Diaphorina citri psyllid: psy6208

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------

MKLVPEGEMSNLFEVYLKPYFLEAYRPVHKDDLFIVRGGMRAVEFKIVDTDPAPYCIVAADTVIHCEGDPIKREEEEEASNAVGYDDIGGCRKQLAQIKEMVELPLRHPSLFKAIGVKPPRGILLYGPPGTGKTLIARAVANETGAFFFLINGPEIMSKLAGESESNLRKAFEEADKNSPSIIFIDELDAIAPKREK

cCCcccccccHHHHHHHHHHHHHcccccccccEEEEECcccEEEEEEEEEcccccEEEccccEEEEcccccccHHHHHHcccccccccccHHHHHHHHHHHHccccccHHHHHHcccccccEEEEEcccccHHHHHHHHHHHHcccEEEEEEcHHHHHHcccccHHHHHHHHHHHHHccccEEEEECcccccccccc

MKLVPEGEMSNLFEVYLKPYFLEAYRPVHKDDLFIVRGGMRAVEFKIVDTDPAPYCIVAADTVIHCE***************VGYDDIGGCRKQLAQIKEMVELPLRHPSLFKAIGVKPPRGILLYGPPGTGKTLIARAVANETGAFFFLINGPEIMSKLAGESESNLRKAFEEADKNSPSIIFIDELDAIAPK***

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MKLVPEGEMSNLFEVYLKPYFLEAYRPVHKDDLFIVRGGMRAVEFKIVDTDPAPYCIVAADTVIHCEGDPIKREEEEEASNAVGYDDIGGCRKQLAQIKEMVELPLRHPSLFKAIGVKPPRGILLYGPPGTGKTLIARAVANETGAFFFLINGPEIMSKLAGESESNLRKAFEEADKNSPSIIFIDELDAIAPKREK

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Transitional endoplasmic reticulum ATPase TER94	Necessary for the fragmentation of Golgi stacks during mitosis and for their reassembly after mitosis. Involved in the formation of the transitional endoplasmic reticulum (tER). The transfer of membranes from the endoplasmic reticulum to the Golgi apparatus occurs via 50-70 nm transition vesicles which derive from part-rough, part-smooth transitional elements of the endoplasmic reticulum (tER). Vesicle budding from the tER is an ATP-dependent process (By similarity). Involved in the ubiquitin-proteasome system. Important for oskar mRNA localization and/or anchoring during oogenesis.	confident	Q7KN62
Cell division control protein 48 homolog E	Probably functions in cell division and growth processes. Interacts with certain SNAREs as part of specialized membrane fusion events where vesicles from the same organelle fuse (homotypic fusion).	confident	Q9LZF6
Transitional endoplasmic reticulum ATPase	Necessary for the fragmentation of Golgi stacks during mitosis and for their reassembly after mitosis. Involved in the formation of the transitional endoplasmic reticulum (tER). The transfer of membranes from the endoplasmic reticulum to the Golgi apparatus occurs via 50-70 nm transition vesicles which derive from part-rough, part-smooth transitional elements of the endoplasmic reticulum (tER). Vesicle budding from the tER is an ATP-dependent process. The ternary complex containing UFD1L, VCP and NPLOC4 binds ubiquitinated proteins and is necessary for the export of misfolded proteins from the ER to the cytoplasm, where they are degraded by the proteasome. The NPLOC4-UFD1L-VCP complex regulates spindle disassembly at the end of mitosis and is necessary for the formation of a closed nuclear envelope. Regulates E3 ubiquitin-protein ligase activity of RNF19A (By similarity). Component of the VCP/p97-AMFR/gp78 complex that participates in the final step of the sterol-mediated ubiquitination and endoplasmic reticulum-associated degradation (ERAD) of HMGCR.	confident	Q3ZBT1

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0044427 [CC]	chromosomal part	confident	GO:0005575, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0043228, GO:0044424, GO:0005694, GO:0043226, GO:0044422
GO:0043234 [CC]	protein complex	confident	GO:0005575, GO:0032991
GO:0005829 [CC]	cytosol	confident	GO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0006200 [BP]	ATP catabolic process	confident	GO:0046434, GO:0009141, GO:0009143, GO:0009144, GO:0009146, GO:0009166, GO:0009164, GO:0006807, GO:0044237, GO:0072521, GO:0072523, GO:0046130, GO:0009259, GO:1901360, GO:1901361, GO:0046700, GO:0006139, GO:1901575, GO:0006195, GO:0042278, GO:0071704, GO:0009199, GO:0006152, GO:0046483, GO:0044281, GO:0009207, GO:0009205, GO:0009987, GO:0009203, GO:0044238, GO:0046034, GO:0009154, GO:0006725, GO:0044710, GO:0009150, GO:0009261, GO:0019637, GO:0009117, GO:0009116, GO:0008152, GO:0034655, GO:0009119, GO:0046128, GO:0009056, GO:0055086, GO:0042454, GO:0044248, GO:1901564, GO:0044270, GO:1901136, GO:1901135, GO:0034641, GO:0019693, GO:0006163, GO:1901657, GO:0006796, GO:1901292, GO:0006793, GO:0019439, GO:0008150, GO:0006753, GO:1901658, GO:1901565
GO:0005515 [MF]	protein binding	confident	GO:0003674, GO:0005488
GO:0016887 [MF]	ATPase activity	confident	GO:0016787, GO:0016818, GO:0003824, GO:0017111, GO:0016817, GO:0016462, GO:0003674
GO:0005730 [CC]	nucleolus	confident	GO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0019222 [BP]	regulation of metabolic process	confident	GO:0008150, GO:0065007, GO:0050789
GO:0005794 [CC]	Golgi apparatus	confident	GO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0005886 [CC]	plasma membrane	confident	GO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623
GO:0022626 [CC]	cytosolic ribosome	probable	GO:0005737, GO:0032991, GO:0005840, GO:0043232, GO:0005829, GO:0044464, GO:0043229, GO:0005623, GO:0030529, GO:0005575, GO:0044444, GO:0044445, GO:0044424, GO:0043228, GO:0005622, GO:0043226
GO:0034214 [BP]	protein hexamerization	probable	GO:0051259, GO:0022607, GO:0071822, GO:0070271, GO:0043933, GO:0006461, GO:0016043, GO:0065003, GO:0044085, GO:0008150, GO:0071840
GO:0043332 [CC]	mating projection tip	probable	GO:0044464, GO:0044463, GO:0030427, GO:0005623, GO:0005575, GO:0005937, GO:0042995
GO:0006302 [BP]	double-strand break repair	probable	GO:0090304, GO:0034641, GO:0006807, GO:1901360, GO:0006139, GO:0051716, GO:0044260, GO:0071704, GO:0044699, GO:0006281, GO:0009987, GO:0006725, GO:0006974, GO:0006950, GO:0044763, GO:0008152, GO:0046483, GO:0044238, GO:0050896, GO:0044237, GO:0043170, GO:0033554, GO:0006259, GO:0008150
GO:0035861 [CC]	site of double-strand break	probable	GO:0005575, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0043228, GO:0044424, GO:0044427, GO:0005694, GO:0043226, GO:0044422
GO:0005875 [CC]	microtubule associated complex	probable	GO:0043234, GO:0005856, GO:0015630, GO:0032991, GO:0005575, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0044430, GO:0044424, GO:0043228, GO:0043226, GO:0044422
GO:0000837 [CC]	Doa10p ubiquitin ligase complex	probable	GO:0005783, GO:0005789, GO:0042175, GO:0043229, GO:0005622, GO:0043227, GO:0043226, GO:0005737, GO:0044446, GO:0031090, GO:0016020, GO:0044432, GO:0012505, GO:0043234, GO:0000835, GO:0032991, GO:0043231, GO:0044464, GO:0000151, GO:0005623, GO:0000153, GO:0005575, GO:0044444, GO:0044424, GO:0044425, GO:0044422
GO:0009524 [CC]	phragmoplast	probable	GO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0005615 [CC]	extracellular space	probable	GO:0005575, GO:0005576, GO:0044421
GO:0031593 [MF]	polyubiquitin binding	probable	GO:0003674, GO:0043130, GO:0032182, GO:0005488, GO:0005515
GO:0000790 [CC]	nuclear chromatin	probable	GO:0031974, GO:0043229, GO:0043228, GO:0000785, GO:0000228, GO:0043227, GO:0043226, GO:0044446, GO:0031981, GO:0005634, GO:0044454, GO:0005694, GO:0043231, GO:0043232, GO:0043233, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0070013, GO:0044428, GO:0044424, GO:0044427, GO:0044422
GO:0006919 [BP]	activation of cysteine-type endopeptidase activity involved in apoptotic process	probable	GO:0019222, GO:2001056, GO:0007569, GO:0010941, GO:0042981, GO:0050789, GO:0043085, GO:0097202, GO:0051345, GO:2000116, GO:0043067, GO:0065007, GO:0044699, GO:0044093, GO:0043281, GO:0043280, GO:0065009, GO:0010259, GO:0009987, GO:0052547, GO:0052548, GO:0006915, GO:0050794, GO:0012501, GO:0044763, GO:0010950, GO:0010952, GO:0051336, GO:0050790, GO:0008150
GO:0009506 [CC]	plasmodesma	probable	GO:0055044, GO:0005575, GO:0030054, GO:0005911
GO:0032403 [MF]	protein complex binding	probable	GO:0003674, GO:0005488, GO:0005515
GO:0071712 [BP]	ER-associated misfolded protein catabolic process	probable	GO:0044248, GO:0070887, GO:0043632, GO:0044699, GO:0044267, GO:0051716, GO:0044265, GO:0044260, GO:0043161, GO:0009057, GO:0071704, GO:0071310, GO:0035966, GO:0071218, GO:0006508, GO:0044238, GO:0009987, GO:0019941, GO:1901575, GO:0006950, GO:0044763, GO:0030163, GO:0008152, GO:0030433, GO:0044257, GO:0042221, GO:0009056, GO:0010033, GO:0051603, GO:0019538, GO:0050896, GO:0010498, GO:0044237, GO:0043170, GO:0035967, GO:0006511, GO:0033554, GO:0006515, GO:0008150, GO:0051788
GO:0005102 [MF]	receptor binding	probable	GO:0003674, GO:0005488, GO:0005515
GO:0048046 [CC]	apoplast	probable	GO:0005575, GO:0005576
GO:0005819 [CC]	spindle	probable	GO:0043234, GO:0005856, GO:0015630, GO:0032991, GO:0005575, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0044430, GO:0044424, GO:0043228, GO:0043226, GO:0044422
GO:0005811 [CC]	lipid particle	probable	GO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0032436 [BP]	positive regulation of proteasomal ubiquitin-dependent protein catabolic process	probable	GO:0009896, GO:0009894, GO:0009893, GO:0032434, GO:0031325, GO:0031323, GO:0042176, GO:0050789, GO:0080090, GO:0031329, GO:0051246, GO:0051247, GO:0008150, GO:0032270, GO:1901800, GO:0048518, GO:0065007, GO:0060255, GO:0031331, GO:0050794, GO:0030162, GO:0019222, GO:0010604, GO:0032268, GO:0045732, GO:0061136, GO:0045862, GO:0048522
GO:0030970 [BP]	retrograde protein transport, ER to cytosol	probable	GO:0033036, GO:0034613, GO:0046907, GO:0070727, GO:0006886, GO:0006810, GO:0045184, GO:0044765, GO:0008104, GO:0008150, GO:0071702, GO:0015031, GO:0044763, GO:0009987, GO:0051234, GO:0051649, GO:0051179, GO:0044699, GO:0051641
GO:0034098 [CC]	Cdc48p-Npl4p-Ufd1p AAA ATPase complex	probable	GO:0005783, GO:0005789, GO:0042175, GO:0043229, GO:0043227, GO:0043226, GO:0005737, GO:0044446, GO:0031090, GO:0016020, GO:0044432, GO:0012505, GO:0043234, GO:0032991, GO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0044425, GO:0044422
GO:0042802 [MF]	identical protein binding	probable	GO:0003674, GO:0005488, GO:0005515
GO:0009986 [CC]	cell surface	probable	GO:0005575, GO:0044464, GO:0005623
GO:0030968 [BP]	endoplasmic reticulum unfolded protein response	probable	GO:0023052, GO:0007165, GO:0070887, GO:0007154, GO:0050789, GO:0044699, GO:0006984, GO:0051716, GO:0006986, GO:0071310, GO:0065007, GO:0009987, GO:0050794, GO:0006950, GO:0044763, GO:0042221, GO:0010033, GO:0044700, GO:0050896, GO:0035967, GO:0035966, GO:0033554, GO:0008150, GO:0034976, GO:0034620
GO:0036266 [CC]	Cdc48p-Npl4p-Vms1p AAA ATPase complex	probable	GO:0031975, GO:0043229, GO:0043227, GO:0043226, GO:0005737, GO:0044446, GO:0031090, GO:0016020, GO:0005740, GO:0005739, GO:0044455, GO:0031968, GO:0031967, GO:0031966, GO:0043234, GO:0032991, GO:0043231, GO:0044464, GO:0019867, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0005741, GO:0044429, GO:0044424, GO:0044425, GO:0044422
GO:0005618 [CC]	cell wall	probable	GO:0005575, GO:0071944, GO:0044464, GO:0005623, GO:0030312
GO:0005635 [CC]	nuclear envelope	probable	GO:0005575, GO:0005623, GO:0005634, GO:0044464, GO:0031967, GO:0031975, GO:0044446, GO:0043229, GO:0044428, GO:0012505, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0031334 [BP]	positive regulation of protein complex assembly	probable	GO:0051130, GO:0051128, GO:0044087, GO:0065007, GO:0048518, GO:0008150, GO:0043254, GO:0050794, GO:0050789, GO:0048522
GO:0045335 [CC]	phagocytic vesicle	probable	GO:0005737, GO:0005575, GO:0043231, GO:0016023, GO:0031410, GO:0044464, GO:0044444, GO:0005623, GO:0031988, GO:0030139, GO:0043229, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0031982
GO:0051260 [BP]	protein homooligomerization	probable	GO:0051259, GO:0022607, GO:0071822, GO:0070271, GO:0043933, GO:0006461, GO:0016043, GO:0065003, GO:0044085, GO:0008150, GO:0071840
GO:0022623 [CC]	proteasome-activating nucleotidase complex	probable	GO:0043234, GO:0032991, GO:0022624, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424, GO:0000502
GO:0006906 [BP]	vesicle fusion	probable	GO:0006996, GO:0009987, GO:0016192, GO:0008150, GO:0016044, GO:0071840, GO:0006810, GO:0016050, GO:0061025, GO:0061024, GO:0048284, GO:0006944, GO:0044763, GO:0051234, GO:0051179, GO:0044699, GO:0016043
GO:0034517 [BP]	ribophagy	probable	GO:0006914, GO:0009987, GO:0044237, GO:0044248, GO:0008150, GO:0008152, GO:0009056
GO:0010605 [BP]	negative regulation of macromolecule metabolic process	probable	GO:0009892, GO:0019222, GO:0060255, GO:0008150, GO:0065007, GO:0048519, GO:0050789
GO:0003924 [MF]	GTPase activity	probable	GO:0016787, GO:0016818, GO:0003824, GO:0017111, GO:0016817, GO:0016462, GO:0003674
GO:0051228 [BP]	mitotic spindle disassembly	probable	GO:0006996, GO:0032984, GO:0007017, GO:0007010, GO:0000278, GO:0071822, GO:0043933, GO:0044699, GO:0071840, GO:0009987, GO:0044763, GO:0016043, GO:0008150, GO:0007051, GO:0007052, GO:0000226, GO:0022411, GO:0022402, GO:0043241, GO:0007049, GO:0051230
GO:0061166 [BP]	establishment of endoplasmic reticulum localization involved in endoplasmic reticulum polarization at cell division site	probable	GO:0006996, GO:0051234, GO:0007029, GO:0071840, GO:0009987, GO:0016043, GO:0051179, GO:0008150, GO:0007163, GO:0044763, GO:0044699, GO:0051641, GO:0051649, GO:0061164, GO:0061165, GO:0051656, GO:0051686, GO:0051643, GO:0051640, GO:0061163
GO:0006888 [BP]	ER to Golgi vesicle-mediated transport	probable	GO:0051234, GO:0016192, GO:0046907, GO:0048193, GO:0006810, GO:0044765, GO:0008150, GO:0051649, GO:0044763, GO:0009987, GO:0051641, GO:0051179, GO:0044699, GO:0016482
GO:0009860 [BP]	pollen tube growth	probable	GO:0048610, GO:0048589, GO:0048588, GO:0030154, GO:0048468, GO:0009653, GO:0044699, GO:0009826, GO:0000904, GO:0016049, GO:0000003, GO:0048868, GO:0048869, GO:0016043, GO:0032989, GO:0071840, GO:0051704, GO:0060560, GO:0000902, GO:0032502, GO:0032501, GO:0009987, GO:0044767, GO:0022414, GO:0008150, GO:0040007, GO:0048856, GO:0044703, GO:0003006, GO:0044706, GO:0009932, GO:0009856, GO:0044763
GO:0072671 [BP]	mitochondria-associated protein catabolic process	probable	GO:0044248, GO:0043632, GO:0044267, GO:1901575, GO:0044265, GO:0044260, GO:0043161, GO:0071704, GO:0006508, GO:0044238, GO:0009987, GO:0019941, GO:0008150, GO:0030163, GO:0008152, GO:0044257, GO:0009056, GO:0009057, GO:0051603, GO:0019538, GO:0010498, GO:0044237, GO:0043170, GO:0006511
GO:0097308 [BP]	cellular response to farnesol	probable	GO:1901700, GO:1901701, GO:0051716, GO:0033993, GO:0050896, GO:0009987, GO:0071396, GO:0008150, GO:0071310, GO:0044763, GO:0044699, GO:0070887, GO:0042221, GO:0097305, GO:0010033, GO:0097307, GO:0097306
GO:0048813 [BP]	dendrite morphogenesis	probable	GO:0032502, GO:0044707, GO:0030030, GO:0030154, GO:0048468, GO:0016358, GO:0031175, GO:0009653, GO:0007275, GO:0044699, GO:0000904, GO:0000902, GO:0048869, GO:0016043, GO:0032989, GO:0071840, GO:0048666, GO:0048667, GO:0032501, GO:0030182, GO:0009987, GO:0044767, GO:0008150, GO:0048731, GO:0022008, GO:0032990, GO:0048699, GO:0048858, GO:0007399, GO:0048856, GO:0048812, GO:0044763
GO:0007126 [BP]	meiosis	probable	GO:0048610, GO:0051321, GO:0000003, GO:0009987, GO:0008150, GO:0022402, GO:0044699, GO:0044763, GO:0007049
GO:0009846 [BP]	pollen germination	probable	GO:0044703, GO:0032501, GO:0000003, GO:0044707, GO:0044706, GO:0022414, GO:0009856, GO:0008150, GO:0044699, GO:0051704
GO:0016320 [BP]	endoplasmic reticulum membrane fusion	probable	GO:0006996, GO:0090174, GO:0016044, GO:0071840, GO:0009987, GO:0016043, GO:0061025, GO:0061024, GO:0048284, GO:0006944, GO:0008150, GO:0044763, GO:0044699
GO:0008289 [MF]	lipid binding	probable	GO:0003674, GO:0005488
GO:0031134 [BP]	sister chromatid biorientation	probable	GO:0033036, GO:0008104, GO:0008608, GO:0000226, GO:0007067, GO:0051656, GO:0051303, GO:0044699, GO:0032507, GO:0070727, GO:0051651, GO:0071840, GO:0000280, GO:0016043, GO:0051179, GO:0008150, GO:0007080, GO:0065007, GO:0007049, GO:0065008, GO:0007010, GO:0034453, GO:0034613, GO:0000278, GO:0009987, GO:0045185, GO:0007017, GO:0044763, GO:0051649, GO:0051310, GO:0007059, GO:0051235, GO:0051234, GO:0051315, GO:0051640, GO:0051641, GO:0006996, GO:0000070, GO:0000819, GO:0051276, GO:0050000, GO:0048285, GO:0022402
GO:0046686 [BP]	response to cadmium ion	probable	GO:0042221, GO:0050896, GO:0010035, GO:0008150, GO:0010038
GO:0040011 [BP]	locomotion	probable	GO:0008150
GO:0040010 [BP]	positive regulation of growth rate	probable	GO:0045927, GO:0040008, GO:0040009, GO:0065007, GO:0048518, GO:0008150, GO:0050789
GO:0040018 [BP]	positive regulation of multicellular organism growth	probable	GO:0040014, GO:0051240, GO:0050789, GO:0065007, GO:0051239, GO:0048518, GO:0008150, GO:0040008, GO:0045927
GO:0008103 [BP]	oocyte microtubule cytoskeleton polarization	probable	GO:0048610, GO:0009994, GO:0030154, GO:0048468, GO:0007569, GO:0007292, GO:0007163, GO:0000226, GO:0007309, GO:0007308, GO:0009798, GO:0010259, GO:0007275, GO:0044699, GO:0007389, GO:0030952, GO:0030951, GO:0048869, GO:0071840, GO:0016043, GO:0007276, GO:0048477, GO:0032502, GO:0048599, GO:0032501, GO:0048609, GO:0032504, GO:0016325, GO:0009987, GO:0019953, GO:0007281, GO:0022414, GO:0044702, GO:0044763, GO:0022412, GO:0000003, GO:0006996, GO:0044767, GO:0007017, GO:0007010, GO:0044707, GO:0003006, GO:0048856, GO:0008150
GO:0043523 [BP]	regulation of neuron apoptotic process	probable	GO:0050794, GO:0043067, GO:0065007, GO:0008150, GO:1901214, GO:0010941, GO:0042981, GO:0050789
GO:2000058 [BP]	regulation of protein ubiquitination involved in ubiquitin-dependent protein catabolic process	probable	GO:0009894, GO:0032268, GO:0080090, GO:0031329, GO:0060255, GO:0051246, GO:0031323, GO:0050794, GO:0008150, GO:0042176, GO:0030162, GO:0031399, GO:0031396, GO:0065007, GO:0019222, GO:0050789
GO:0070842 [BP]	aggresome assembly	probable	GO:0022607, GO:0070841, GO:0016043, GO:0044085, GO:0008150, GO:0071840
GO:0019985 [BP]	translesion synthesis	probable	GO:0090304, GO:0044249, GO:0034641, GO:0006807, GO:0034645, GO:1901576, GO:1901362, GO:1901360, GO:0006139, GO:0051716, GO:0044260, GO:0071704, GO:0044699, GO:0018130, GO:0006281, GO:0009987, GO:0006725, GO:0006974, GO:0009058, GO:0009059, GO:0008150, GO:0008152, GO:0034654, GO:0046483, GO:0044238, GO:0044271, GO:0006301, GO:0050896, GO:0044763, GO:0006950, GO:0044237, GO:0043170, GO:0033554, GO:0006259, GO:0019438, GO:0071897
GO:0016567 [BP]	protein ubiquitination	probable	GO:0071704, GO:0044267, GO:0044260, GO:0044238, GO:0019538, GO:0009987, GO:0070647, GO:0006464, GO:0043170, GO:0032446, GO:0043412, GO:0036211, GO:0008150, GO:0044237, GO:0008152
GO:0007317 [BP]	regulation of pole plasm oskar mRNA localization	probable	GO:2000241, GO:0051239, GO:0060341, GO:0050793, GO:0060281, GO:0060284, GO:0050794, GO:0008150, GO:0044087, GO:0045595, GO:2000026, GO:0045995, GO:0065007, GO:0032879, GO:0051128, GO:0050789
GO:0002119 [BP]	nematode larval development	probable	GO:0032502, GO:0032501, GO:0044707, GO:0009791, GO:0002164, GO:0008150, GO:0007275, GO:0044699
GO:0033047 [BP]	regulation of mitotic sister chromatid segregation	probable	GO:0033044, GO:0033045, GO:0007346, GO:0033043, GO:0051726, GO:0010564, GO:0050794, GO:0051783, GO:0065007, GO:0008150, GO:0051128, GO:0007088, GO:0050789, GO:0051983
GO:0042406 [CC]	extrinsic to endoplasmic reticulum membrane	probable	GO:0005783, GO:0019898, GO:0042175, GO:0043229, GO:0043227, GO:0043226, GO:0005737, GO:0044446, GO:0031090, GO:0016020, GO:0044432, GO:0031312, GO:0012505, GO:0005789, GO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0044425, GO:0044422
GO:0071470 [BP]	cellular response to osmotic stress	probable	GO:0009628, GO:0051716, GO:0050896, GO:0009987, GO:0008150, GO:0006950, GO:0006970, GO:0033554, GO:0044763, GO:0071214, GO:0044699
GO:0043273 [MF]	CTPase activity	probable	GO:0016787, GO:0016818, GO:0003824, GO:0017111, GO:0016817, GO:0016462, GO:0003674
GO:0007030 [BP]	Golgi organization	probable	GO:0006996, GO:0009987, GO:0016043, GO:0044763, GO:0044699, GO:0008150, GO:0071840
GO:0004175 [MF]	endopeptidase activity	probable	GO:0016787, GO:0008233, GO:0070011, GO:0003674, GO:0003824
GO:0016236 [BP]	macroautophagy	probable	GO:0009991, GO:0008152, GO:0044248, GO:0042594, GO:0044699, GO:0051716, GO:0071496, GO:0006914, GO:0009987, GO:0006950, GO:0008150, GO:0009267, GO:0007154, GO:0009056, GO:0031668, GO:0031669, GO:0009605, GO:0050896, GO:0031667, GO:0044237, GO:0033554, GO:0044763
GO:0016235 [CC]	aggresome	probable	GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0016234, GO:0044424
GO:0043581 [BP]	mycelium development	probable	GO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0044767, GO:0008150, GO:0007275, GO:0044699
GO:0018279 [BP]	protein N-linked glycosylation via asparagine	probable	GO:0044249, GO:0044237, GO:0034645, GO:0009100, GO:0009101, GO:0044267, GO:0044260, GO:0006487, GO:0018196, GO:0018193, GO:0071704, GO:1901576, GO:0009987, GO:0070085, GO:0006464, GO:0043412, GO:0036211, GO:0008150, GO:0008152, GO:0044723, GO:0044238, GO:0005975, GO:0006486, GO:1901137, GO:1901135, GO:0009058, GO:0009059, GO:0043170, GO:0019538, GO:0043413
GO:0019903 [MF]	protein phosphatase binding	probable	GO:0019902, GO:0003674, GO:0005515, GO:0019899, GO:0005488
GO:0019904 [MF]	protein domain specific binding	probable	GO:0003674, GO:0005488, GO:0005515
GO:0043531 [MF]	ADP binding	probable	GO:0043168, GO:0017076, GO:0030554, GO:0097159, GO:0003674, GO:1901363, GO:1901265, GO:0043167, GO:0036094, GO:0032559, GO:0032553, GO:0032549, GO:0032555, GO:0005488, GO:0000166, GO:0032550, GO:0001883, GO:0001882
GO:0005524 [MF]	ATP binding	probable	GO:0043168, GO:0003674, GO:0005488, GO:0030554, GO:0035639, GO:0097159, GO:1901363, GO:0043167, GO:0036094, GO:0032553, GO:0032559, GO:0001883, GO:0032549, GO:0032555, GO:0017076, GO:0000166, GO:0032550, GO:1901265, GO:0001882
GO:0009617 [BP]	response to bacterium	probable	GO:0008150, GO:0009607, GO:0050896, GO:0051707, GO:0051704
GO:0001673 [CC]	male germ cell nucleus	probable	GO:0043231, GO:0005634, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0043073, GO:0044424, GO:0043227, GO:0043226
GO:1900182 [BP]	positive regulation of protein localization to nucleus	probable	GO:1900180, GO:0032879, GO:0060341, GO:0050794, GO:0065007, GO:0048518, GO:0008150, GO:0048522, GO:0050789, GO:0032880
GO:0006355 [BP]	regulation of transcription, DNA-dependent	probable	GO:0009889, GO:0080090, GO:0019222, GO:0060255, GO:0031326, GO:0031323, GO:0051252, GO:2000112, GO:0050794, GO:0050789, GO:0019219, GO:0010556, GO:0065007, GO:0051171, GO:2001141, GO:0008150, GO:0010468
GO:0008540 [CC]	proteasome regulatory particle, base subcomplex	probable	GO:0043234, GO:0005838, GO:0022624, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0000502, GO:0044424, GO:0032991
GO:0042052 [BP]	rhabdomere development	probable	GO:0048666, GO:0044707, GO:0042051, GO:0030154, GO:0048468, GO:0001745, GO:0007275, GO:0071840, GO:0042462, GO:0042461, GO:0009653, GO:0048869, GO:0016043, GO:0048513, GO:0044699, GO:0048749, GO:0009887, GO:0032501, GO:0030182, GO:0048592, GO:0009987, GO:0044767, GO:0001654, GO:0048731, GO:0001754, GO:0022008, GO:0001751, GO:0006996, GO:0048699, GO:0007399, GO:0007423, GO:0048856, GO:0044763, GO:0046530, GO:0008150, GO:0032502
GO:0071630 [BP]	nucleus-associated proteasomal ubiquitin-dependent protein catabolic process	probable	GO:0044248, GO:0070887, GO:0043632, GO:0044699, GO:0044267, GO:0051716, GO:0044265, GO:0044260, GO:0043161, GO:0009057, GO:0071704, GO:0071310, GO:0006511, GO:0071218, GO:0006508, GO:0044238, GO:0009987, GO:0019941, GO:1901575, GO:0006950, GO:0044763, GO:0030163, GO:0008152, GO:0044257, GO:0042221, GO:0009056, GO:0010033, GO:0051603, GO:0019538, GO:0050896, GO:0010498, GO:0044237, GO:0043170, GO:0035967, GO:0035966, GO:0033554, GO:0006515, GO:0008150, GO:0051788
GO:0035101 [CC]	FACT complex	probable	GO:0008023, GO:0031974, GO:0043229, GO:0043227, GO:0043226, GO:0005575, GO:0031981, GO:0005634, GO:0005654, GO:0044451, GO:0043234, GO:0032991, GO:0043231, GO:0043233, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0070013, GO:0044428, GO:0044424, GO:0044422
GO:0006184 [BP]	GTP catabolic process	probable	GO:0046434, GO:0009141, GO:0009143, GO:0009144, GO:0009146, GO:0009166, GO:0009164, GO:0006807, GO:0044237, GO:0072521, GO:0009203, GO:0072523, GO:0046130, GO:0009259, GO:1901360, GO:1901361, GO:0046700, GO:0006139, GO:1901575, GO:0006195, GO:0071704, GO:0042278, GO:1901069, GO:1901068, GO:0009199, GO:0006152, GO:0046483, GO:0044281, GO:0009207, GO:0009205, GO:0009987, GO:0046039, GO:0044238, GO:0009154, GO:0006725, GO:0044710, GO:0009150, GO:0009261, GO:0019637, GO:0009117, GO:0009116, GO:0008152, GO:0034655, GO:0009119, GO:0046128, GO:0009056, GO:0055086, GO:0042454, GO:0044248, GO:1901564, GO:0044270, GO:1901136, GO:1901135, GO:0034641, GO:0019693, GO:0006163, GO:1901657, GO:0006796, GO:1901292, GO:0006793, GO:0019439, GO:0008150, GO:0006753, GO:1901658, GO:1901565
GO:0071629 [BP]	cytoplasm-associated proteasomal ubiquitin-dependent protein catabolic process	probable	GO:0044248, GO:0070887, GO:0043632, GO:0044699, GO:0044267, GO:0051716, GO:0044265, GO:0044260, GO:0043161, GO:0009057, GO:0071704, GO:0071310, GO:0006511, GO:0071218, GO:0006508, GO:0044238, GO:0009987, GO:0019941, GO:1901575, GO:0006950, GO:0044763, GO:0030163, GO:0008152, GO:0044257, GO:0042221, GO:0009056, GO:0010033, GO:0051603, GO:0019538, GO:0050896, GO:0010498, GO:0044237, GO:0043170, GO:0035967, GO:0035966, GO:0033554, GO:0006515, GO:0008150, GO:0051788
GO:0000910 [BP]	cytokinesis	probable	GO:0009987, GO:0008150, GO:0044763, GO:0007049, GO:0051301, GO:0022402, GO:0044699
GO:0043335 [BP]	protein unfolding	probable	GO:0044267, GO:0044260, GO:0044238, GO:0019538, GO:0009987, GO:0044237, GO:0043170, GO:0071704, GO:0008150, GO:0008152
GO:0034727 [BP]	piecemeal microautophagy of nucleus	probable	GO:0016044, GO:0006914, GO:0009987, GO:0016237, GO:0010324, GO:0044248, GO:0061024, GO:0044763, GO:0044237, GO:0008152, GO:0071840, GO:0008150, GO:0009056, GO:0044699, GO:0016043
GO:0045451 [BP]	pole plasm oskar mRNA localization	probable	GO:0048610, GO:0009994, GO:0030154, GO:0048468, GO:0007569, GO:0007292, GO:0009790, GO:0008358, GO:0022607, GO:0016043, GO:0000578, GO:0007309, GO:0007308, GO:0009798, GO:0035282, GO:0010259, GO:0007275, GO:0044699, GO:0048609, GO:0007389, GO:0022414, GO:0007276, GO:0000003, GO:0003006, GO:0070727, GO:0009948, GO:0007028, GO:0060811, GO:0060810, GO:0008298, GO:0071840, GO:0033036, GO:0048477, GO:0032502, GO:0048599, GO:0032501, GO:0009880, GO:0032504, GO:0019094, GO:0019953, GO:0007281, GO:0007316, GO:0007315, GO:0007314, GO:0008150, GO:0003002, GO:0022412, GO:0007351, GO:0007350, GO:0051179, GO:0051641, GO:0044767, GO:0006403, GO:0009952, GO:0044707, GO:0008595, GO:0044702, GO:0048856, GO:0044085, GO:0048869, GO:0044763, GO:0009987
GO:0031324 [BP]	negative regulation of cellular metabolic process	probable	GO:0009892, GO:0019222, GO:0031323, GO:0050794, GO:0008150, GO:0065007, GO:0048519, GO:0050789, GO:0048523
GO:0040002 [BP]	collagen and cuticulin-based cuticle development	probable	GO:0032502, GO:0042335, GO:0044707, GO:0048856, GO:0044767, GO:0032501, GO:0008150, GO:0007275, GO:0044699

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3HU3, chain A
Confidence level:very confident
Coverage over the Query: 8-196
View the alignment between query and template
View the model in PyMOL