2bwp_A* | Back alignment and structure |
|---|
| >1j32_A Aspartate aminotransferase; HET: PLP; 2.10A {Phormidium lapideum} SCOP: c.67.1.1 | Back alignment and structure |
|---|
| >2oga_A Transaminase; PLP-dependent enzyme, desosamine, deoxysugars, antibiotics, hydrolase; HET: PGU; 2.05A {Streptomyces venezuelae} PDB: 2oge_A* | Back alignment and structure |
|---|
| >2o1b_A Aminotransferase, class I; aminotrasferase; HET: PLP; 1.95A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >2huf_A Alanine glyoxylate aminotransferase; alpha and beta protein, PLP-dependent transferase; HET: LLP; 1.75A {Aedes aegypti} PDB: 2hui_A* 2huu_A* | Back alignment and structure |
|---|
| >3acz_A Methionine gamma-lyase; L-methionine; HET: LLP; 1.97A {Entamoeba histolytica} PDB: 3aej_A* 3ael_A* 3aem_A* 3aen_A* 3aeo_A* 3aep_A* | Back alignment and structure |
|---|
| >3qhx_A Cystathionine gamma-synthase METB (CGS); structural genomics, seattle structural genomics center for infectious disease, ssgcid, CGS_LIKE; HET: LLP EPE; 1.65A {Mycobacterium ulcerans} SCOP: c.67.1.0 PDB: 3qi6_A* | Back alignment and structure |
|---|
| >3nnk_A Ureidoglycine-glyoxylate aminotransferase; PLP-dependent; HET: LLP; 2.58A {Klebsiella pneumoniae} | Back alignment and structure |
|---|
| >1mdo_A ARNB aminotransferase; type 1 aminotransferase fold; HET: MSE PMP; 1.70A {Salmonella typhimurium} SCOP: c.67.1.4 PDB: 1mdx_A* 1mdz_A* | Back alignment and structure |
|---|
| >1b9h_A AHBA synthase, protein (3-amino-5-hydroxybenzoic acid synthase); rifamycin biosynthesis (RIFD gene); HET: PLP; 2.00A {Amycolatopsis mediterranei} SCOP: c.67.1.4 PDB: 1b9i_A* | Back alignment and structure |
|---|
| >3h14_A Aminotransferase, classes I and II; YP_167802.1, SPO258 structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.90A {Silicibacter pomeroyi dss-3} | Back alignment and structure |
|---|
| >2po3_A 4-dehydrase; external aldimine, PLP, aminotransferase, TDP-sugar; HET: T4K; 2.10A {Streptomyces venezuelae} | Back alignment and structure |
|---|
| >3e2y_A Kynurenine-oxoglutarate transaminase 3; alpha beta protein, PLP dependent protein, aminotransferase, pyridoxal phosphate, transferase; HET: GLN PMP; 2.26A {Mus musculus} SCOP: c.67.1.0 PDB: 2zjg_A* 3e2f_A* 3e2z_A* | Back alignment and structure |
|---|
| >3isl_A Purine catabolism protein PUCG; pyridoxalphosphate, PLP dependent enzymes, purine metabolism transaminases, aminotransferases; HET: PLP; 2.06A {Bacillus subtilis} | Back alignment and structure |
|---|
| >1bw0_A TAT, protein (tyrosine aminotransferase); tyrosine catabolism, pyridoxal-5'-phosphate, PLP; HET: LLP; 2.50A {Trypanosoma cruzi} SCOP: c.67.1.1 | Back alignment and structure |
|---|
| >3kgw_A Alanine-glyoxylate aminotransferase; AAH25799.1, putative aminotransferase, structural genomics, center for structural genomics, JCSG; HET: PLP; 1.65A {Mus musculus} SCOP: c.67.1.3 PDB: 3kgx_A 3imz_A* 3r9a_A* 1h0c_A* 1j04_A* | Back alignment and structure |
|---|
| >3mad_A Sphingosine-1-phosphate lyase; carboxy-lyase activity, pyridoxal phosphate; HET: LLP; 2.00A {Symbiobacterium thermophilum} PDB: 3maf_A* 3mau_A* 3mbb_A* | Back alignment and structure |
|---|
| >3g0t_A Putative aminotransferase; NP_905498.1, putative aspartate aminotransferase, structural genomics, joint center for structural genomics; HET: MSE LLP PE4; 1.75A {Porphyromonas gingivalis} | Back alignment and structure |
|---|
| >2gb3_A Aspartate aminotransferase; TM1698, structural genomics, PSI structure initiative, joint center for structural genomics; HET: LLP; 2.50A {Thermotoga maritima} SCOP: c.67.1.1 | Back alignment and structure |
|---|
| >3b46_A Aminotransferase BNA3; kynurenine aminotransferase, LLP, PLP, cytoplasm, mitochondrion, pyridoxal phosphate; HET: LLP; 2.00A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3zrp_A Serine-pyruvate aminotransferase (AGXT); HET: PLP; 1.75A {Sulfolobus solfataricus} PDB: 3zrq_A* 3zrr_A* | Back alignment and structure |
|---|
| >3lws_A Aromatic amino acid beta-eliminating lyase/threonine aldolase; structural genomics, joint center for structural genomics, JCSG; HET: LLP MSE; 2.00A {Exiguobacterium sibiricum} | Back alignment and structure |
|---|
| >1xi9_A Putative transaminase; alanine aminotransferase, southeast collaboratory for structural genomics, secsg; HET: PLP; 2.33A {Pyrococcus furiosus} SCOP: c.67.1.1 | Back alignment and structure |
|---|
| >3aow_A Putative uncharacterized protein PH0207; protein-PLP-AKG triple complex, schiff-base linkage, kynuren aminotransferase; HET: PLP AKG; 1.56A {Pyrococcus horikoshii} PDB: 3aov_A* 3ath_A* 3av7_A* 1x0m_A 1wst_A* | Back alignment and structure |
|---|
| >3ecd_A Serine hydroxymethyltransferase 2; ssgcid, decode, bupsa00008A, one-carbon metabolism, pyridoxa phosphate, structural genomics; 1.60A {Burkholderia pseudomallei} | Back alignment and structure |
|---|
| >2ch1_A 3-hydroxykynurenine transaminase; PLP-enzyme, kynurenine pathway, transferase; HET: LLP; 2.4A {Anopheles gambiae} SCOP: c.67.1.3 PDB: 2ch2_A* | Back alignment and structure |
|---|
| >3gbx_A Serine hydroxymethyltransferase; structural genomics, IDP01011, serine hydroxymethyltransfera salmonella typhimurium.; HET: MSE; 1.80A {Salmonella typhimurium} SCOP: c.67.1.4 PDB: 1dfo_A* 3g8m_A* 1eqb_A* | Back alignment and structure |
|---|
| >2rfv_A Methionine gamma-lyase; pyridoxal-5'-phosphate, PLP-dependent enzyme; HET: LLP; 1.35A {Citrobacter freundii} PDB: 1y4i_A* 3jwa_A* 3jw9_A* 3jwb_A* 3mkj_A* | Back alignment and structure |
|---|
| >3fvs_A Kynurenine--oxoglutarate transaminase 1; alpha beta protein, PLP dependent protein, aminotransferase, pyridoxal phosphate, transferase; HET: LLP; 1.50A {Homo sapiens} SCOP: c.67.1.1 PDB: 3fvu_A* 3fvx_A* 1w7l_A* 1w7m_A* 1w7n_A* | Back alignment and structure |
|---|
| >2qma_A Diaminobutyrate-pyruvate transaminase and L-2,4- diaminobutyrate decarboxylase; structural genomics, APC91511.1, glutamate decarboxylase; HET: MSE; 1.81A {Vibrio parahaemolyticus} | Back alignment and structure |
|---|
| >3e9k_A Kynureninase; kynurenine-L-hydrolase, kynurenine hydrolase, pyridoxal-5'-phosphate, inhibitor complex, 3-hydroxy hippur hydroxyhippuric acid, PLP; HET: PLP 3XH; 1.70A {Homo sapiens} PDB: 2hzp_A* | Back alignment and structure |
|---|
| >3ke3_A Putative serine-pyruvate aminotransferase; structural genomi center for structural genomics, JCSG, protein structure INI PSI-2; HET: LLP; 2.20A {Psychrobacter arcticus 273-4} | Back alignment and structure |
|---|
| >3f0h_A Aminotransferase; RER070207000802, structural genomics, JOIN for structural genomics, JCSG; HET: MSE LLP; 1.70A {Eubacterium rectale} | Back alignment and structure |
|---|
| >1uu1_A Histidinol-phosphate aminotransferase; histidine biosynthesis, pyridoxal phosphate, complete proteome; HET: PMP HSA; 2.38A {Thermotoga maritima} SCOP: c.67.1.1 PDB: 1uu0_A 1h1c_A* 1uu2_A* 2f8j_A* | Back alignment and structure |
|---|
| >2c81_A Glutamine-2-deoxy-scyllo-inosose aminotransferase; SMAT, butirosin, aminoglycoside antibiotics; HET: PMP; 1.7A {Bacillus circulans} PDB: 2c7t_A* | Back alignment and structure |
|---|
| >2yrr_A Aminotransferase, class V; structural genomics, NPPSFA, national PROJ protein structural and functional analyses; HET: PLP; 1.86A {Thermus thermophilus} PDB: 2yri_A* | Back alignment and structure |
|---|
| >3b1d_A Betac-S lyase; HET: PLP PLS EPE; 1.66A {Streptococcus anginosus} PDB: 3b1c_A* 3b1e_A* | Back alignment and structure |
|---|
| >3qgu_A LL-diaminopimelate aminotransferase; L-lysine, pyridoxal-5' phosphate, chamydomonas reinhardtii; HET: GOL; 1.55A {Chlamydomonas reinhardtii} | Back alignment and structure |
|---|
| >1yaa_A Aspartate aminotransferase; HET: PLP; 2.05A {Saccharomyces cerevisiae} SCOP: c.67.1.1 | Back alignment and structure |
|---|
| >3h7f_A Serine hydroxymethyltransferase 1; cytoplasm, one-carbon metabolism, pyridoxal phosphate, structural genomics; HET: LLP; 1.50A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >2dgk_A GAD-beta, GADB, glutamate decarboxylase beta; gadbd1-14, autoinhibition, substituted aldamine, lyase; HET: PLP; 1.90A {Escherichia coli} PDB: 2dgm_A* 1pmo_A* 2dgl_A* 1pmm_A* 3fz6_A* 3fz7_A 3fz8_A* 1xey_A* | Back alignment and structure |
|---|
| >1o69_A Aminotransferase; structural genomics, unknown function; HET: X04; 1.84A {Campylobacter jejuni} SCOP: c.67.1.4 PDB: 1o62_A 1o61_A* | Back alignment and structure |
|---|
| >1m32_A 2-aminoethylphosphonate-pyruvate aminotransferase; PLP-dependent aminotransferase fold; HET: PLP; 2.20A {Salmonella typhimurium} SCOP: c.67.1.3 | Back alignment and structure |
|---|
| >1gc0_A Methionine gamma-lyase; pyridoxal-5'-phosphate; HET: LLP; 1.70A {Pseudomonas putida} SCOP: c.67.1.3 PDB: 1gc2_A* 1pg8_A* 1ukj_A* 2o7c_A* | Back alignment and structure |
|---|
| >3asa_A LL-diaminopimelate aminotransferase; PLP dependent aminotransferase; 2.05A {Chlamydia trachomatis} PDB: 3asb_A* | Back alignment and structure |
|---|
| >1cs1_A CGS, protein (cystathionine gamma-synthase); lyase, LLP-dependent enzymes, methionine biosynthesis; HET: LLP DHD; 1.50A {Escherichia coli} SCOP: c.67.1.3 | Back alignment and structure |
|---|
| >3if2_A Aminotransferase; YP_265399.1, structura genomics, joint center for structural genomics, JCSG, prote structure initiative, PSI-2; HET: PLP; 2.50A {Psychrobacter arcticus 273-4} | Back alignment and structure |
|---|
| >3n0l_A Serine hydroxymethyltransferase; alpha beta class, 3-layer(ABA) sandwich, CSGI transferase, structural genomics; HET: MSE; 1.80A {Campylobacter jejuni} SCOP: c.67.1.0 | Back alignment and structure |
|---|
| >3ndn_A O-succinylhomoserine sulfhydrylase; seattle structural genomics center for infectious disease, S mycobacterium, PLP, schiff base; HET: LLP; 1.85A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >2ctz_A O-acetyl-L-homoserine sulfhydrylase; crystal, O-acetyl homoserine sulfhydrase, structural genomic structural genomics/proteomics initiative; HET: PLP; 2.60A {Thermus thermophilus} SCOP: c.67.1.3 | Back alignment and structure |
|---|
| >3ju7_A Putative PLP-dependent aminotransferase; NP_978343.1, struct genomics, joint center for structural genomics, JCSG; HET: LLP PGE; 2.19A {Bacillus cereus atcc 10987} | Back alignment and structure |
|---|
| >3meb_A Aspartate aminotransferase; pyridoxal PHOS transferase, structural genomics, seattle structural genomi for infectious disease, ssgcid; HET: PLP; 1.90A {Giardia lamblia} | Back alignment and structure |
|---|
| >2dkj_A Serine hydroxymethyltransferase; PLP dependent enzyme, structural genomics; HET: PLP; 1.15A {Thermus thermophilus} | Back alignment and structure |
|---|
| >3ei9_A LL-diaminopimelate aminotransferase; lysine biosynthesis, pyridoxal 5' phosphat external aldimine, chloroplast, pyridox phosphate; HET: PL6; 1.55A {Arabidopsis thaliana} PDB: 3ei8_A* 3eib_A* 3ei6_A* 2z1z_A* 3ei5_A* 2z20_A* 3ei7_A 3eia_A* | Back alignment and structure |
|---|
| >3nmy_A Xometc, cystathionine gamma-lyase-like protein; Cys-Met metabolism PLP-dependent enzyme family, CYST gamma lyase, pyridoxal-phosphate; HET: PLP; 2.07A {Xanthomonas oryzae PV} SCOP: c.67.1.0 PDB: 3e6g_A* 3nnp_A* | Back alignment and structure |
|---|
| >1fg7_A Histidinol phosphate aminotransferase; HISC, histidine biosynthesis, pyridoxal PH montreal-kingston bacterial structural genomics initiative; HET: PMP; 1.50A {Escherichia coli} SCOP: c.67.1.1 PDB: 1fg3_A* 1gew_A* 1gex_A* 1gey_A* 1iji_A* | Back alignment and structure |
|---|
| >3e77_A Phosphoserine aminotransferase; SERC, PLP, structural genomi structural genomics consortium, SGC, amino-acid biosynthesi aminotransferase; HET: PLP; 2.50A {Homo sapiens} | Back alignment and structure |
|---|
| >3m5u_A Phosphoserine aminotransferase; alpha-beta half sandwich, csgid, amino-acid biosynthesis, cytoplasm, pyridoxal phosphate; HET: MES; 2.15A {Campylobacter jejuni} SCOP: c.67.1.0 | Back alignment and structure |
|---|
| >3ri6_A O-acetylhomoserine sulfhydrylase; PYR 5'-phosphate, gamma-elimination, direct sulfhydrylation, CY metabolism, protein thiocarboxylate, TR; 2.20A {Wolinella succinogenes} | Back alignment and structure |
|---|
| >2vi8_A Serine hydroxymethyltransferase; SHMT, E53Q, FTHF, enzyme memory, pyridoxal phosphate, one-carbon metabolism, PLP-dependent enzymes; HET: PLP; 1.67A {Bacillus stearothermophilus} PDB: 2vi9_A* 2via_A* 2vib_A* 1kkj_A* 1kkp_A* 1kl1_A* 1kl2_A* 1yjs_A* 2w7f_A* 2w7d_A* 2w7e_A* 2w7g_A* 2w7h_A* 1yjz_A* 1yjy_A* 2vgu_A* 2vgs_A* 2vgt_A* 2vgv_A* 2vgw_A* ... | Back alignment and structure |
|---|
| >2bkw_A Alanine-glyoxylate aminotransferase 1; analine-glyoxylate aminotransferase, pyridoxal-5-phosphate, SAD, glycolate pathway; HET: LLP; 2.57A {Saccharomyces cerevisiae} SCOP: c.67.1.3 | Back alignment and structure |
|---|
| >2jis_A Cysteine sulfinic acid decarboxylase; pyridoxal phosphate, alternative splicing, pyridoxal phosphate (PLP), structural genomics consortium (SGC); HET: PLP; 1.6A {Homo sapiens} | Back alignment and structure |
|---|
| >3ffr_A Phosphoserine aminotransferase SERC; structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; HET: LLP MSE P33; 1.75A {Cytophaga hutchinsonii atcc 33406} | Back alignment and structure |
|---|
| >1n8p_A Cystathionine gamma-lyase; three open alpha/beta structures; HET: PLP; 2.60A {Saccharomyces cerevisiae} SCOP: c.67.1.3 | Back alignment and structure |
|---|
| >3piu_A 1-aminocyclopropane-1-carboxylate synthase; fruit ripening, ethylene biosynthesis, lyase, pyridoxal 5'-P binding; HET: LLP PLR; 1.35A {Malus domestica} SCOP: c.67.1.4 PDB: 1m4n_A* 1m7y_A* 1ynu_A* 1b8g_A* | Back alignment and structure |
|---|
| >1b5p_A Protein (aspartate aminotransferase); pyridoxal enzyme; HET: PLP; 1.80A {Thermus thermophilus} SCOP: c.67.1.1 PDB: 1gck_A* 1b5o_A* 5bj4_A* 1gc4_A* 1gc3_A* 1bkg_A* 5bj3_A* 1bjw_A* | Back alignment and structure |
|---|
| >3ez1_A Aminotransferase MOCR family; YP_604413.1, struct genomics, joint center for structural genomics, JCSG; 2.60A {Deinococcus geothermalis dsm 11300} | Back alignment and structure |
|---|
| >3qm2_A Phosphoserine aminotransferase; structural genomics, center for structural genomics of infec diseases, csgid; 2.25A {Salmonella enterica subsp} PDB: 1bjn_A* 1bjo_A* 3qbo_A* | Back alignment and structure |
|---|
| >2okj_A Glutamate decarboxylase 1; PLP-dependent decarboxylase, lyase; HET: LLP PLZ; 2.30A {Homo sapiens} PDB: 2okk_A* | Back alignment and structure |
|---|
| >2ez2_A Beta-tyrosinase, tyrosine phenol-lyase; PLP-dependent enzyme, pyridoxal-5'-phosphate, domain lyase; 1.85A {Citrobacter freundii} PDB: 2ez1_A 2vlf_A* 2vlh_A* 2yct_A* 1tpl_A 2tpl_A* 2ycn_A* 2yhk_A* 2ycp_A* 1c7g_A* | Back alignment and structure |
|---|
| >3op7_A Aminotransferase class I and II; PLP-dependent transferase, structural genomics, joint center structural genomics, JCSG; HET: LLP UNL; 1.70A {Streptococcus suis 89} PDB: 3p6k_A* | Back alignment and structure |
|---|
| >2x5f_A Aspartate_tyrosine_phenylalanine pyridoxal-5' phosphate-dependent aminotransferase...; HET: PLP EPE; 1.80A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >1iay_A ACC synthase 2, 1-aminocyclopropane-1-carboxylate synthase 2; protein-cofactor-inhibitor complex, V6-dependent enzyme, LYA; HET: PLP AVG; 2.70A {Solanum lycopersicum} SCOP: c.67.1.4 PDB: 1iax_A* | Back alignment and structure |
|---|
| >3rq1_A Aminotransferase class I and II; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, alpha-beta structure, cytosol; HET: AKG GOL; 2.20A {Veillonella parvula} | Back alignment and structure |
|---|
| >7aat_A Aspartate aminotransferase; transferase(aminotransferase); HET: PLP; 1.90A {Gallus gallus} SCOP: c.67.1.1 PDB: 1ivr_A* 1map_A* 1maq_A* 1oxo_A* 1oxp_A* 1ama_A* 1tas_A* 1tat_A* 1tar_A* 8aat_A* 9aat_A* 1aka_A* 1akb_A* 1akc_A* 3pd6_A* 3hlm_A* 3pdb_A* | Back alignment and structure |
|---|
| >1jg8_A L-ALLO-threonine aldolase; glycine biosynthesis, pyridoxal-5'- phosphate, calcium binding site, structural genomics, PSI; HET: LLP; 1.80A {Thermotoga maritima} SCOP: c.67.1.1 PDB: 1lw4_A* 1lw5_A* 1m6s_A* 2fm1_A* | Back alignment and structure |
|---|
| >2fyf_A PSAT, phosphoserine aminotransferase; PLP-dependent enzyme, dimer, structural genomics; HET: PLP; 1.50A {Mycobacterium tuberculosis} PDB: 3vom_A* | Back alignment and structure |
|---|
| >2c0r_A PSAT, phosphoserine aminotransferase; pyridoxal-5'-phosphate, pyridine serine biosynthesis, amino-acid biosynthesis, pyridoxal phosphate; HET: PLP; 1.2A {Bacillus circulans} SCOP: c.67.1.4 PDB: 1bt4_A* 1w3u_A* | Back alignment and structure |
|---|
| >2aeu_A Hypothetical protein MJ0158; selenocysteine synthase, PLP, pyridoxal phosphate, HOMO- oligomerization, unknown function; 1.70A {Methanocaldococcus jannaschii} SCOP: c.67.1.8 PDB: 2aev_A* | Back alignment and structure |
|---|
| >3ht4_A Aluminum resistance protein; lyase, putative cystathionine BEAT-lyase, aluminium resistance protein, Q81A77_baccr, NESG, BCR213; 2.90A {Bacillus cereus atcc 14579} | Back alignment and structure |
|---|
| >3f6t_A Aspartate aminotransferase; YP_194538.1, STRU genomics, joint center for structural genomics, JCSG, prote structure initiative; HET: LLP; 2.15A {Lactobacillus acidophilus ncfm} | Back alignment and structure |
|---|
| >3vp6_A Glutamate decarboxylase 1; catalytic loop SWAP, lyase; HET: LLP HLD; 2.10A {Homo sapiens} PDB: 2okj_A* 2okk_A* | Back alignment and structure |
|---|
| >1qgn_A Protein (cystathionine gamma-synthase); methionine biosynthesis, pyridoxal 5'-phosphate, gamma-famil; HET: PLP; 2.90A {Nicotiana tabacum} SCOP: c.67.1.3 PDB: 1i41_A* 1i48_A* 1i43_A* | Back alignment and structure |
|---|
| >2fq6_A Cystathionine beta-lyase; protein-inhibitor complex, PLP cofactor covalently bound to inhibitor; HET: P3F; 1.78A {Escherichia coli} SCOP: c.67.1.3 PDB: 2gqn_A* 1cl1_A* 1cl2_A* | Back alignment and structure |
|---|
| >2x3l_A ORN/Lys/Arg decarboxylase family protein; lyase; HET: LLP; 2.00A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >3jzl_A Putative cystathionine beta-lyase involved in ALU resistance; putative cystathionine beta-lyase involved in aluminum resis structural genomics; HET: LLP; 1.91A {Listeria monocytogenes str} PDB: 3fd0_A* | Back alignment and structure |
|---|
| >3cog_A Cystathionine gamma-lyase; CTH, PLP, propargylglycine, SGC, inhibitor, structural genom stockholm, structural genomics consortium; HET: PLP; 2.00A {Homo sapiens} PDB: 2nmp_A* 3elp_B | Back alignment and structure |
|---|
| >3k40_A Aromatic-L-amino-acid decarboxylase; PLP dependent protein, alpha beta protein, alternative splicing, catecholamine biosynthesis, lyase; HET: LLP; 1.75A {Drosophila melanogaster} SCOP: c.67.1.6 | Back alignment and structure |
|---|
| >1pff_A Methionine gamma-lyase; homocysteine; 2.50A {Trichomonas vaginalis} SCOP: c.67.1.3 | Back alignment and structure |
|---|
| >4e1o_A HDC, histidine decarboxylase; lyase; HET: PLP PVH; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1w23_A Phosphoserine aminotransferase; pyridoxal-5'-phosphate; HET: PGE PLP EPE; 1.08A {Bacillus alcalophilus} SCOP: c.67.1.4 PDB: 2bhx_A* 2bi1_A* 2bi2_A* 2bi3_A* 2bi5_A* 2bi9_A* 2bia_A* 2bie_A* 2big_A* | Back alignment and structure |
|---|
| >3hbx_A GAD 1, glutamate decarboxylase 1; calmodulin-binding, lyase, pyridoxal phosphate; HET: LLP; 2.67A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >2z67_A O-phosphoseryl-tRNA(SEC) selenium transferase; selenocysteine biosynthesis, seven-stranded BETE-strand, PYR 5'-phosphate; HET: PLP; 2.50A {Methanococcus maripaludis} SCOP: c.67.1.9 | Back alignment and structure |
|---|
| >1js3_A DDC;, DOPA decarboxylase; carbidopa, parkinson'S disease, vitamin; HET: PLP 142; 2.25A {Sus scrofa} SCOP: c.67.1.6 PDB: 1js6_A* 3rch_A* 3rbl_A 3rbf_A* | Back alignment and structure |
|---|
| >1ibj_A CBL, cystathionine beta-lyase; PLP-dependent enzyme, methionine biosynthesis, transsulfurat lyase; HET: PLP; 2.30A {Arabidopsis thaliana} SCOP: c.67.1.3 | Back alignment and structure |
|---|
| >2zy4_A L-aspartate beta-decarboxylase; pyridoxal 5'-phosphate, aminotransferase, lyase; HET: PLP; 2.00A {Alcaligenes faecalis subsp} PDB: 2zy3_A* 2zy5_A* 3fdd_A* 2zy2_A* | Back alignment and structure |
|---|
| >3tcm_A Alanine aminotransferase 2; pyridoxal phosphate (PLP)-binding; HET: DCS; 2.71A {Hordeum vulgare} | Back alignment and structure |
|---|
| >2a7v_A Serine hydroxymethyltransferase; structural genomics, structural genomics consortium, SGC; 2.04A {Homo sapiens} PDB: 3ou5_A | Back alignment and structure |
|---|
| >4eu1_A Mitochondrial aspartate aminotransferase; ssgcid, structural genomics, SEA structural genomics center for infectious disease; HET: LLP; 2.30A {Trypanosoma brucei} | Back alignment and structure |
|---|
| >1e5e_A MGL, methionine gamma-lyase; methionine biosynthesis, PLP-dependent enzymes, C-S gamma lyase; HET: PPJ; 2.18A {Trichomonas vaginalis} SCOP: c.67.1.3 PDB: 1e5f_A* | Back alignment and structure |
|---|
| >3d6k_A Putative aminotransferase; APC82464, corynebacterium diphthe structural genomics, PSI-2, protein structure initiative; 2.00A {Corynebacterium diphtheriae} | Back alignment and structure |
|---|
| >3ihj_A Alanine aminotransferase 2; helix, structural genomics, structural genomics consortium, pyridoxal phosphate; HET: PLP; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >1wyu_A Glycine dehydrogenase (decarboxylating) subunit 1; alpha(2)beta(2) tetramer, riken structural genomics/proteomi initiative, RSGI; HET: PLP; 2.10A {Thermus thermophilus} SCOP: c.67.1.7 PDB: 1wyt_A* 1wyv_A* | Back alignment and structure |
|---|
| >2r2n_A Kynurenine/alpha-aminoadipate aminotransferase mitochondrial; alpha & beta protein, PLP-dependent transferase, aminotransf mitochondrion; HET: PMP KYN; 1.95A {Homo sapiens} PDB: 2qlr_A* 3dc1_A* 3ue8_A* 2vgz_A* 2xh1_A* | Back alignment and structure |
|---|
| >3ppl_A Aspartate aminotransferase; dimer, PLP-dependent transferase-like fold structural genomics, joint center for structural genomics; HET: MSE PLP UNL; 1.25A {Corynebacterium glutamicum} | Back alignment and structure |
|---|
| >3hvy_A Cystathionine beta-lyase family protein, YNBB B.S ortholog; NP_348457.1, putative cystathionine beta-lyase involved in A resistance; HET: LLP MSE; 2.00A {Clostridium acetobutylicum} | Back alignment and structure |
|---|
| >3i16_A Aluminum resistance protein; YP_878183.1, carbon-sulfur lyase involved in aluminum resist structural genomics; HET: MSE TLA PLP; 2.00A {Clostridium novyi} PDB: 3gwp_A* | Back alignment and structure |
|---|
| >1rv3_A Serine hydroxymethyltransferase, cytosolic; one-carbon metabolism; HET: GLY PLP; 2.40A {Oryctolagus cuniculus} SCOP: c.67.1.4 PDB: 1rv4_A* 1rvu_A* 1rvy_A* 1ls3_A* 1cj0_A* 1bj4_A* 1eji_A* | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 83 | ||||
| d2gsaa_ | 427 | c.67.1.4 (A:) Glutamate-1-semialdehyde aminomutase | 1e-12 | |
| d1ohwa_ | 461 | c.67.1.4 (A:) 4-aminobutyrate aminotransferase, GA | 5e-12 | |
| d1zoda1 | 431 | c.67.1.4 (A:3-433) Dialkylglycine decarboxylase {P | 2e-11 | |
| d1vefa1 | 387 | c.67.1.4 (A:9-395) Acetylornithine/acetyl-lysine a | 9e-10 | |
| d2byla1 | 404 | c.67.1.4 (A:36-439) Ornithine aminotransferase {Hu | 2e-07 | |
| d1v72a1 | 345 | c.67.1.1 (A:6-350) Phenylserine aldolase PSALD {Ps | 1e-06 | |
| d1sffa_ | 425 | c.67.1.4 (A:) 4-aminobutyrate aminotransferase, GA | 2e-06 | |
| d1z7da1 | 404 | c.67.1.4 (A:7-410) Ornithine aminotransferase {Pla | 1e-05 | |
| d1s0aa_ | 429 | c.67.1.4 (A:) Adenosylmethionine-8-amino-7-oxonona | 1e-05 | |
| d1svva_ | 340 | c.67.1.1 (A:) Low-specificity threonine aldolase { | 2e-04 | |
| d1o69a_ | 374 | c.67.1.4 (A:) Aminotransferase homolog WlaK (PglE, | 0.002 | |
| d1b9ha_ | 384 | c.67.1.4 (A:) 3-amino-5-hydroxybenzoic acid syntha | 0.002 | |
| d1ax4a_ | 465 | c.67.1.2 (A:) Tryptophan indol-lyase (tryptophanas | 0.003 |
| >d2gsaa_ c.67.1.4 (A:) Glutamate-1-semialdehyde aminomutase (aminotransferase) {Synechococcus sp., strain GR6 [TaxId: 1131]} Length = 427 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: PLP-dependent transferase-like superfamily: PLP-dependent transferases family: GABA-aminotransferase-like domain: Glutamate-1-semialdehyde aminomutase (aminotransferase) species: Synechococcus sp., strain GR6 [TaxId: 1131]
Score = 58.7 bits (141), Expect = 1e-12
Identities = 22/79 (27%), Positives = 34/79 (43%), Gaps = 2/79 (2%)
Query: 2 SLPVGHCHPAVVKAACTQLALLNTNNRFLHDNLVLCARKLASLLPDPLSVCFFVNSGSEA 61
GH HP V++A + + VL ++ + + + FVNSG+EA
Sbjct: 63 PAICGHAHPEVIEALKVAMEKGTSFGAPCALENVLA--EMVNDAVPSIEMVRFVNSGTEA 120
Query: 62 NDLALRLARVHTNNDDVIT 80
LRL R +T D +I
Sbjct: 121 CMAVLRLMRAYTGRDKIIK 139
|
| >d1ohwa_ c.67.1.4 (A:) 4-aminobutyrate aminotransferase, GABA-aminotransferase {Pig (Sus scrofa) [TaxId: 9823]} Length = 461 | Back information, alignment and structure |
|---|
| >d1zoda1 c.67.1.4 (A:3-433) Dialkylglycine decarboxylase {Pseudomonas cepacia [TaxId: 292]} Length = 431 | Back information, alignment and structure |
|---|
| >d1vefa1 c.67.1.4 (A:9-395) Acetylornithine/acetyl-lysine aminotransferase ArgD {Thermus thermophilus [TaxId: 274]} Length = 387 | Back information, alignment and structure |
|---|
| >d2byla1 c.67.1.4 (A:36-439) Ornithine aminotransferase {Human (Homo sapiens) [TaxId: 9606]} Length = 404 | Back information, alignment and structure |
|---|
| >d1v72a1 c.67.1.1 (A:6-350) Phenylserine aldolase PSALD {Pseudomonas putida [TaxId: 303]} Length = 345 | Back information, alignment and structure |
|---|
| >d1sffa_ c.67.1.4 (A:) 4-aminobutyrate aminotransferase, GABA-aminotransferase {Escherichia coli [TaxId: 562]} Length = 425 | Back information, alignment and structure |
|---|
| >d1z7da1 c.67.1.4 (A:7-410) Ornithine aminotransferase {Plasmodium yoelii yoelii [TaxId: 73239]} Length = 404 | Back information, alignment and structure |
|---|
| >d1s0aa_ c.67.1.4 (A:) Adenosylmethionine-8-amino-7-oxononanoate aminotransferase, BioA {Escherichia coli [TaxId: 562]} Length = 429 | Back information, alignment and structure |
|---|
| >d1svva_ c.67.1.1 (A:) Low-specificity threonine aldolase {Leishmania major [TaxId: 5664]} Length = 340 | Back information, alignment and structure |
|---|
| >d1o69a_ c.67.1.4 (A:) Aminotransferase homolog WlaK (PglE, Cj1121c) {Campylobacter jejuni [TaxId: 197]} Length = 374 | Back information, alignment and structure |
|---|
| >d1b9ha_ c.67.1.4 (A:) 3-amino-5-hydroxybenzoic acid synthase (AHBA synthase) {Amycolatopsis mediterranei [TaxId: 33910]} Length = 384 | Back information, alignment and structure |
|---|
| >d1ax4a_ c.67.1.2 (A:) Tryptophan indol-lyase (tryptophanase) {Proteus vulgaris [TaxId: 585]} Length = 465 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 83 | |||
| d1zoda1 | 431 | Dialkylglycine decarboxylase {Pseudomonas cepacia | 99.94 | |
| d1vefa1 | 387 | Acetylornithine/acetyl-lysine aminotransferase Arg | 99.9 | |
| d1sffa_ | 425 | 4-aminobutyrate aminotransferase, GABA-aminotransf | 99.9 | |
| d2gsaa_ | 427 | Glutamate-1-semialdehyde aminomutase (aminotransfe | 99.88 | |
| d1s0aa_ | 429 | Adenosylmethionine-8-amino-7-oxononanoate aminotra | 99.86 | |
| d1ohwa_ | 461 | 4-aminobutyrate aminotransferase, GABA-aminotransf | 99.83 | |
| d2byla1 | 404 | Ornithine aminotransferase {Human (Homo sapiens) [ | 99.79 | |
| d1z7da1 | 404 | Ornithine aminotransferase {Plasmodium yoelii yoel | 99.69 | |
| d1v72a1 | 345 | Phenylserine aldolase PSALD {Pseudomonas putida [T | 98.95 | |
| d1svva_ | 340 | Low-specificity threonine aldolase {Leishmania maj | 98.7 | |
| d1fc4a_ | 401 | 2-amino-3-ketobutyrate CoA ligase {Escherichia col | 98.34 | |
| d1m6sa_ | 343 | Low-specificity threonine aldolase {Thermotoga mar | 98.14 | |
| d1ax4a_ | 465 | Tryptophan indol-lyase (tryptophanase) {Proteus vu | 97.83 | |
| d1bs0a_ | 383 | PLP-dependent acyl-CoA synthase (8-amino-7-oxonano | 97.55 | |
| d1elua_ | 381 | Cystine C-S lyase C-des {Synechocystis sp. [TaxId: | 97.33 | |
| d2v1pa1 | 467 | Tryptophan indol-lyase (tryptophanase) {Escherichi | 97.15 | |
| d2bkwa1 | 382 | Alanine-glyoxylate aminotransferase {Baker's yeast | 96.93 | |
| d1v2da_ | 368 | Glutamine aminotransferase {Thermus thermophilus [ | 96.57 | |
| d1p3wa_ | 391 | Cysteine desulfurase IscS {Escherichia coli [TaxId | 96.44 | |
| d1eg5a_ | 376 | NifS-like protein/selenocysteine lyase {Thermotoga | 96.28 | |
| d2fnua1 | 371 | Spore coat polysaccharide biosynthesis protein C { | 96.2 | |
| d1mdoa_ | 376 | Aminotransferase ArnB {Salmonella typhimurium [Tax | 96.19 | |
| d2e7ja1 | 364 | Selenocysteinyl-tRNA synthase (SepSecS) {Archaeogl | 95.78 | |
| d1h0ca_ | 388 | Alanine-glyoxylate aminotransferase {Human (Homo s | 95.78 | |
| d1o69a_ | 374 | Aminotransferase homolog WlaK (PglE, Cj1121c) {Cam | 95.7 | |
| d1b9ha_ | 384 | 3-amino-5-hydroxybenzoic acid synthase (AHBA synth | 95.69 | |
| d2ch1a1 | 388 | 3-hydroxykynurenine transaminase {Malaria mosquito | 95.4 | |
| d1iuga_ | 348 | Subgroup IV putative aspartate aminotransferase {T | 95.23 | |
| d2bwna1 | 396 | 5-aminolevulinate synthase {Rhodobacter capsulatus | 95.14 | |
| d1m32a_ | 361 | 2-aminoethylphosphonate transaminase {Salmonella t | 95.13 | |
| d1vjoa_ | 377 | Alanine-glyoxylate aminotransferase {Cyanobacteria | 95.0 | |
| d1qz9a_ | 404 | Kynureninase {Pseudomonas fluorescens [TaxId: 294] | 94.91 | |
| d2c0ra1 | 361 | Phosphoserine aminotransferase, PSAT {Bacillus cir | 94.36 | |
| d1bjna_ | 360 | Phosphoserine aminotransferase, PSAT {Escherichia | 94.26 | |
| d1w23a_ | 360 | Phosphoserine aminotransferase, PSAT {Bacillus alc | 94.18 | |
| d1jf9a_ | 405 | NifS-like protein/selenocysteine lyase {Escherichi | 93.95 | |
| d1c7na_ | 394 | Cystalysin {Treponema denticola [TaxId: 158]} | 93.77 | |
| d1c7ga_ | 456 | Tyrosine phenol-lyase {Erwinia herbicola [TaxId: 5 | 93.24 | |
| d1d2fa_ | 361 | Modulator in mal gene expression, MalY {Escherichi | 93.2 | |
| d1pmma_ | 450 | Glutamate decarboxylase beta, GadB {Escherichia co | 92.9 | |
| d1c4ka2 | 462 | Ornithine decarboxylase major domain {Lactobacillu | 92.87 | |
| d1wsta1 | 403 | Multiple substrate aminotransferase, MSAT {Thermoc | 91.36 | |
| d1lc5a_ | 355 | L-threonine-O-3-phosphate decarboxylase CobD {Salm | 91.35 | |
| d1b5pa_ | 382 | Aspartate aminotransferase, AAT {Thermus thermophi | 90.83 | |
| d1j32a_ | 388 | Aspartate aminotransferase, AAT {Phormidium lapide | 90.34 | |
| d2r5ea1 | 418 | Kynurenine--oxoglutarate transaminase I {Yellowfev | 88.29 | |
| d1gdea_ | 388 | Aromatic aminoacid aminotransferase, AroAT {Archae | 88.02 | |
| d1u08a_ | 382 | Putative methionine aminotransferase YdbL {Escheri | 87.86 | |
| d2gb3a1 | 389 | AAT homologue TM1698 {Thermotoga maritima [TaxId: | 87.2 | |
| d2z67a1 | 434 | Selenocysteinyl-tRNA synthase (SepSecS) {Methanoco | 85.44 | |
| d1o4sa_ | 375 | Aspartate aminotransferase, AAT {Thermotoga mariti | 85.25 | |
| d1fg7a_ | 354 | Histidinol-phosphate aminotransferase HisC {Escher | 85.05 | |
| d1xi9a_ | 395 | Putative alanine aminotransferase {Pyrococcus furi | 83.58 | |
| d1js3a_ | 476 | DOPA decarboxylase {Pig (Sus scrofa) [TaxId: 9823] | 83.24 | |
| d1wyua1 | 437 | Glycine dehydrogenase (decarboxylating) subunit 1 | 82.53 | |
| d1t3ia_ | 408 | Probable cysteine desulfurase SufS {Synechocystis | 81.36 |
| >d1zoda1 c.67.1.4 (A:3-433) Dialkylglycine decarboxylase {Pseudomonas cepacia [TaxId: 292]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: PLP-dependent transferase-like superfamily: PLP-dependent transferases family: GABA-aminotransferase-like domain: Dialkylglycine decarboxylase species: Pseudomonas cepacia [TaxId: 292]
Probab=99.94 E-value=1.2e-26 Score=156.51 Aligned_cols=83 Identities=29% Similarity=0.492 Sum_probs=77.3
Q ss_pred CccCCCCCCHHHHHHHHHHHHhh-ccCCCCcchHHHHHHHHHHhhCCCCCCeEEeeCChHHHHHHHHHHHHhhcCCCceE
Q psy6206 1 MSLPVGHCHPAVVKAACTQLALL-NTNNRFLHDNLVLCARKLASLLPDPLSVCFFVNSGSEANDLALRLARVHTNNDDVI 79 (83)
Q Consensus 1 ~~~~lGh~~p~i~~a~~~~~~~~-~~~~~~~~~~~~~la~~l~~~~p~~~~~v~f~~sGseA~e~Alk~ar~~~~r~~ii 79 (83)
|++++||+||+|++|+.+|++++ +....+++++..+|+++|++.+|.++++|+|++|||||||.|||+||+++||++|+
T Consensus 51 ~~~~lGh~~p~v~~ai~~q~~~~~~~~~~~~~~~~~~la~~L~~~~~~~~~~v~f~~sGseA~e~Alk~Ar~~t~r~~i~ 130 (431)
T d1zoda1 51 MSAVLGHCHPEIVSVIGEYAGKLDHLFSEMLSRPVVDLATRLANITPPGLDRALLLSTGAESNEAAIRMAKLVTGKYEIV 130 (431)
T ss_dssp HTCTTCBTCHHHHHHHHHHHHHCCCCCTTCCCHHHHHHHHHHHHHSCTTCCEEEEESCHHHHHHHHHHHHHHHHTCCEEE
T ss_pred HhhhhcCCCHHHHHHHHHHHhhccccccccccHHHHHHHHHHHHhCCcccceeeecccccchHHHHHHHHHHhcCCccee
Confidence 57899999999999999999998 44566788999999999999999889999999999999999999999999999999
Q ss_pred EecC
Q psy6206 80 TQDQ 83 (83)
Q Consensus 80 ~~~~ 83 (83)
+|+|
T Consensus 131 ~~~~ 134 (431)
T d1zoda1 131 GFAQ 134 (431)
T ss_dssp EETT
T ss_pred eccc
Confidence 9975
|
| >d1vefa1 c.67.1.4 (A:9-395) Acetylornithine/acetyl-lysine aminotransferase ArgD {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1sffa_ c.67.1.4 (A:) 4-aminobutyrate aminotransferase, GABA-aminotransferase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2gsaa_ c.67.1.4 (A:) Glutamate-1-semialdehyde aminomutase (aminotransferase) {Synechococcus sp., strain GR6 [TaxId: 1131]} | Back information, alignment and structure |
|---|
| >d1s0aa_ c.67.1.4 (A:) Adenosylmethionine-8-amino-7-oxononanoate aminotransferase, BioA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ohwa_ c.67.1.4 (A:) 4-aminobutyrate aminotransferase, GABA-aminotransferase {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d2byla1 c.67.1.4 (A:36-439) Ornithine aminotransferase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1z7da1 c.67.1.4 (A:7-410) Ornithine aminotransferase {Plasmodium yoelii yoelii [TaxId: 73239]} | Back information, alignment and structure |
|---|
| >d1v72a1 c.67.1.1 (A:6-350) Phenylserine aldolase PSALD {Pseudomonas putida [TaxId: 303]} | Back information, alignment and structure |
|---|
| >d1svva_ c.67.1.1 (A:) Low-specificity threonine aldolase {Leishmania major [TaxId: 5664]} | Back information, alignment and structure |
|---|
| >d1fc4a_ c.67.1.4 (A:) 2-amino-3-ketobutyrate CoA ligase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1m6sa_ c.67.1.1 (A:) Low-specificity threonine aldolase {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1ax4a_ c.67.1.2 (A:) Tryptophan indol-lyase (tryptophanase) {Proteus vulgaris [TaxId: 585]} | Back information, alignment and structure |
|---|
| >d1bs0a_ c.67.1.4 (A:) PLP-dependent acyl-CoA synthase (8-amino-7-oxonanoate synthase, AONS) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1elua_ c.67.1.3 (A:) Cystine C-S lyase C-des {Synechocystis sp. [TaxId: 1143]} | Back information, alignment and structure |
|---|
| >d2v1pa1 c.67.1.2 (A:5-471) Tryptophan indol-lyase (tryptophanase) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2bkwa1 c.67.1.3 (A:3-384) Alanine-glyoxylate aminotransferase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1v2da_ c.67.1.1 (A:) Glutamine aminotransferase {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1p3wa_ c.67.1.3 (A:) Cysteine desulfurase IscS {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1eg5a_ c.67.1.3 (A:) NifS-like protein/selenocysteine lyase {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2fnua1 c.67.1.4 (A:2-372) Spore coat polysaccharide biosynthesis protein C {Helicobacter pylori [TaxId: 210]} | Back information, alignment and structure |
|---|
| >d1mdoa_ c.67.1.4 (A:) Aminotransferase ArnB {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d2e7ja1 c.67.1.9 (A:8-371) Selenocysteinyl-tRNA synthase (SepSecS) {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1h0ca_ c.67.1.3 (A:) Alanine-glyoxylate aminotransferase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1o69a_ c.67.1.4 (A:) Aminotransferase homolog WlaK (PglE, Cj1121c) {Campylobacter jejuni [TaxId: 197]} | Back information, alignment and structure |
|---|
| >d1b9ha_ c.67.1.4 (A:) 3-amino-5-hydroxybenzoic acid synthase (AHBA synthase) {Amycolatopsis mediterranei [TaxId: 33910]} | Back information, alignment and structure |
|---|
| >d2ch1a1 c.67.1.3 (A:2-389) 3-hydroxykynurenine transaminase {Malaria mosquito (Anopheles gambiae) [TaxId: 7165]} | Back information, alignment and structure |
|---|
| >d1iuga_ c.67.1.3 (A:) Subgroup IV putative aspartate aminotransferase {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d2bwna1 c.67.1.4 (A:2-397) 5-aminolevulinate synthase {Rhodobacter capsulatus [TaxId: 1061]} | Back information, alignment and structure |
|---|
| >d1m32a_ c.67.1.3 (A:) 2-aminoethylphosphonate transaminase {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1vjoa_ c.67.1.3 (A:) Alanine-glyoxylate aminotransferase {Cyanobacteria (Nostoc sp. pcc 7120) [TaxId: 103690]} | Back information, alignment and structure |
|---|
| >d1qz9a_ c.67.1.3 (A:) Kynureninase {Pseudomonas fluorescens [TaxId: 294]} | Back information, alignment and structure |
|---|
| >d2c0ra1 c.67.1.4 (A:2-362) Phosphoserine aminotransferase, PSAT {Bacillus circulans, subsp. alkalophilus [TaxId: 1397]} | Back information, alignment and structure |
|---|
| >d1bjna_ c.67.1.4 (A:) Phosphoserine aminotransferase, PSAT {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1w23a_ c.67.1.4 (A:) Phosphoserine aminotransferase, PSAT {Bacillus alcalophilus [TaxId: 1445]} | Back information, alignment and structure |
|---|
| >d1jf9a_ c.67.1.3 (A:) NifS-like protein/selenocysteine lyase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1c7na_ c.67.1.3 (A:) Cystalysin {Treponema denticola [TaxId: 158]} | Back information, alignment and structure |
|---|
| >d1c7ga_ c.67.1.2 (A:) Tyrosine phenol-lyase {Erwinia herbicola [TaxId: 549]} | Back information, alignment and structure |
|---|
| >d1d2fa_ c.67.1.3 (A:) Modulator in mal gene expression, MalY {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1pmma_ c.67.1.6 (A:) Glutamate decarboxylase beta, GadB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1c4ka2 c.67.1.5 (A:108-569) Ornithine decarboxylase major domain {Lactobacillus sp., strain 30a [TaxId: 1591]} | Back information, alignment and structure |
|---|
| >d1wsta1 c.67.1.1 (A:13-415) Multiple substrate aminotransferase, MSAT {Thermococcus profundus [TaxId: 49899]} | Back information, alignment and structure |
|---|
| >d1lc5a_ c.67.1.1 (A:) L-threonine-O-3-phosphate decarboxylase CobD {Salmonella enterica [TaxId: 28901]} | Back information, alignment and structure |
|---|
| >d1b5pa_ c.67.1.1 (A:) Aspartate aminotransferase, AAT {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1j32a_ c.67.1.1 (A:) Aspartate aminotransferase, AAT {Phormidium lapideum [TaxId: 32060]} | Back information, alignment and structure |
|---|
| >d2r5ea1 c.67.1.1 (A:12-429) Kynurenine--oxoglutarate transaminase I {Yellowfever mosquito (Aedes aegypti) [TaxId: 7159]} | Back information, alignment and structure |
|---|
| >d1gdea_ c.67.1.1 (A:) Aromatic aminoacid aminotransferase, AroAT {Archaeon Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1u08a_ c.67.1.1 (A:) Putative methionine aminotransferase YdbL {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2gb3a1 c.67.1.1 (A:4-392) AAT homologue TM1698 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2z67a1 c.67.1.9 (A:1-434) Selenocysteinyl-tRNA synthase (SepSecS) {Methanococcus maripaludis [TaxId: 39152]} | Back information, alignment and structure |
|---|
| >d1o4sa_ c.67.1.1 (A:) Aspartate aminotransferase, AAT {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1fg7a_ c.67.1.1 (A:) Histidinol-phosphate aminotransferase HisC {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1xi9a_ c.67.1.1 (A:) Putative alanine aminotransferase {Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1js3a_ c.67.1.6 (A:) DOPA decarboxylase {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1wyua1 c.67.1.7 (A:1-437) Glycine dehydrogenase (decarboxylating) subunit 1 {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1t3ia_ c.67.1.3 (A:) Probable cysteine desulfurase SufS {Synechocystis sp. PCC 6803 [TaxId: 1148]} | Back information, alignment and structure |
|---|