Psyllid ID: psy6208


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------
MKLVPEGEMSNLFEVYLKPYFLEAYRPVHKDDLFIVRGGMRAVEFKIVDTDPAPYCIVAADTVIHCEGDPIKREEEEEASNAVGYDDIGGCRKQLAQIKEMVELPLRHPSLFKAIGVKPPRGILLYGPPGTGKTLIARAVANETGAFFFLINGPEIMSKLAGESESNLRKAFEEADKNSPSIIFIDELDAIAPKREK
cEEcccccccHHHHHHHHHHHHHcccccccccEEEEEEcccEEEEEEEEEcccccEEEccccEEEEccccccHHHHHHHcccccccccccHHHHHHHHHHHHHcccccHHHHHHcccccccEEEEEcccccHHHHHHHHHHHHcccEEEEEEcHHHHHHcccccHHHHHHHHHHHHHccccEEEEEEcccccccccc
ccccEcccccHHHHHHHHHHHHHHccccccccEEEEEccccEEEEEEEEEccccEEEEccccEEEEEccccccEEEEEEcccccHcccccHHHHHHHHHHHHccccccHHHHHHHccccccEEEEEcccccHHHHHHHHHHHHcccEEEEEccHHHHHHHHcccHHHHHHHHHHHHHcccEEEEEccHHHHcccccc
mklvpegemsNLFEVYLkpyfleayrpvhkddlfivrggmravefkivdtdpapycivaadtvihcegdpikreeeeeasnavgyddiggCRKQLAQIKEMVelplrhpslfkaigvkpprgillygppgtgkTLIARAVANETGAFFFLINGPEIMSKLAGESESNLRKAFEeadknspsiifideldaiapkrek
mklvpegemSNLFEVYLKPYFLEAYRPVHKDDLFIVRGGMRAVEFKIVDTDPAPYCIVAADTVIHCEGDPIKREEEeeasnavgyddigGCRKQLAQIKEMVELPLRHPSLFKAIGVKPPRGILLYGPPGTGKTLIARAVANETGAFFFLINGPEIMSKLAGESESNLRKAFEeadknspsiifideldaiapkrek
MKLVPEGEMSNLFEVYLKPYFLEAYRPVHKDDLFIVRGGMRAVEFKIVDTDPAPYCIVAADTVIHCEGDPIKREEEEEASNAVGYDDIGGCRKQLAQIKEMVELPLRHPSLFKAIGVKPPRGILLYGPPGTGKTLIARAVANETGAFFFLINGPEIMSKLAGESESNLRKAFEEADKNSPSIIFIDELDAIAPKREK
**********NLFEVYLKPYFLEAYRPVHKDDLFIVRGGMRAVEFKIVDTDPAPYCIVAADTVIHCE***************VGYDDIGGCRKQLAQIKEMVELPLRHPSLFKAIGVKPPRGILLYGPPGTGKTLIARAVANETGAFFFLINGPEIM************************IIFIDE**********
MKLVPEGEMSNLFEVYLKPYFLEAYRPVHKDDLFIVRGGMRAVEFKIVDTDPAPYCIVAADTVIHCE***************VGYDDIGGCRKQLAQIKEMVELPLRHPSLFKAIGVKPPRGILLYGPPGTGKTLIARAVANETGAFFFLINGPEIMSKLAGESESNLRKAFEEADKNSPSIIFIDELDAIAPK***
MKLVPEGEMSNLFEVYLKPYFLEAYRPVHKDDLFIVRGGMRAVEFKIVDTDPAPYCIVAADTVIHCEGDPIKR********AVGYDDIGGCRKQLAQIKEMVELPLRHPSLFKAIGVKPPRGILLYGPPGTGKTLIARAVANETGAFFFLINGPEIMSKLAGESESNLRKAFEEADKNSPSIIFIDELDAIAPKREK
MKLVPEGEMSNLFEVYLKPYFLEAYRPVHKDDLFIVRGGMRAVEFKIVDTDPAPYCIVAADTVIHCEGDPIKREEEEEASNAVGYDDIGGCRKQLAQIKEMVELPLRHPSLFKAIGVKPPRGILLYGPPGTGKTLIARAVANETGAFFFLINGPEIMSKLAGESESNLRKAFEEADKNSPSIIFIDELDAIAP****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKLVPEGEMSNLFEVYLKPYFLEAYRPVHKDDLFIVRGGMRAVEFKIVDTDPAPYCIVAADTVIHCEGDPIKREEEEEASNAVGYDDIGGCRKQLAQIKEMVELPLRHPSLFKAIGVKPPRGILLYGPPGTGKTLIARAVANETGAFFFLINGPEIMSKLAGESESNLRKAFEEADKNSPSIIFIDELDAIAPKREK
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query197 2.2.26 [Sep-21-2011]
Q6GL04 805 Transitional endoplasmic yes N/A 0.974 0.238 0.890 3e-99
P23787 805 Transitional endoplasmic N/A N/A 0.974 0.238 0.890 5e-99
Q3ZBT1 806 Transitional endoplasmic yes N/A 0.974 0.238 0.890 6e-99
P46462 806 Transitional endoplasmic yes N/A 0.974 0.238 0.890 6e-99
Q01853 806 Transitional endoplasmic yes N/A 0.974 0.238 0.890 6e-99
P55072 806 Transitional endoplasmic yes N/A 0.974 0.238 0.890 6e-99
P03974 806 Transitional endoplasmic yes N/A 0.974 0.238 0.890 6e-99
Q7ZU99 806 Transitional endoplasmic no N/A 0.969 0.236 0.885 7e-98
Q7KN62 801 Transitional endoplasmic yes N/A 0.969 0.238 0.864 2e-95
P54811 809 Transitional endoplasmic yes N/A 0.969 0.236 0.791 9e-90
>sp|Q6GL04|TERA_XENTR Transitional endoplasmic reticulum ATPase OS=Xenopus tropicalis GN=vcp PE=2 SV=1 Back     alignment and function desciption
 Score =  360 bits (924), Expect = 3e-99,   Method: Compositional matrix adjust.
 Identities = 171/192 (89%), Positives = 184/192 (95%)

Query: 6   EGEMSNLFEVYLKPYFLEAYRPVHKDDLFIVRGGMRAVEFKIVDTDPAPYCIVAADTVIH 65
           EG   NLFEVYLKPYFLEAYRP+ K D+F+VRGGMRAVEFK+V+TDP+PYCIVA DTVIH
Sbjct: 124 EGITGNLFEVYLKPYFLEAYRPIRKGDIFLVRGGMRAVEFKVVETDPSPYCIVAPDTVIH 183

Query: 66  CEGDPIKREEEEEASNAVGYDDIGGCRKQLAQIKEMVELPLRHPSLFKAIGVKPPRGILL 125
           CEG+PIKRE+EEE+ N VGYDDIGGCRKQLAQIKEMVELPLRHP+LFKAIGVKPPRGILL
Sbjct: 184 CEGEPIKREDEEESLNEVGYDDIGGCRKQLAQIKEMVELPLRHPALFKAIGVKPPRGILL 243

Query: 126 YGPPGTGKTLIARAVANETGAFFFLINGPEIMSKLAGESESNLRKAFEEADKNSPSIIFI 185
           YGPPGTGKTLIARAVANETGAFFFLINGPEIMSKLAGESESNLRKAFEEA+KN+P+IIFI
Sbjct: 244 YGPPGTGKTLIARAVANETGAFFFLINGPEIMSKLAGESESNLRKAFEEAEKNAPAIIFI 303

Query: 186 DELDAIAPKREK 197
           DELDAIAPKREK
Sbjct: 304 DELDAIAPKREK 315




Necessary for the fragmentation of Golgi stacks during mitosis and for their reassembly after mitosis. Involved in the formation of the nuclear envelope and of the transitional endoplasmic reticulum (tER). The transfer of membranes from the endoplasmic reticulum to the Golgi apparatus occurs via 50-70 nm transition vesicles which derive from part-rough, part-smooth transitional elements of the endoplasmic reticulum (tER). Vesicle budding from the tER is an ATP-dependent process.
Xenopus tropicalis (taxid: 8364)
>sp|P23787|TERA_XENLA Transitional endoplasmic reticulum ATPase OS=Xenopus laevis GN=vcp PE=1 SV=3 Back     alignment and function description
>sp|Q3ZBT1|TERA_BOVIN Transitional endoplasmic reticulum ATPase OS=Bos taurus GN=VCP PE=2 SV=1 Back     alignment and function description
>sp|P46462|TERA_RAT Transitional endoplasmic reticulum ATPase OS=Rattus norvegicus GN=Vcp PE=1 SV=3 Back     alignment and function description
>sp|Q01853|TERA_MOUSE Transitional endoplasmic reticulum ATPase OS=Mus musculus GN=Vcp PE=1 SV=4 Back     alignment and function description
>sp|P55072|TERA_HUMAN Transitional endoplasmic reticulum ATPase OS=Homo sapiens GN=VCP PE=1 SV=4 Back     alignment and function description
>sp|P03974|TERA_PIG Transitional endoplasmic reticulum ATPase OS=Sus scrofa GN=VCP PE=1 SV=5 Back     alignment and function description
>sp|Q7ZU99|TERA_DANRE Transitional endoplasmic reticulum ATPase OS=Danio rerio GN=vcp PE=1 SV=1 Back     alignment and function description
>sp|Q7KN62|TERA_DROME Transitional endoplasmic reticulum ATPase TER94 OS=Drosophila melanogaster GN=TER94 PE=1 SV=1 Back     alignment and function description
>sp|P54811|TERA1_CAEEL Transitional endoplasmic reticulum ATPase homolog 1 OS=Caenorhabditis elegans GN=cdc-48.1 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query197
193617621 804 PREDICTED: transitional endoplasmic reti 0.974 0.238 0.932 1e-102
91086235 803 PREDICTED: similar to transitional endop 0.969 0.237 0.927 1e-100
242008814 804 conserved hypothetical protein [Pediculu 0.969 0.237 0.927 1e-100
344251788 2171 Transitional endoplasmic reticulum ATPas 0.974 0.088 0.890 1e-99
307211146 796 Transitional endoplasmic reticulum ATPas 0.974 0.241 0.921 2e-99
322801676 793 hypothetical protein SINV_06607 [Solenop 0.974 0.242 0.921 2e-99
170036949 797 spermatogenesis associated factor [Culex 0.969 0.239 0.911 2e-99
332031336 832 Transitional endoplasmic reticulum ATPas 0.974 0.230 0.921 2e-99
345486620 801 PREDICTED: transitional endoplasmic reti 0.974 0.239 0.916 2e-99
307174120 801 Transitional endoplasmic reticulum ATPas 0.974 0.239 0.916 5e-99
>gi|193617621|ref|XP_001949588.1| PREDICTED: transitional endoplasmic reticulum ATPase TER94-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
 Score =  375 bits (963), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 179/192 (93%), Positives = 186/192 (96%)

Query: 6   EGEMSNLFEVYLKPYFLEAYRPVHKDDLFIVRGGMRAVEFKIVDTDPAPYCIVAADTVIH 65
           EG   NLFEV+LKPYFLEAYRP+HKDD FIVRGGMRAVEFK+V+TDP+PYCIVA DTVIH
Sbjct: 122 EGLTGNLFEVFLKPYFLEAYRPIHKDDNFIVRGGMRAVEFKVVETDPSPYCIVAYDTVIH 181

Query: 66  CEGDPIKREEEEEASNAVGYDDIGGCRKQLAQIKEMVELPLRHPSLFKAIGVKPPRGILL 125
           CEGDPIKREEEEEASN VGYDDIGGCRKQLAQIKEMVELPLRHPSLFKAIGVKPPRGILL
Sbjct: 182 CEGDPIKREEEEEASNTVGYDDIGGCRKQLAQIKEMVELPLRHPSLFKAIGVKPPRGILL 241

Query: 126 YGPPGTGKTLIARAVANETGAFFFLINGPEIMSKLAGESESNLRKAFEEADKNSPSIIFI 185
           YGPPGTGKTLIARAVANETGAFFFLINGPEIMSKLAGESESNLRKAFEEAD+NSP+IIFI
Sbjct: 242 YGPPGTGKTLIARAVANETGAFFFLINGPEIMSKLAGESESNLRKAFEEADRNSPAIIFI 301

Query: 186 DELDAIAPKREK 197
           DELDAIAPKREK
Sbjct: 302 DELDAIAPKREK 313




Source: Acyrthosiphon pisum

Species: Acyrthosiphon pisum

Genus: Acyrthosiphon

Family: Aphididae

Order: Hemiptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|91086235|ref|XP_966692.1| PREDICTED: similar to transitional endoplasmic reticulum ATPase TER94 isoform 1 [Tribolium castaneum] gi|270011017|gb|EFA07465.1| transitional endoplasmic reticulum ATPase TER94 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|242008814|ref|XP_002425193.1| conserved hypothetical protein [Pediculus humanus corporis] gi|212508909|gb|EEB12455.1| conserved hypothetical protein [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|344251788|gb|EGW07892.1| Transitional endoplasmic reticulum ATPase [Cricetulus griseus] Back     alignment and taxonomy information
>gi|307211146|gb|EFN87364.1| Transitional endoplasmic reticulum ATPase TER94 [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|322801676|gb|EFZ22299.1| hypothetical protein SINV_06607 [Solenopsis invicta] Back     alignment and taxonomy information
>gi|170036949|ref|XP_001846323.1| spermatogenesis associated factor [Culex quinquefasciatus] gi|167879951|gb|EDS43334.1| spermatogenesis associated factor [Culex quinquefasciatus] Back     alignment and taxonomy information
>gi|332031336|gb|EGI70849.1| Transitional endoplasmic reticulum ATPase TER94 [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|345486620|ref|XP_001605497.2| PREDICTED: transitional endoplasmic reticulum ATPase TER94-like [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|307174120|gb|EFN64778.1| Transitional endoplasmic reticulum ATPase TER94 [Camponotus floridanus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query197
UNIPROTKB|G3X757 806 VCP "Transitional endoplasmic 0.974 0.238 0.890 2.7e-91
UNIPROTKB|Q3ZBT1 806 VCP "Transitional endoplasmic 0.974 0.238 0.890 2.7e-91
UNIPROTKB|E2RLQ9 822 VCP "Uncharacterized protein" 0.974 0.233 0.890 2.7e-91
UNIPROTKB|P55072 806 VCP "Transitional endoplasmic 0.974 0.238 0.890 2.7e-91
UNIPROTKB|F1SIH8 808 VCP "Transitional endoplasmic 0.974 0.237 0.890 2.7e-91
UNIPROTKB|P23787 805 vcp "Transitional endoplasmic 0.974 0.238 0.890 2.7e-91
UNIPROTKB|Q6GL04 805 vcp "Transitional endoplasmic 0.974 0.238 0.890 2.7e-91
MGI|MGI:99919 806 Vcp "valosin containing protei 0.974 0.238 0.890 2.7e-91
RGD|621595 806 Vcp "valosin-containing protei 0.974 0.238 0.890 2.7e-91
UNIPROTKB|P03974 806 VCP "Transitional endoplasmic 0.974 0.238 0.890 2.7e-91
UNIPROTKB|G3X757 VCP "Transitional endoplasmic reticulum ATPase" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
 Score = 910 (325.4 bits), Expect = 2.7e-91, P = 2.7e-91
 Identities = 171/192 (89%), Positives = 184/192 (95%)

Query:     6 EGEMSNLFEVYLKPYFLEAYRPVHKDDLFIVRGGMRAVEFKIVDTDPAPYCIVAADTVIH 65
             EG   NLFEVYLKPYFLEAYRP+ K D+F+VRGGMRAVEFK+V+TDP+PYCIVA DTVIH
Sbjct:   124 EGITGNLFEVYLKPYFLEAYRPIRKGDIFLVRGGMRAVEFKVVETDPSPYCIVAPDTVIH 183

Query:    66 CEGDPIKREEEEEASNAVGYDDIGGCRKQLAQIKEMVELPLRHPSLFKAIGVKPPRGILL 125
             CEG+PIKRE+EEE+ N VGYDDIGGCRKQLAQIKEMVELPLRHP+LFKAIGVKPPRGILL
Sbjct:   184 CEGEPIKREDEEESLNEVGYDDIGGCRKQLAQIKEMVELPLRHPALFKAIGVKPPRGILL 243

Query:   126 YGPPGTGKTLIARAVANETGAFFFLINGPEIMSKLAGESESNLRKAFEEADKNSPSIIFI 185
             YGPPGTGKTLIARAVANETGAFFFLINGPEIMSKLAGESESNLRKAFEEA+KN+P+IIFI
Sbjct:   244 YGPPGTGKTLIARAVANETGAFFFLINGPEIMSKLAGESESNLRKAFEEAEKNAPAIIFI 303

Query:   186 DELDAIAPKREK 197
             DELDAIAPKREK
Sbjct:   304 DELDAIAPKREK 315


GO:0070842 "aggresome assembly" evidence=IEA
GO:0045732 "positive regulation of protein catabolic process" evidence=IEA
GO:0035861 "site of double-strand break" evidence=IEA
GO:0031593 "polyubiquitin binding" evidence=IEA
GO:0031334 "positive regulation of protein complex assembly" evidence=IEA
GO:0030970 "retrograde protein transport, ER to cytosol" evidence=IEA
GO:0019904 "protein domain specific binding" evidence=IEA
GO:0019903 "protein phosphatase binding" evidence=IEA
GO:0018279 "protein N-linked glycosylation via asparagine" evidence=IEA
GO:0006919 "activation of cysteine-type endopeptidase activity involved in apoptotic process" evidence=IEA
GO:0006511 "ubiquitin-dependent protein catabolic process" evidence=IEA
GO:0006302 "double-strand break repair" evidence=IEA
GO:0005737 "cytoplasm" evidence=IEA
GO:0005634 "nucleus" evidence=IEA
GO:0000502 "proteasome complex" evidence=IEA
GO:0005524 "ATP binding" evidence=IEA
GO:0017111 "nucleoside-triphosphatase activity" evidence=IEA
UNIPROTKB|Q3ZBT1 VCP "Transitional endoplasmic reticulum ATPase" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|E2RLQ9 VCP "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|P55072 VCP "Transitional endoplasmic reticulum ATPase" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1SIH8 VCP "Transitional endoplasmic reticulum ATPase" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|P23787 vcp "Transitional endoplasmic reticulum ATPase" [Xenopus laevis (taxid:8355)] Back     alignment and assigned GO terms
UNIPROTKB|Q6GL04 vcp "Transitional endoplasmic reticulum ATPase" [Xenopus (Silurana) tropicalis (taxid:8364)] Back     alignment and assigned GO terms
MGI|MGI:99919 Vcp "valosin containing protein" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|621595 Vcp "valosin-containing protein" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|P03974 VCP "Transitional endoplasmic reticulum ATPase" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q58556Y1156_METJANo assigned EC number0.55120.78680.1716yesN/A
P54609CD48A_ARATHNo assigned EC number0.79680.96950.2360yesN/A
P46462TERA_RATNo assigned EC number0.89060.97460.2382yesN/A
Q3ZBT1TERA_BOVINNo assigned EC number0.89060.97460.2382yesN/A
Q9P3A7CDC48_SCHPONo assigned EC number0.76560.97460.2355yesN/A
P55072TERA_HUMANNo assigned EC number0.89060.97460.2382yesN/A
Q01853TERA_MOUSENo assigned EC number0.89060.97460.2382yesN/A
Q5AWS6CDC48_EMENINo assigned EC number0.77080.97460.2332yesN/A
Q8SSJ5CDC48_ENCCUNo assigned EC number0.60410.94410.2384yesN/A
Q7KN62TERA_DROMENo assigned EC number0.86450.96950.2384yesN/A
P54811TERA1_CAEELNo assigned EC number0.79160.96950.2360yesN/A
Q6GL04TERA_XENTRNo assigned EC number0.89060.97460.2385yesN/A
O05209VAT_THEACNo assigned EC number0.52540.86290.2281yesN/A
P25694CDC48_YEASTNo assigned EC number0.77600.96950.2287yesN/A
Q9LZF6CD48E_ARATHNo assigned EC number0.79680.96950.2358yesN/A
P03974TERA_PIGNo assigned EC number0.89060.97460.2382yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query197
TIGR01243 733 TIGR01243, CDC48, AAA family ATPase, CDC48 subfami 3e-58
COG1222 406 COG1222, RPT1, ATP-dependent 26S proteasome regula 3e-51
PRK03992 389 PRK03992, PRK03992, proteasome-activating nucleoti 2e-47
TIGR01242 364 TIGR01242, 26Sp45, 26S proteasome subunit P45 fami 2e-43
PTZ00454 398 PTZ00454, PTZ00454, 26S protease regulatory subuni 3e-43
PTZ00361 438 PTZ00361, PTZ00361, 26 proteosome regulatory subun 3e-43
COG0464 494 COG0464, SpoVK, ATPases of the AAA+ class [Posttra 8e-41
TIGR01243 733 TIGR01243, CDC48, AAA family ATPase, CDC48 subfami 3e-40
TIGR03689 512 TIGR03689, pup_AAA, proteasome ATPase 2e-36
pfam00004131 pfam00004, AAA, ATPase family associated with vari 2e-35
TIGR01241 495 TIGR01241, FtsH_fam, ATP-dependent metalloprotease 3e-33
COG1223 368 COG1223, COG1223, Predicted ATPase (AAA+ superfami 3e-29
CHL00176 638 CHL00176, ftsH, cell division protein; Validated 7e-29
COG0464 494 COG0464, SpoVK, ATPases of the AAA+ class [Posttra 1e-28
COG0465 596 COG0465, HflB, ATP-dependent Zn proteases [Posttra 5e-28
PRK10733 644 PRK10733, hflB, ATP-dependent metalloprotease; Rev 2e-26
cd00009151 cd00009, AAA, The AAA+ (ATPases Associated with a 6e-20
smart00382148 smart00382, AAA, ATPases associated with a variety 3e-14
PRK13342 413 PRK13342, PRK13342, recombination factor protein R 7e-13
smart0107264 smart01072, CDC48_2, Cell division protein 48 (CDC 9e-12
CHL00195 489 CHL00195, ycf46, Ycf46; Provisional 2e-11
COG2256 436 COG2256, MGS1, ATPase related to the helicase subu 1e-10
PRK13341 725 PRK13341, PRK13341, recombination factor protein R 9e-09
pfam0293361 pfam02933, CDC48_2, Cell division protein 48 (CDC4 7e-08
COG2255 332 COG2255, RuvB, Holliday junction resolvasome, heli 1e-07
TIGR00635 305 TIGR00635, ruvB, Holliday junction DNA helicase, R 2e-07
PRK00080 328 PRK00080, ruvB, Holliday junction DNA helicase Ruv 9e-07
PHA02544 316 PHA02544, 44, clamp loader, small subunit; Provisi 1e-06
COG1484254 COG1484, DnaC, DNA replication protein [DNA replic 3e-06
PRK04195 482 PRK04195, PRK04195, replication factor C large sub 3e-06
COG1224 450 COG1224, TIP49, DNA helicase TIP49, TBP-interactin 4e-06
TIGR03922 557 TIGR03922, T7SS_EccA, type VII secretion AAA-ATPas 6e-06
pfam06068 395 pfam06068, TIP49, TIP49 C-terminus 7e-06
COG0714 329 COG0714, COG0714, MoxR-like ATPases [General funct 1e-05
pfam07724168 pfam07724, AAA_2, AAA domain (Cdc48 subfamily) 3e-05
pfam05496 231 pfam05496, RuvB_N, Holliday junction DNA helicase 5e-05
TIGR02928 365 TIGR02928, TIGR02928, orc1/cdc6 family replication 7e-05
TIGR00382 413 TIGR00382, clpX, endopeptidase Clp ATP-binding reg 1e-04
PRK08116268 PRK08116, PRK08116, hypothetical protein; Validate 2e-04
COG0542 786 COG0542, clpA, ATP-binding subunits of Clp proteas 2e-04
pfam13401124 pfam13401, AAA_22, AAA domain 4e-04
pfam07728135 pfam07728, AAA_5, AAA domain (dynein-related subfa 5e-04
pfam13191154 pfam13191, AAA_16, AAA ATPase domain 5e-04
COG1474 366 COG1474, CDC6, Cdc6-related protein, AAA superfami 8e-04
pfam00910105 pfam00910, RNA_helicase, RNA helicase 0.001
pfam01057271 pfam01057, Parvo_NS1, Parvovirus non-structural pr 0.002
pfam13207114 pfam13207, AAA_17, AAA domain 0.002
PRK05342 412 PRK05342, clpX, ATP-dependent protease ATP-binding 0.003
COG1219 408 COG1219, ClpX, ATP-dependent protease Clp, ATPase 0.003
>gnl|CDD|233328 TIGR01243, CDC48, AAA family ATPase, CDC48 subfamily Back     alignment and domain information
 Score =  194 bits (494), Expect = 3e-58
 Identities = 98/185 (52%), Positives = 131/185 (70%), Gaps = 3/185 (1%)

Query: 13  FEVYLKPYFLEAYRPVHKDDLFIVRGGMRAVEFKIVDTDPAPYCIVAADTVIHCEGDPIK 72
           F  Y+K + L   +P+ K +  IV     A+ F +V T PA +  V   T +     P+ 
Sbjct: 108 FVDYVKEFLLG--KPISKGETVIVPVLEGALPFVVVSTQPAGFVYVTEATEVEIREKPV- 164

Query: 73  REEEEEASNAVGYDDIGGCRKQLAQIKEMVELPLRHPSLFKAIGVKPPRGILLYGPPGTG 132
           REE E     V Y+DIGG ++   +I+EMVELP++HP LF+ +G++PP+G+LLYGPPGTG
Sbjct: 165 REEIERKVPKVTYEDIGGLKEAKEKIREMVELPMKHPELFEHLGIEPPKGVLLYGPPGTG 224

Query: 133 KTLIARAVANETGAFFFLINGPEIMSKLAGESESNLRKAFEEADKNSPSIIFIDELDAIA 192
           KTL+A+AVANE GA+F  INGPEIMSK  GESE  LR+ F+EA++N+PSIIFIDE+DAIA
Sbjct: 225 KTLLAKAVANEAGAYFISINGPEIMSKYYGESEERLREIFKEAEENAPSIIFIDEIDAIA 284

Query: 193 PKREK 197
           PKRE+
Sbjct: 285 PKREE 289


This subfamily of the AAA family ATPases includes two members each from three archaeal species. It also includes yeast CDC48 (cell division control protein 48) and the human ortholog, transitional endoplasmic reticulum ATPase (valosin-containing protein). These proteins in eukaryotes are involved in the budding and transfer of membrane from the transitional endoplasmic reticulum to the Golgi apparatus. Length = 733

>gnl|CDD|224143 COG1222, RPT1, ATP-dependent 26S proteasome regulatory subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|179699 PRK03992, PRK03992, proteasome-activating nucleotidase; Provisional Back     alignment and domain information
>gnl|CDD|130309 TIGR01242, 26Sp45, 26S proteasome subunit P45 family Back     alignment and domain information
>gnl|CDD|240423 PTZ00454, PTZ00454, 26S protease regulatory subunit 6B-like protein; Provisional Back     alignment and domain information
>gnl|CDD|185575 PTZ00361, PTZ00361, 26 proteosome regulatory subunit 4-like protein; Provisional Back     alignment and domain information
>gnl|CDD|223540 COG0464, SpoVK, ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|233328 TIGR01243, CDC48, AAA family ATPase, CDC48 subfamily Back     alignment and domain information
>gnl|CDD|200312 TIGR03689, pup_AAA, proteasome ATPase Back     alignment and domain information
>gnl|CDD|215649 pfam00004, AAA, ATPase family associated with various cellular activities (AAA) Back     alignment and domain information
>gnl|CDD|233327 TIGR01241, FtsH_fam, ATP-dependent metalloprotease FtsH Back     alignment and domain information
>gnl|CDD|224144 COG1223, COG1223, Predicted ATPase (AAA+ superfamily) [General function prediction only] Back     alignment and domain information
>gnl|CDD|214386 CHL00176, ftsH, cell division protein; Validated Back     alignment and domain information
>gnl|CDD|223540 COG0464, SpoVK, ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|223541 COG0465, HflB, ATP-dependent Zn proteases [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|182683 PRK10733, hflB, ATP-dependent metalloprotease; Reviewed Back     alignment and domain information
>gnl|CDD|99707 cd00009, AAA, The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold Back     alignment and domain information
>gnl|CDD|214640 smart00382, AAA, ATPases associated with a variety of cellular activities Back     alignment and domain information
>gnl|CDD|237355 PRK13342, PRK13342, recombination factor protein RarA; Reviewed Back     alignment and domain information
>gnl|CDD|215011 smart01072, CDC48_2, Cell division protein 48 (CDC48) domain 2 Back     alignment and domain information
>gnl|CDD|177094 CHL00195, ycf46, Ycf46; Provisional Back     alignment and domain information
>gnl|CDD|225165 COG2256, MGS1, ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|237354 PRK13341, PRK13341, recombination factor protein RarA/unknown domain fusion protein; Reviewed Back     alignment and domain information
>gnl|CDD|202475 pfam02933, CDC48_2, Cell division protein 48 (CDC48), domain 2 Back     alignment and domain information
>gnl|CDD|225164 COG2255, RuvB, Holliday junction resolvasome, helicase subunit [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|129721 TIGR00635, ruvB, Holliday junction DNA helicase, RuvB subunit Back     alignment and domain information
>gnl|CDD|234619 PRK00080, ruvB, Holliday junction DNA helicase RuvB; Reviewed Back     alignment and domain information
>gnl|CDD|222866 PHA02544, 44, clamp loader, small subunit; Provisional Back     alignment and domain information
>gnl|CDD|224401 COG1484, DnaC, DNA replication protein [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional Back     alignment and domain information
>gnl|CDD|224145 COG1224, TIP49, DNA helicase TIP49, TBP-interacting protein [Transcription] Back     alignment and domain information
>gnl|CDD|188437 TIGR03922, T7SS_EccA, type VII secretion AAA-ATPase EccA Back     alignment and domain information
>gnl|CDD|147949 pfam06068, TIP49, TIP49 C-terminus Back     alignment and domain information
>gnl|CDD|223786 COG0714, COG0714, MoxR-like ATPases [General function prediction only] Back     alignment and domain information
>gnl|CDD|219536 pfam07724, AAA_2, AAA domain (Cdc48 subfamily) Back     alignment and domain information
>gnl|CDD|203260 pfam05496, RuvB_N, Holliday junction DNA helicase ruvB N-terminus Back     alignment and domain information
>gnl|CDD|234063 TIGR02928, TIGR02928, orc1/cdc6 family replication initiation protein Back     alignment and domain information
>gnl|CDD|232949 TIGR00382, clpX, endopeptidase Clp ATP-binding regulatory subunit (clpX) Back     alignment and domain information
>gnl|CDD|236153 PRK08116, PRK08116, hypothetical protein; Validated Back     alignment and domain information
>gnl|CDD|223616 COG0542, clpA, ATP-binding subunits of Clp protease and DnaK/DnaJ chaperones [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|222104 pfam13401, AAA_22, AAA domain Back     alignment and domain information
>gnl|CDD|219538 pfam07728, AAA_5, AAA domain (dynein-related subfamily) Back     alignment and domain information
>gnl|CDD|221970 pfam13191, AAA_16, AAA ATPase domain Back     alignment and domain information
>gnl|CDD|224391 COG1474, CDC6, Cdc6-related protein, AAA superfamily ATPase [DNA replication, recombination, and repair / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|216186 pfam00910, RNA_helicase, RNA helicase Back     alignment and domain information
>gnl|CDD|216270 pfam01057, Parvo_NS1, Parvovirus non-structural protein NS1 Back     alignment and domain information
>gnl|CDD|221983 pfam13207, AAA_17, AAA domain Back     alignment and domain information
>gnl|CDD|235422 PRK05342, clpX, ATP-dependent protease ATP-binding subunit ClpX; Provisional Back     alignment and domain information
>gnl|CDD|224140 COG1219, ClpX, ATP-dependent protease Clp, ATPase subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 197
COG1222 406 RPT1 ATP-dependent 26S proteasome regulatory subun 99.97
KOG0733|consensus 802 99.96
COG1223 368 Predicted ATPase (AAA+ superfamily) [General funct 99.95
KOG0730|consensus 693 99.95
KOG0736|consensus 953 99.95
KOG0733|consensus 802 99.94
KOG0727|consensus 408 99.93
KOG0739|consensus 439 99.93
KOG0738|consensus 491 99.92
KOG0652|consensus 424 99.92
KOG0728|consensus 404 99.91
KOG0726|consensus 440 99.91
TIGR01243 733 CDC48 AAA family ATPase, CDC48 subfamily. This sub 99.91
KOG0729|consensus 435 99.91
KOG0735|consensus 952 99.91
KOG0734|consensus 752 99.91
PTZ00454 398 26S protease regulatory subunit 6B-like protein; P 99.89
PRK03992 389 proteasome-activating nucleotidase; Provisional 99.89
KOG0731|consensus 774 99.88
KOG0730|consensus 693 99.88
COG0464 494 SpoVK ATPases of the AAA+ class [Posttranslational 99.88
PTZ00361 438 26 proteosome regulatory subunit 4-like protein; P 99.87
TIGR01243 733 CDC48 AAA family ATPase, CDC48 subfamily. This sub 99.87
KOG0737|consensus 386 99.86
KOG0651|consensus 388 99.85
TIGR03689 512 pup_AAA proteasome ATPase. In the Actinobacteria, 99.85
TIGR01242 364 26Sp45 26S proteasome subunit P45 family. Many pro 99.85
TIGR01241 495 FtsH_fam ATP-dependent metalloprotease FtsH. HflB( 99.85
CHL00195 489 ycf46 Ycf46; Provisional 99.83
COG0465 596 HflB ATP-dependent Zn proteases [Posttranslational 99.82
CHL00176 638 ftsH cell division protein; Validated 99.81
KOG0740|consensus 428 99.81
PLN00020 413 ribulose bisphosphate carboxylase/oxygenase activa 99.81
KOG0732|consensus 1080 99.77
KOG0741|consensus 744 99.77
PF05496 233 RuvB_N: Holliday junction DNA helicase ruvB N-term 99.68
PRK10733 644 hflB ATP-dependent metalloprotease; Reviewed 99.67
PF00004132 AAA: ATPase family associated with various cellula 99.67
TIGR02881 261 spore_V_K stage V sporulation protein K. Members o 99.66
CHL00206 2281 ycf2 Ycf2; Provisional 99.64
TIGR02880 284 cbbX_cfxQ probable Rubsico expression protein CbbX 99.64
CHL00181 287 cbbX CbbX; Provisional 99.63
PRK00149 450 dnaA chromosomal replication initiation protein; R 99.6
TIGR00362 405 DnaA chromosomal replication initiator protein Dna 99.59
PRK14088 440 dnaA chromosomal replication initiation protein; P 99.57
COG2255 332 RuvB Holliday junction resolvasome, helicase subun 99.56
COG2256 436 MGS1 ATPase related to the helicase subunit of the 99.54
KOG0744|consensus 423 99.52
PRK12422 445 chromosomal replication initiation protein; Provis 99.5
TIGR02639 731 ClpA ATP-dependent Clp protease ATP-binding subuni 99.5
COG0593 408 DnaA ATPase involved in DNA replication initiation 99.47
KOG0743|consensus 457 99.46
KOG0736|consensus 953 99.44
CHL00095 821 clpC Clp protease ATP binding subunit 99.43
PRK14087 450 dnaA chromosomal replication initiation protein; P 99.42
PRK00080 328 ruvB Holliday junction DNA helicase RuvB; Reviewed 99.42
PRK04195 482 replication factor C large subunit; Provisional 99.42
PRK05342 412 clpX ATP-dependent protease ATP-binding subunit Cl 99.42
PF00308 219 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013 99.41
TIGR00635 305 ruvB Holliday junction DNA helicase, RuvB subunit. 99.41
COG3829 560 RocR Transcriptional regulator containing PAS, AAA 99.39
TIGR00763 775 lon ATP-dependent protease La. This protein is ind 99.38
PRK10865 857 protein disaggregation chaperone; Provisional 99.37
PRK13342 413 recombination factor protein RarA; Reviewed 99.37
PLN03025 319 replication factor C subunit; Provisional 99.36
PF00158168 Sigma54_activat: Sigma-54 interaction domain; Inte 99.34
TIGR00382 413 clpX endopeptidase Clp ATP-binding regulatory subu 99.33
PRK14086 617 dnaA chromosomal replication initiation protein; P 99.32
KOG2028|consensus 554 99.32
PRK11034 758 clpA ATP-dependent Clp protease ATP-binding subuni 99.31
TIGR03346 852 chaperone_ClpB ATP-dependent chaperone ClpB. Membe 99.3
PRK14956 484 DNA polymerase III subunits gamma and tau; Provisi 99.3
PHA02544 316 44 clamp loader, small subunit; Provisional 99.3
cd00009151 AAA The AAA+ (ATPases Associated with a wide varie 99.29
PRK14962 472 DNA polymerase III subunits gamma and tau; Provisi 99.29
PRK14958 509 DNA polymerase III subunits gamma and tau; Provisi 99.29
PRK12402 337 replication factor C small subunit 2; Reviewed 99.28
TIGR03345 852 VI_ClpV1 type VI secretion ATPase, ClpV1 family. M 99.28
PRK12323 700 DNA polymerase III subunits gamma and tau; Provisi 99.27
TIGR03420 226 DnaA_homol_Hda DnaA regulatory inactivator Hda. Me 99.27
PRK08903 227 DnaA regulatory inactivator Hda; Validated 99.27
PRK14960 702 DNA polymerase III subunits gamma and tau; Provisi 99.26
PRK12377248 putative replication protein; Provisional 99.26
COG3283 511 TyrR Transcriptional regulator of aromatic amino a 99.26
PRK13341 725 recombination factor protein RarA/unknown domain f 99.26
KOG0989|consensus 346 99.25
PRK08727 233 hypothetical protein; Validated 99.25
PRK10820 520 DNA-binding transcriptional regulator TyrR; Provis 99.24
PRK08084 235 DNA replication initiation factor; Provisional 99.24
PRK07003 830 DNA polymerase III subunits gamma and tau; Validat 99.24
TIGR02928 365 orc1/cdc6 family replication initiation protein. M 99.24
PRK14961 363 DNA polymerase III subunits gamma and tau; Provisi 99.23
COG0466 782 Lon ATP-dependent Lon protease, bacterial type [Po 99.23
PRK14949 944 DNA polymerase III subunits gamma and tau; Provisi 99.23
smart00382148 AAA ATPases associated with a variety of cellular 99.21
PRK14964 491 DNA polymerase III subunits gamma and tau; Provisi 99.21
COG1484254 DnaC DNA replication protein [DNA replication, rec 99.21
PRK00411 394 cdc6 cell division control protein 6; Reviewed 99.2
PRK07952244 DNA replication protein DnaC; Validated 99.2
PRK07994 647 DNA polymerase III subunits gamma and tau; Validat 99.2
PRK06893 229 DNA replication initiation factor; Validated 99.19
COG3604 550 FhlA Transcriptional regulator containing GAF, AAA 99.19
PRK08181269 transposase; Validated 99.18
PRK06645 507 DNA polymerase III subunits gamma and tau; Validat 99.18
PRK14963 504 DNA polymerase III subunits gamma and tau; Provisi 99.18
PRK05642 234 DNA replication initiation factor; Validated 99.18
KOG0742|consensus 630 99.18
PRK11034 758 clpA ATP-dependent Clp protease ATP-binding subuni 99.18
PRK14951 618 DNA polymerase III subunits gamma and tau; Provisi 99.18
PRK15424 538 propionate catabolism operon regulatory protein Pr 99.17
PRK08691 709 DNA polymerase III subunits gamma and tau; Validat 99.17
KOG0735|consensus 952 99.16
PRK14969 527 DNA polymerase III subunits gamma and tau; Provisi 99.15
TIGR02329 526 propionate_PrpR propionate catabolism operon regul 99.15
PF05673 249 DUF815: Protein of unknown function (DUF815); Inte 99.15
PRK14957 546 DNA polymerase III subunits gamma and tau; Provisi 99.14
TIGR02902 531 spore_lonB ATP-dependent protease LonB. Members of 99.13
PRK14955 397 DNA polymerase III subunits gamma and tau; Provisi 99.13
KOG0991|consensus 333 99.13
PRK08939306 primosomal protein DnaI; Reviewed 99.13
COG2204 464 AtoC Response regulator containing CheY-like recei 99.12
PRK07940 394 DNA polymerase III subunit delta'; Validated 99.12
PRK14952 584 DNA polymerase III subunits gamma and tau; Provisi 99.11
PRK10787 784 DNA-binding ATP-dependent protease La; Provisional 99.11
KOG2004|consensus 906 99.11
PRK06835329 DNA replication protein DnaC; Validated 99.1
TIGR02639 731 ClpA ATP-dependent Clp protease ATP-binding subuni 99.1
COG1219 408 ClpX ATP-dependent protease Clp, ATPase subunit [P 99.09
PRK14959 624 DNA polymerase III subunits gamma and tau; Provisi 99.09
PRK14970 367 DNA polymerase III subunits gamma and tau; Provisi 99.09
PF01695178 IstB_IS21: IstB-like ATP binding protein; InterPro 99.09
TIGR01817 534 nifA Nif-specific regulatory protein. This model r 99.08
PRK05896 605 DNA polymerase III subunits gamma and tau; Validat 99.08
TIGR02640 262 gas_vesic_GvpN gas vesicle protein GvpN. Members o 99.08
PTZ00112 1164 origin recognition complex 1 protein; Provisional 99.07
TIGR02974 329 phageshock_pspF psp operon transcriptional activat 99.07
PRK07764 824 DNA polymerase III subunits gamma and tau; Validat 99.07
PRK06526254 transposase; Provisional 99.07
COG0542 786 clpA ATP-binding subunits of Clp protease and DnaK 99.07
PRK11608 326 pspF phage shock protein operon transcriptional ac 99.07
TIGR03345 852 VI_ClpV1 type VI secretion ATPase, ClpV1 family. M 99.06
PRK14965 576 DNA polymerase III subunits gamma and tau; Provisi 99.06
PRK08116268 hypothetical protein; Validated 99.06
PRK05563 559 DNA polymerase III subunits gamma and tau; Validat 99.06
COG1221 403 PspF Transcriptional regulators containing an AAA- 99.06
TIGR02397 355 dnaX_nterm DNA polymerase III, subunit gamma and t 99.05
PRK00440 319 rfc replication factor C small subunit; Reviewed 99.05
PHA02244 383 ATPase-like protein 99.04
PRK14954 620 DNA polymerase III subunits gamma and tau; Provisi 99.04
COG1474 366 CDC6 Cdc6-related protein, AAA superfamily ATPase 99.04
PRK15429 686 formate hydrogenlyase transcriptional activator Fh 99.04
PRK14948 620 DNA polymerase III subunits gamma and tau; Provisi 99.02
PRK06620 214 hypothetical protein; Validated 99.01
PRK06647 563 DNA polymerase III subunits gamma and tau; Validat 99.01
TIGR00390 441 hslU ATP-dependent protease HslVU, ATPase subunit. 99.01
PRK05022 509 anaerobic nitric oxide reductase transcription reg 99.01
PF07724171 AAA_2: AAA domain (Cdc48 subfamily); InterPro: IPR 99.01
PRK11388 638 DNA-binding transcriptional regulator DhaR; Provis 99.0
PRK06305 451 DNA polymerase III subunits gamma and tau; Validat 99.0
PRK06921266 hypothetical protein; Provisional 98.99
PRK07133 725 DNA polymerase III subunits gamma and tau; Validat 98.99
PRK09183259 transposase/IS protein; Provisional 98.99
PRK14953 486 DNA polymerase III subunits gamma and tau; Provisi 98.99
PRK09111 598 DNA polymerase III subunits gamma and tau; Validat 98.98
PRK14950 585 DNA polymerase III subunits gamma and tau; Provisi 98.98
KOG0745|consensus 564 98.98
PRK05201 443 hslU ATP-dependent protease ATP-binding subunit Hs 98.98
PF01078 206 Mg_chelatase: Magnesium chelatase, subunit ChlI; I 98.97
TIGR02903 615 spore_lon_C ATP-dependent protease, Lon family. Me 98.97
PF14532138 Sigma54_activ_2: Sigma-54 interaction domain; PDB: 98.96
COG0542 786 clpA ATP-binding subunits of Clp protease and DnaK 98.94
PRK10865 857 protein disaggregation chaperone; Provisional 98.93
TIGR01650 327 PD_CobS cobaltochelatase, CobS subunit. This model 98.92
KOG1969|consensus 877 98.92
CHL00095 821 clpC Clp protease ATP binding subunit 98.91
PRK08451 535 DNA polymerase III subunits gamma and tau; Validat 98.89
TIGR03346 852 chaperone_ClpB ATP-dependent chaperone ClpB. Membe 98.87
PRK13531 498 regulatory ATPase RavA; Provisional 98.87
PF07728139 AAA_5: AAA domain (dynein-related subfamily); Inte 98.85
PRK14971 614 DNA polymerase III subunits gamma and tau; Provisi 98.83
PF13173128 AAA_14: AAA domain 98.82
COG2607 287 Predicted ATPase (AAA+ superfamily) [General funct 98.82
KOG0741|consensus 744 98.8
CHL00081 350 chlI Mg-protoporyphyrin IX chelatase 98.78
PRK09087 226 hypothetical protein; Validated 98.78
PF13401131 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S 98.76
COG0464 494 SpoVK ATPases of the AAA+ class [Posttranslational 98.76
PRK13407 334 bchI magnesium chelatase subunit I; Provisional 98.76
PF06068 398 TIP49: TIP49 C-terminus; InterPro: IPR010339 This 98.76
TIGR02442 633 Cob-chelat-sub cobaltochelatase subunit. A number 98.75
TIGR00602 637 rad24 checkpoint protein rad24. This family is bas 98.74
COG2812 515 DnaX DNA polymerase III, gamma/tau subunits [DNA r 98.71
PRK05564 313 DNA polymerase III subunit delta'; Validated 98.71
smart00763 361 AAA_PrkA PrkA AAA domain. This is a family of PrkA 98.7
COG0470 325 HolB ATPase involved in DNA replication [DNA repli 98.69
COG1224 450 TIP49 DNA helicase TIP49, TBP-interacting protein 98.68
PRK11331 459 5-methylcytosine-specific restriction enzyme subun 98.65
PRK07471 365 DNA polymerase III subunit delta'; Validated 98.64
COG0714 329 MoxR-like ATPases [General function prediction onl 98.62
TIGR00368 499 Mg chelatase-related protein. The N-terminal end m 98.61
PRK10923 469 glnG nitrogen regulation protein NR(I); Provisiona 98.58
PHA00729 226 NTP-binding motif containing protein 98.58
PRK09112 351 DNA polymerase III subunit delta'; Validated 98.58
KOG1051|consensus 898 98.53
TIGR02915 445 PEP_resp_reg putative PEP-CTERM system response re 98.53
cd01120165 RecA-like_NTPases RecA-like NTPases. This family i 98.53
COG0606 490 Predicted ATPase with chaperone activity [Posttran 98.52
TIGR00678188 holB DNA polymerase III, delta' subunit. At positi 98.51
PRK11361 457 acetoacetate metabolism regulatory protein AtoC; P 98.47
PRK07399 314 DNA polymerase III subunit delta'; Validated 98.44
TIGR02030 337 BchI-ChlI magnesium chelatase ATPase subunit I. Th 98.43
PRK08058 329 DNA polymerase III subunit delta'; Validated 98.43
TIGR02237209 recomb_radB DNA repair and recombination protein R 98.4
cd01129264 PulE-GspE PulE/GspE The type II secretory pathway 98.4
TIGR02688 449 conserved hypothetical protein TIGR02688. Members 98.37
COG2804 500 PulE Type II secretory pathway, ATPase PulE/Tfp pi 98.37
PF13207121 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6 98.36
PF01637 234 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 98.35
PRK15115 444 response regulator GlrR; Provisional 98.35
TIGR02782299 TrbB_P P-type conjugative transfer ATPase TrbB. Th 98.34
TIGR03015 269 pepcterm_ATPase putative secretion ATPase, PEP-CTE 98.34
PF00437270 T2SE: Type II/IV secretion system protein; InterPr 98.34
PF12774 231 AAA_6: Hydrolytic ATP binding site of dynein motor 98.34
PRK08118167 topology modulation protein; Reviewed 98.33
cd01131 198 PilT Pilus retraction ATPase PilT. PilT is a nucle 98.33
COG1618179 Predicted nucleotide kinase [Nucleotide transport 98.32
PRK07261171 topology modulation protein; Provisional 98.32
PF03215 519 Rad17: Rad17 cell cycle checkpoint protein 98.32
TIGR01420 343 pilT_fam pilus retraction protein PilT. This model 98.31
COG2805 353 PilT Tfp pilus assembly protein, pilus retraction 98.31
PF13177162 DNA_pol3_delta2: DNA polymerase III, delta subunit 98.31
COG4650 531 RtcR Sigma54-dependent transcription regulator con 98.3
TIGR00764 608 lon_rel lon-related putative ATP-dependent proteas 98.27
PF07726131 AAA_3: ATPase family associated with various cellu 98.26
PRK11823 446 DNA repair protein RadA; Provisional 98.25
cd01124 187 KaiC KaiC is a circadian clock protein primarily f 98.25
TIGR02012 321 tigrfam_recA protein RecA. This model describes or 98.25
cd01121 372 Sms Sms (bacterial radA) DNA repair protein. This 98.24
TIGR01818 463 ntrC nitrogen regulation protein NR(I). This model 98.24
TIGR02533 486 type_II_gspE general secretory pathway protein E. 98.24
PRK13900332 type IV secretion system ATPase VirB11; Provisiona 98.23
PF13191185 AAA_16: AAA ATPase domain; PDB: 2V1U_A. 98.22
COG1220 444 HslU ATP-dependent protease HslVU (ClpYQ), ATPase 98.22
PRK13833323 conjugal transfer protein TrbB; Provisional 98.21
cd00983 325 recA RecA is a bacterial enzyme which has roles in 98.21
PF05621 302 TniB: Bacterial TniB protein; InterPro: IPR008868 98.2
PRK13894319 conjugal transfer ATPase TrbB; Provisional 98.2
PRK04296190 thymidine kinase; Provisional 98.19
PRK10436 462 hypothetical protein; Provisional 98.18
TIGR02525 372 plasmid_TraJ plasmid transfer ATPase TraJ. Members 98.18
KOG2170|consensus 344 98.17
cd01130186 VirB11-like_ATPase Type IV secretory pathway compo 98.17
PF00910107 RNA_helicase: RNA helicase; InterPro: IPR000605 He 98.17
PRK08533 230 flagellar accessory protein FlaH; Reviewed 98.16
COG3854308 SpoIIIAA ncharacterized protein conserved in bacte 98.16
PF13671143 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1 98.16
KOG1970|consensus 634 98.16
KOG0990|consensus 360 98.15
PRK09361 225 radB DNA repair and recombination protein RadB; Pr 98.15
PRK15455 644 PrkA family serine protein kinase; Provisional 98.15
smart00350 509 MCM minichromosome maintenance proteins. 98.14
PF00931 287 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is 98.14
) proteins. It has been suggested that torsins play a role in effectively managing protein folding and that possible breakdown in a neuroprotective mechanism that is, in part, mediated by torsins may be responsible for the neuronal dysfunction associated with dystonia [].; GO: 0005524 ATP binding, 0051085 chaperone mediated protein folding requiring cofactor" target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=PF06309">PF06309127 Torsin: Torsin; InterPro: IPR010448 This family co 98.14
PRK00131175 aroK shikimate kinase; Reviewed 98.13
KOG1942|consensus 456 98.12
PHA02624 647 large T antigen; Provisional 98.12
KOG2227|consensus 529 98.12
PRK06067 234 flagellar accessory protein FlaH; Validated 98.12
PF03969 362 AFG1_ATPase: AFG1-like ATPase; InterPro: IPR005654 98.1
PRK13764 602 ATPase; Provisional 98.1
TIGR02538 564 type_IV_pilB type IV-A pilus assembly ATPase PilB. 98.09
PRK05707 328 DNA polymerase III subunit delta'; Validated 98.09
PRK10365 441 transcriptional regulatory protein ZraR; Provision 98.08
PF05729166 NACHT: NACHT domain 98.08
cd01128 249 rho_factor Transcription termination factor rho is 98.08
PRK13851344 type IV secretion system protein VirB11; Provision 98.07
PRK06762166 hypothetical protein; Provisional 98.07
KOG1514|consensus 767 98.07
KOG3347|consensus176 98.06
TIGR01618 220 phage_P_loop phage nucleotide-binding protein. Thi 98.05
TIGR02788308 VirB11 P-type DNA transfer ATPase VirB11. The VirB 98.05
PRK09862 506 putative ATP-dependent protease; Provisional 98.04
PF13604196 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL 98.03
COG3284 606 AcoR Transcriptional activator of acetoin/glycerol 98.03
PRK09376 416 rho transcription termination factor Rho; Provisio 98.02
PRK09354 349 recA recombinase A; Provisional 98.01
PRK03839 180 putative kinase; Provisional 98.01
TIGR02031 589 BchD-ChlD magnesium chelatase ATPase subunit D. Th 98.01
PRK13947171 shikimate kinase; Provisional 97.99
PF09848 352 DUF2075: Uncharacterized conserved protein (DUF207 97.99
PRK10536 262 hypothetical protein; Provisional 97.99
COG4619 223 ABC-type uncharacterized transport system, ATPase 97.99
TIGR00416 454 sms DNA repair protein RadA. The gene protuct code 97.98
cd00046144 DEXDc DEAD-like helicases superfamily. A diverse f 97.97
PRK00625173 shikimate kinase; Provisional 97.96
PRK06217 183 hypothetical protein; Validated 97.95
TIGR03877 237 thermo_KaiC_1 KaiC domain protein, Ph0284 family. 97.95
cd03283199 ABC_MutS-like MutS-like homolog in eukaryotes. The 97.95
PRK06871 325 DNA polymerase III subunit delta'; Validated 97.95
PHA02774 613 E1; Provisional 97.94
cd00464154 SK Shikimate kinase (SK) is the fifth enzyme in th 97.94
TIGR02858270 spore_III_AA stage III sporulation protein AA. Mem 97.93
TIGR01359 183 UMP_CMP_kin_fam UMP-CMP kinase family. This subfam 97.91
TIGR03499282 FlhF flagellar biosynthetic protein FlhF. 97.91
cd01394 218 radB RadB. The archaeal protein radB shares simila 97.9
PRK14532 188 adenylate kinase; Provisional 97.9
PF12775 272 AAA_7: P-loop containing dynein motor region D3; P 97.89
COG0563 178 Adk Adenylate kinase and related kinases [Nucleoti 97.88
PRK07993 334 DNA polymerase III subunit delta'; Validated 97.88
PLN03210 1153 Resistant to P. syringae 6; Provisional 97.88
PRK13949169 shikimate kinase; Provisional 97.87
cd00227175 CPT Chloramphenicol (Cm) phosphotransferase (CPT). 97.87
TIGR02524 358 dot_icm_DotB Dot/Icm secretion system ATPase DotB. 97.86
PRK00771 437 signal recognition particle protein Srp54; Provisi 97.86
cd02021150 GntK Gluconate kinase (GntK) catalyzes the phospho 97.86
cd03221144 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is 97.86
PRK14974336 cell division protein FtsY; Provisional 97.85
PF01745 233 IPT: Isopentenyl transferase; InterPro: IPR002648 97.85
TIGR01313163 therm_gnt_kin carbohydrate kinase, thermoresistant 97.85
PRK13765 637 ATP-dependent protease Lon; Provisional 97.85
PRK12723 388 flagellar biosynthesis regulator FlhF; Provisional 97.84
PRK14530 215 adenylate kinase; Provisional 97.84
PRK14531 183 adenylate kinase; Provisional 97.84
COG1066 456 Sms Predicted ATP-dependent serine protease [Postt 97.82
cd01428 194 ADK Adenylate kinase (ADK) catalyzes the reversibl 97.82
PRK04132 846 replication factor C small subunit; Provisional 97.82
PRK13948182 shikimate kinase; Provisional 97.82
TIGR03574 249 selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal. Mem 97.81
cd02020147 CMPK Cytidine monophosphate kinase (CMPK) catalyze 97.8
PF08433 270 KTI12: Chromatin associated protein KTI12 ; InterP 97.8
PRK06547172 hypothetical protein; Provisional 97.79
PF00448196 SRP54: SRP54-type protein, GTPase domain; InterPro 97.79
PRK11889436 flhF flagellar biosynthesis regulator FlhF; Provis 97.79
PLN02674 244 adenylate kinase 97.79
COG0703172 AroK Shikimate kinase [Amino acid transport and me 97.79
TIGR03878 259 thermo_KaiC_2 KaiC domain protein, AF_0795 family. 97.78
COG1373 398 Predicted ATPase (AAA+ superfamily) [General funct 97.78
cd00561159 CobA_CobO_BtuR ATP:corrinoid adenosyltransferase B 97.78
TIGR00767 415 rho transcription termination factor Rho. Members 97.77
PRK04328 249 hypothetical protein; Provisional 97.77
PTZ00111 915 DNA replication licensing factor MCM4; Provisional 97.76
PRK05057172 aroK shikimate kinase I; Reviewed 97.76
PTZ00088 229 adenylate kinase 1; Provisional 97.76
TIGR00064272 ftsY signal recognition particle-docking protein F 97.75
cd01123 235 Rad51_DMC1_radA Rad51_DMC1_radA,B. This group of r 97.75
COG1102 179 Cmk Cytidylate kinase [Nucleotide transport and me 97.74
cd03216163 ABC_Carb_Monos_I This family represents the domain 97.74
cd03281 213 ABC_MSH5_euk MutS5 homolog in eukaryotes. The MutS 97.73
PRK03731171 aroL shikimate kinase II; Reviewed 97.73
TIGR02655 484 circ_KaiC circadian clock protein KaiC. Members of 97.73
cd01393 226 recA_like RecA is a bacterial enzyme which has rol 97.72
PF01583156 APS_kinase: Adenylylsulphate kinase; InterPro: IPR 97.72
cd03222177 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibi 97.72
cd00544169 CobU Adenosylcobinamide kinase / adenosylcobinamid 97.72
PRK14722 374 flhF flagellar biosynthesis regulator FlhF; Provis 97.72
TIGR03881 229 KaiC_arch_4 KaiC domain protein, PAE1156 family. M 97.72
TIGR00150133 HI0065_YjeE ATPase, YjeE family. Members of this f 97.71
PRK13946184 shikimate kinase; Provisional 97.71
TIGR03819340 heli_sec_ATPase helicase/secretion neighborhood AT 97.71
PLN02200 234 adenylate kinase family protein 97.7
PF1324576 AAA_19: Part of AAA domain 97.7
PRK14528 186 adenylate kinase; Provisional 97.7
PRK08154309 anaerobic benzoate catabolism transcriptional regu 97.7
PRK08699 325 DNA polymerase III subunit delta'; Validated 97.69
PRK08769 319 DNA polymerase III subunit delta'; Validated 97.69
PF13479 213 AAA_24: AAA domain 97.69
TIGR01360 188 aden_kin_iso1 adenylate kinase, isozyme 1 subfamil 97.68
cd0201969 NK Nucleoside/nucleotide kinase (NK) is a protein 97.68
COG4962355 CpaF Flp pilus assembly protein, ATPase CpaF [Intr 97.68
PF13238129 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB 97.67
TIGR01351 210 adk adenylate kinases. Adenylate kinase (EC 2.7.4. 97.67
COG1936 180 Predicted nucleotide kinase (related to CMP and AM 97.67
cd03115173 SRP The signal recognition particle (SRP) mediates 97.67
PRK02496 184 adk adenylate kinase; Provisional 97.67
PRK06696 223 uridine kinase; Validated 97.66
PRK14527 191 adenylate kinase; Provisional 97.66
PF01443 234 Viral_helicase1: Viral (Superfamily 1) RNA helicas 97.66
PRK06090 319 DNA polymerase III subunit delta'; Validated 97.64
PRK00279 215 adk adenylate kinase; Reviewed 97.63
cd03243202 ABC_MutS_homologs The MutS protein initiates DNA m 97.63
PRK05800170 cobU adenosylcobinamide kinase/adenosylcobinamide- 97.63
COG1485 367 Predicted ATPase [General function prediction only 97.62
PF06414 199 Zeta_toxin: Zeta toxin; InterPro: IPR010488 This e 97.62
smart00534 185 MUTSac ATPase domain of DNA mismatch repair MUTS f 97.62
TIGR02768 744 TraA_Ti Ti-type conjugative transfer relaxase TraA 97.61
PHA02530 300 pseT polynucleotide kinase; Provisional 97.61
PF13086 236 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV 97.61
PF08298 358 AAA_PrkA: PrkA AAA domain; InterPro: IPR013153 Thi 97.61
PRK12724 432 flagellar biosynthesis regulator FlhF; Provisional 97.61
PRK10416 318 signal recognition particle-docking protein FtsY; 97.6
cd00267157 ABC_ATPase ABC (ATP-binding cassette) transporter 97.59
PRK04040 188 adenylate kinase; Provisional 97.59
PRK08233 182 hypothetical protein; Provisional 97.59
cd03280200 ABC_MutS2 MutS2 homologs in bacteria and eukaryote 97.58
PF05970 364 PIF1: PIF1-like helicase; InterPro: IPR010285 This 97.58
TIGR01526325 nadR_NMN_Atrans nicotinamide-nucleotide adenylyltr 97.58
TIGR01448 720 recD_rel helicase, putative, RecD/TraA family. Thi 97.58
cd02027149 APSK Adenosine 5'-phosphosulfate kinase (APSK) cat 97.57
cd03238176 ABC_UvrA The excision repair protein UvrA; Nucleot 97.57
COG0467 260 RAD55 RecA-superfamily ATPases implicated in signa 97.55
PRK12726 407 flagellar biosynthesis regulator FlhF; Provisional 97.55
PF14516 331 AAA_35: AAA-like domain 97.55
PRK08099 399 bifunctional DNA-binding transcriptional repressor 97.54
COG5008 375 PilU Tfp pilus assembly protein, ATPase PilU [Cell 97.54
PRK05541176 adenylylsulfate kinase; Provisional 97.54
PF13521163 AAA_28: AAA domain; PDB: 1LW7_A. 97.54
PRK14526 211 adenylate kinase; Provisional 97.53
PRK05973237 replicative DNA helicase; Provisional 97.53
PRK04182 180 cytidylate kinase; Provisional 97.53
cd03228171 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein 97.52
COG0529197 CysC Adenylylsulfate kinase and related kinases [I 97.51
KOG2680|consensus 454 97.51
TIGR02173171 cyt_kin_arch cytidylate kinase, putative. Proteins 97.51
PF00406151 ADK: Adenylate kinase; InterPro: IPR000850 Adenyla 97.5
PF05707193 Zot: Zonular occludens toxin (Zot); InterPro: IPR0 97.5
PRK09519 790 recA DNA recombination protein RecA; Reviewed 97.49
PRK12608 380 transcription termination factor Rho; Provisional 97.48
PRK10078 186 ribose 1,5-bisphosphokinase; Provisional 97.47
PF06745 226 KaiC: KaiC; InterPro: IPR014774 This entry represe 97.47
COG1855 604 ATPase (PilT family) [General function prediction 97.47
PRK06964 342 DNA polymerase III subunit delta'; Validated 97.47
PRK01184 184 hypothetical protein; Provisional 97.46
PRK14529 223 adenylate kinase; Provisional 97.45
KOG2035|consensus 351 97.44
TIGR01425 429 SRP54_euk signal recognition particle protein SRP5 97.44
TIGR02238 313 recomb_DMC1 meiotic recombinase Dmc1. This model d 97.43
COG0630312 VirB11 Type IV secretory pathway, VirB11 component 97.43
cd03247178 ABCC_cytochrome_bd The CYD subfamily implicated in 97.42
PRK10867 433 signal recognition particle protein; Provisional 97.42
cd03223166 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cass 97.41
PRK05703 424 flhF flagellar biosynthesis regulator FlhF; Valida 97.41
PRK05986191 cob(I)alamin adenolsyltransferase/cobinamide ATP-d 97.41
PRK00889175 adenylylsulfate kinase; Provisional 97.4
KOG1051|consensus 898 97.4
cd03246173 ABCC_Protease_Secretion This family represents the 97.39
PF03266168 NTPase_1: NTPase; InterPro: IPR004948 This entry r 97.38
PLN02199 303 shikimate kinase 97.38
PRK14730 195 coaE dephospho-CoA kinase; Provisional 97.38
TIGR02655 484 circ_KaiC circadian clock protein KaiC. Members of 97.38
cd03227162 ABC_Class2 ABC-type Class 2 contains systems invol 97.38
TIGR02322 179 phosphon_PhnN phosphonate metabolism protein/1,5-b 97.36
TIGR00708173 cobA cob(I)alamin adenosyltransferase. Alternate n 97.36
COG0194 191 Gmk Guanylate kinase [Nucleotide transport and met 97.34
PRK05480 209 uridine/cytidine kinase; Provisional 97.34
TIGR00959 428 ffh signal recognition particle protein. This mode 97.34
PLN02459 261 probable adenylate kinase 97.33
PRK12339 197 2-phosphoglycerate kinase; Provisional 97.33
PF12780 268 AAA_8: P-loop containing dynein motor region D4; I 97.33
PRK12338 319 hypothetical protein; Provisional 97.32
cd03214180 ABC_Iron-Siderophores_B12_Hemin ABC transporters, 97.32
PF02367123 UPF0079: Uncharacterised P-loop hydrolase UPF0079; 97.31
PRK00091 307 miaA tRNA delta(2)-isopentenylpyrophosphate transf 97.31
cd02028179 UMPK_like Uridine monophosphate kinase_like (UMPK_ 97.31
cd03287 222 ABC_MSH3_euk MutS3 homolog in eukaryotes. The MutS 97.31
TIGR03880 224 KaiC_arch_3 KaiC domain protein, AF_0351 family. T 97.3
PLN02165 334 adenylate isopentenyltransferase 97.3
PRK05917 290 DNA polymerase III subunit delta'; Validated 97.29
PTZ00293 211 thymidine kinase; Provisional 97.29
PF00485 194 PRK: Phosphoribulokinase / Uridine kinase family; 97.29
cd02024 187 NRK1 Nicotinamide riboside kinase (NRK) is an enzy 97.29
KOG2543|consensus 438 97.28
PTZ00202 550 tuzin; Provisional 97.28
cd03282204 ABC_MSH4_euk MutS4 homolog in eukaryotes. The MutS 97.28
TIGR00376 637 DNA helicase, putative. The gene product may repre 97.27
COG5271 4600 MDN1 AAA ATPase containing von Willebrand factor t 97.26
COG1127 263 Ttg2A ABC-type transport system involved in resist 97.26
cd00071137 GMPK Guanosine monophosphate kinase (GMPK, EC 2.7. 97.26
PLN03187 344 meiotic recombination protein DMC1 homolog; Provis 97.26
PF00154 322 RecA: recA bacterial DNA recombination protein; In 97.25
cd00984 242 DnaB_C DnaB helicase C terminal domain. The hexame 97.25
TIGR02236 310 recomb_radA DNA repair and recombination protein R 97.25
COG4088 261 Predicted nucleotide kinase [Nucleotide transport 97.24
PRK09825176 idnK D-gluconate kinase; Provisional 97.24
cd03285 222 ABC_MSH2_euk MutS2 homolog in eukaryotes. The MutS 97.24
cd02022 179 DPCK Dephospho-coenzyme A kinase (DPCK, EC 2.7.1.2 97.23
PRK00300 205 gmk guanylate kinase; Provisional 97.23
TIGR00174 287 miaA tRNA isopentenyltransferase (miaA). Catalyzes 97.23
smart00487201 DEXDc DEAD-like helicases superfamily. 97.22
cd02023 198 UMPK Uridine monophosphate kinase (UMPK, EC 2.7.1. 97.21
PRK09302 509 circadian clock protein KaiC; Reviewed 97.2
PF1355562 AAA_29: P-loop containing region of AAA domain 97.2
PRK14737 186 gmk guanylate kinase; Provisional 97.2
PRK10646153 ADP-binding protein; Provisional 97.19
PRK10463290 hydrogenase nickel incorporation protein HypB; Pro 97.19
PF04665 241 Pox_A32: Poxvirus A32 protein; InterPro: IPR006758 97.18
COG0552 340 FtsY Signal recognition particle GTPase [Intracell 97.18
PRK13889 988 conjugal transfer relaxase TraA; Provisional 97.18
TIGR03263 180 guanyl_kin guanylate kinase. Members of this famil 97.17
COG3842 352 PotA ABC-type spermidine/putrescine transport syst 97.17
TIGR00750 300 lao LAO/AO transport system ATPase. Mutations have 97.16
PRK13808 333 adenylate kinase; Provisional 97.16
PF13481193 AAA_25: AAA domain; PDB: 1G8Y_J 1OLO_A 1NLF_C. 97.16
PF02456 369 Adeno_IVa2: Adenovirus IVa2 protein; InterPro: IPR 97.16
PRK04301 317 radA DNA repair and recombination protein RadA; Va 97.15
cd01878204 HflX HflX subfamily. A distinct conserved domain w 97.15
cd00820107 PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPC 97.14
TIGR00235 207 udk uridine kinase. Model contains a number of lon 97.14
PRK06761 282 hypothetical protein; Provisional 97.14
KOG0058|consensus 716 97.14
PRK07667193 uridine kinase; Provisional 97.14
>COG1222 RPT1 ATP-dependent 26S proteasome regulatory subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
Probab=99.97  E-value=5.8e-31  Score=211.35  Aligned_cols=124  Identities=52%  Similarity=0.899  Sum_probs=118.4

Q ss_pred             chhHHhhcCCCCcccccCcHHHHHHHHHHHHhcccChhhHhhhCCCCCCceEEECCCCCcHHHHHHHHHHHhCCeEEEEe
Q psy6208          73 REEEEEASNAVGYDDIGGCRKQLAQIKEMVELPLRHPSLFKAIGVKPPRGILLYGPPGTGKTLIARAVANETGAFFFLIN  152 (197)
Q Consensus        73 ~~~~~~~~~~~~~~~i~g~~~~~~~l~~~v~~~~~~~~~~~~~~~~~~~~ill~G~~GtGKT~la~ala~~~~~~~~~v~  152 (197)
                      ..+..+..|.++|+||||++++++++++.++.|+.+|+.|+.+|+.+|+|+|||||||||||.||+|+|++.++.|+.+.
T Consensus       138 ~~M~v~e~PdvtY~dIGGL~~Qi~EirE~VELPL~~PElF~~~GI~PPKGVLLYGPPGTGKTLLAkAVA~~T~AtFIrvv  217 (406)
T COG1222         138 SVMEVEEKPDVTYEDIGGLDEQIQEIREVVELPLKNPELFEELGIDPPKGVLLYGPPGTGKTLLAKAVANQTDATFIRVV  217 (406)
T ss_pred             heeeeccCCCCChhhccCHHHHHHHHHHHhcccccCHHHHHHcCCCCCCceEeeCCCCCcHHHHHHHHHhccCceEEEec
Confidence            34455667899999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             chhhhhhccCccHHHHHHHHHHHhcCCCeEEEEcccCccCcccC
Q psy6208         153 GPEIMSKLAGESESNLRKAFEEADKNSPSIIFIDELDAIAPKRE  196 (197)
Q Consensus       153 ~~~~~~~~~~~~~~~~~~~~~~a~~~~~~vl~lDeid~l~~~r~  196 (197)
                      ++++..+|+|+....++++|+.|+..+||||||||||++..+|-
T Consensus       218 gSElVqKYiGEGaRlVRelF~lArekaPsIIFiDEIDAIg~kR~  261 (406)
T COG1222         218 GSELVQKYIGEGARLVRELFELAREKAPSIIFIDEIDAIGAKRF  261 (406)
T ss_pred             cHHHHHHHhccchHHHHHHHHHHhhcCCeEEEEechhhhhcccc
Confidence            99999999999999999999999999999999999999999883



>KOG0733|consensus Back     alignment and domain information
>COG1223 Predicted ATPase (AAA+ superfamily) [General function prediction only] Back     alignment and domain information
>KOG0730|consensus Back     alignment and domain information
>KOG0736|consensus Back     alignment and domain information
>KOG0733|consensus Back     alignment and domain information
>KOG0727|consensus Back     alignment and domain information
>KOG0739|consensus Back     alignment and domain information
>KOG0738|consensus Back     alignment and domain information
>KOG0652|consensus Back     alignment and domain information
>KOG0728|consensus Back     alignment and domain information
>KOG0726|consensus Back     alignment and domain information
>TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily Back     alignment and domain information
>KOG0729|consensus Back     alignment and domain information
>KOG0735|consensus Back     alignment and domain information
>KOG0734|consensus Back     alignment and domain information
>PTZ00454 26S protease regulatory subunit 6B-like protein; Provisional Back     alignment and domain information
>PRK03992 proteasome-activating nucleotidase; Provisional Back     alignment and domain information
>KOG0731|consensus Back     alignment and domain information
>KOG0730|consensus Back     alignment and domain information
>COG0464 SpoVK ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PTZ00361 26 proteosome regulatory subunit 4-like protein; Provisional Back     alignment and domain information
>TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily Back     alignment and domain information
>KOG0737|consensus Back     alignment and domain information
>KOG0651|consensus Back     alignment and domain information
>TIGR03689 pup_AAA proteasome ATPase Back     alignment and domain information
>TIGR01242 26Sp45 26S proteasome subunit P45 family Back     alignment and domain information
>TIGR01241 FtsH_fam ATP-dependent metalloprotease FtsH Back     alignment and domain information
>CHL00195 ycf46 Ycf46; Provisional Back     alignment and domain information
>COG0465 HflB ATP-dependent Zn proteases [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>CHL00176 ftsH cell division protein; Validated Back     alignment and domain information
>KOG0740|consensus Back     alignment and domain information
>PLN00020 ribulose bisphosphate carboxylase/oxygenase activase -RuBisCO activase (RCA); Provisional Back     alignment and domain information
>KOG0732|consensus Back     alignment and domain information
>KOG0741|consensus Back     alignment and domain information
>PF05496 RuvB_N: Holliday junction DNA helicase ruvB N-terminus; InterPro: IPR008824 The RuvB protein makes up part of the RuvABC revolvasome which catalyses the resolution of Holliday junctions that arise during genetic recombination and DNA repair Back     alignment and domain information
>PRK10733 hflB ATP-dependent metalloprotease; Reviewed Back     alignment and domain information
>PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport Back     alignment and domain information
>TIGR02881 spore_V_K stage V sporulation protein K Back     alignment and domain information
>CHL00206 ycf2 Ycf2; Provisional Back     alignment and domain information
>TIGR02880 cbbX_cfxQ probable Rubsico expression protein CbbX Back     alignment and domain information
>CHL00181 cbbX CbbX; Provisional Back     alignment and domain information
>PRK00149 dnaA chromosomal replication initiation protein; Reviewed Back     alignment and domain information
>TIGR00362 DnaA chromosomal replication initiator protein DnaA Back     alignment and domain information
>PRK14088 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>COG2255 RuvB Holliday junction resolvasome, helicase subunit [DNA replication, recombination, and repair] Back     alignment and domain information
>COG2256 MGS1 ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0744|consensus Back     alignment and domain information
>PRK12422 chromosomal replication initiation protein; Provisional Back     alignment and domain information
>TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA Back     alignment and domain information
>COG0593 DnaA ATPase involved in DNA replication initiation [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0743|consensus Back     alignment and domain information
>KOG0736|consensus Back     alignment and domain information
>CHL00095 clpC Clp protease ATP binding subunit Back     alignment and domain information
>PRK14087 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PRK00080 ruvB Holliday junction DNA helicase RuvB; Reviewed Back     alignment and domain information
>PRK04195 replication factor C large subunit; Provisional Back     alignment and domain information
>PRK05342 clpX ATP-dependent protease ATP-binding subunit ClpX; Provisional Back     alignment and domain information
>PF00308 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013317 This entry represents the central domain of bacterial DnaA proteins [, , ] that play an important role in initiating and regulating chromosomal replication Back     alignment and domain information
>TIGR00635 ruvB Holliday junction DNA helicase, RuvB subunit Back     alignment and domain information
>COG3829 RocR Transcriptional regulator containing PAS, AAA-type ATPase, and DNA-binding domains [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>TIGR00763 lon ATP-dependent protease La Back     alignment and domain information
>PRK10865 protein disaggregation chaperone; Provisional Back     alignment and domain information
>PRK13342 recombination factor protein RarA; Reviewed Back     alignment and domain information
>PLN03025 replication factor C subunit; Provisional Back     alignment and domain information
>PF00158 Sigma54_activat: Sigma-54 interaction domain; InterPro: IPR002078 Some bacterial regulatory proteins activate the expression of genes from promoters recognised by core RNA polymerase associated with the alternative sigma-54 factor Back     alignment and domain information
>TIGR00382 clpX endopeptidase Clp ATP-binding regulatory subunit (clpX) Back     alignment and domain information
>PRK14086 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>KOG2028|consensus Back     alignment and domain information
>PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB Back     alignment and domain information
>PRK14956 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PHA02544 44 clamp loader, small subunit; Provisional Back     alignment and domain information
>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold Back     alignment and domain information
>PRK14962 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14958 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK12402 replication factor C small subunit 2; Reviewed Back     alignment and domain information
>TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family Back     alignment and domain information
>PRK12323 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda Back     alignment and domain information
>PRK08903 DnaA regulatory inactivator Hda; Validated Back     alignment and domain information
>PRK14960 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK12377 putative replication protein; Provisional Back     alignment and domain information
>COG3283 TyrR Transcriptional regulator of aromatic amino acids metabolism [Transcription / Amino acid transport and metabolism] Back     alignment and domain information
>PRK13341 recombination factor protein RarA/unknown domain fusion protein; Reviewed Back     alignment and domain information
>KOG0989|consensus Back     alignment and domain information
>PRK08727 hypothetical protein; Validated Back     alignment and domain information
>PRK10820 DNA-binding transcriptional regulator TyrR; Provisional Back     alignment and domain information
>PRK08084 DNA replication initiation factor; Provisional Back     alignment and domain information
>PRK07003 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>TIGR02928 orc1/cdc6 family replication initiation protein Back     alignment and domain information
>PRK14961 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>COG0466 Lon ATP-dependent Lon protease, bacterial type [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14949 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>smart00382 AAA ATPases associated with a variety of cellular activities Back     alignment and domain information
>PRK14964 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>COG1484 DnaC DNA replication protein [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK00411 cdc6 cell division control protein 6; Reviewed Back     alignment and domain information
>PRK07952 DNA replication protein DnaC; Validated Back     alignment and domain information
>PRK07994 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK06893 DNA replication initiation factor; Validated Back     alignment and domain information
>COG3604 FhlA Transcriptional regulator containing GAF, AAA-type ATPase, and DNA binding domains [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>PRK08181 transposase; Validated Back     alignment and domain information
>PRK06645 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14963 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK05642 DNA replication initiation factor; Validated Back     alignment and domain information
>KOG0742|consensus Back     alignment and domain information
>PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14951 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK15424 propionate catabolism operon regulatory protein PrpR; Provisional Back     alignment and domain information
>PRK08691 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>KOG0735|consensus Back     alignment and domain information
>PRK14969 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR02329 propionate_PrpR propionate catabolism operon regulatory protein PrpR Back     alignment and domain information
>PF05673 DUF815: Protein of unknown function (DUF815); InterPro: IPR008533 This domain consists of several bacterial proteins of unknown function Back     alignment and domain information
>PRK14957 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR02902 spore_lonB ATP-dependent protease LonB Back     alignment and domain information
>PRK14955 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>KOG0991|consensus Back     alignment and domain information
>PRK08939 primosomal protein DnaI; Reviewed Back     alignment and domain information
>COG2204 AtoC Response regulator containing CheY-like receiver, AAA-type ATPase, and DNA-binding domains [Signal transduction mechanisms] Back     alignment and domain information
>PRK07940 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK14952 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK10787 DNA-binding ATP-dependent protease La; Provisional Back     alignment and domain information
>KOG2004|consensus Back     alignment and domain information
>PRK06835 DNA replication protein DnaC; Validated Back     alignment and domain information
>TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA Back     alignment and domain information
>COG1219 ClpX ATP-dependent protease Clp, ATPase subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14959 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14970 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PF01695 IstB_IS21: IstB-like ATP binding protein; InterPro: IPR002611 Proteins in this entry contain an ATP/GTP binding P-loop motif Back     alignment and domain information
>TIGR01817 nifA Nif-specific regulatory protein Back     alignment and domain information
>PRK05896 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>TIGR02640 gas_vesic_GvpN gas vesicle protein GvpN Back     alignment and domain information
>PTZ00112 origin recognition complex 1 protein; Provisional Back     alignment and domain information
>TIGR02974 phageshock_pspF psp operon transcriptional activator PspF Back     alignment and domain information
>PRK07764 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK06526 transposase; Provisional Back     alignment and domain information
>COG0542 clpA ATP-binding subunits of Clp protease and DnaK/DnaJ chaperones [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK11608 pspF phage shock protein operon transcriptional activator; Provisional Back     alignment and domain information
>TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family Back     alignment and domain information
>PRK14965 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK08116 hypothetical protein; Validated Back     alignment and domain information
>PRK05563 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>COG1221 PspF Transcriptional regulators containing an AAA-type ATPase domain and a DNA-binding domain [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>TIGR02397 dnaX_nterm DNA polymerase III, subunit gamma and tau Back     alignment and domain information
>PRK00440 rfc replication factor C small subunit; Reviewed Back     alignment and domain information
>PHA02244 ATPase-like protein Back     alignment and domain information
>PRK14954 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>COG1474 CDC6 Cdc6-related protein, AAA superfamily ATPase [DNA replication, recombination, and repair / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK15429 formate hydrogenlyase transcriptional activator FhlA; Provisional Back     alignment and domain information
>PRK14948 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK06620 hypothetical protein; Validated Back     alignment and domain information
>PRK06647 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>TIGR00390 hslU ATP-dependent protease HslVU, ATPase subunit Back     alignment and domain information
>PRK05022 anaerobic nitric oxide reductase transcription regulator; Provisional Back     alignment and domain information
>PF07724 AAA_2: AAA domain (Cdc48 subfamily); InterPro: IPR013093 ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] Back     alignment and domain information
>PRK11388 DNA-binding transcriptional regulator DhaR; Provisional Back     alignment and domain information
>PRK06305 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK06921 hypothetical protein; Provisional Back     alignment and domain information
>PRK07133 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK09183 transposase/IS protein; Provisional Back     alignment and domain information
>PRK14953 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK09111 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14950 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>KOG0745|consensus Back     alignment and domain information
>PRK05201 hslU ATP-dependent protease ATP-binding subunit HslU; Provisional Back     alignment and domain information
>PF01078 Mg_chelatase: Magnesium chelatase, subunit ChlI; InterPro: IPR000523 Magnesium-chelatase is a three-component enzyme that catalyses the insertion of Mg2+ into protoporphyrin IX Back     alignment and domain information
>TIGR02903 spore_lon_C ATP-dependent protease, Lon family Back     alignment and domain information
>PF14532 Sigma54_activ_2: Sigma-54 interaction domain; PDB: 3CO5_B 3N70_H Back     alignment and domain information
>COG0542 clpA ATP-binding subunits of Clp protease and DnaK/DnaJ chaperones [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK10865 protein disaggregation chaperone; Provisional Back     alignment and domain information
>TIGR01650 PD_CobS cobaltochelatase, CobS subunit Back     alignment and domain information
>KOG1969|consensus Back     alignment and domain information
>CHL00095 clpC Clp protease ATP binding subunit Back     alignment and domain information
>PRK08451 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB Back     alignment and domain information
>PRK13531 regulatory ATPase RavA; Provisional Back     alignment and domain information
>PF07728 AAA_5: AAA domain (dynein-related subfamily); InterPro: IPR011704 The ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] Back     alignment and domain information
>PRK14971 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PF13173 AAA_14: AAA domain Back     alignment and domain information
>COG2607 Predicted ATPase (AAA+ superfamily) [General function prediction only] Back     alignment and domain information
>KOG0741|consensus Back     alignment and domain information
>CHL00081 chlI Mg-protoporyphyrin IX chelatase Back     alignment and domain information
>PRK09087 hypothetical protein; Validated Back     alignment and domain information
>PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B Back     alignment and domain information
>COG0464 SpoVK ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK13407 bchI magnesium chelatase subunit I; Provisional Back     alignment and domain information
>PF06068 TIP49: TIP49 C-terminus; InterPro: IPR010339 This family consists of the C-terminal region of several eukaryotic and archaeal RuvB-like 1 (Pontin or TIP49a) and RuvB-like 2 (Reptin or TIP49b) proteins Back     alignment and domain information
>TIGR02442 Cob-chelat-sub cobaltochelatase subunit Back     alignment and domain information
>TIGR00602 rad24 checkpoint protein rad24 Back     alignment and domain information
>COG2812 DnaX DNA polymerase III, gamma/tau subunits [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK05564 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>smart00763 AAA_PrkA PrkA AAA domain Back     alignment and domain information
>COG0470 HolB ATPase involved in DNA replication [DNA replication, recombination, and repair] Back     alignment and domain information
>COG1224 TIP49 DNA helicase TIP49, TBP-interacting protein [Transcription] Back     alignment and domain information
>PRK11331 5-methylcytosine-specific restriction enzyme subunit McrB; Provisional Back     alignment and domain information
>PRK07471 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>COG0714 MoxR-like ATPases [General function prediction only] Back     alignment and domain information
>TIGR00368 Mg chelatase-related protein Back     alignment and domain information
>PRK10923 glnG nitrogen regulation protein NR(I); Provisional Back     alignment and domain information
>PHA00729 NTP-binding motif containing protein Back     alignment and domain information
>PRK09112 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>KOG1051|consensus Back     alignment and domain information
>TIGR02915 PEP_resp_reg putative PEP-CTERM system response regulator Back     alignment and domain information
>cd01120 RecA-like_NTPases RecA-like NTPases Back     alignment and domain information
>COG0606 Predicted ATPase with chaperone activity [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00678 holB DNA polymerase III, delta' subunit Back     alignment and domain information
>PRK11361 acetoacetate metabolism regulatory protein AtoC; Provisional Back     alignment and domain information
>PRK07399 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>TIGR02030 BchI-ChlI magnesium chelatase ATPase subunit I Back     alignment and domain information
>PRK08058 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>TIGR02237 recomb_radB DNA repair and recombination protein RadB Back     alignment and domain information
>cd01129 PulE-GspE PulE/GspE The type II secretory pathway is the main terminal branch of the general secretory pathway (GSP) Back     alignment and domain information
>TIGR02688 conserved hypothetical protein TIGR02688 Back     alignment and domain information
>COG2804 PulE Type II secretory pathway, ATPase PulE/Tfp pilus assembly pathway, ATPase PilB [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>PF13207 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6_G 2QT1_A 2QSZ_A 2QSY_A 2QT0_A 2QG6_A 2P0E_A Back     alignment and domain information
>PF01637 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 This domain has been found in a number of bacterial and archaeal proteins, all of which contain a conserved P-loop motif that is involved in binding ATP Back     alignment and domain information
>PRK15115 response regulator GlrR; Provisional Back     alignment and domain information
>TIGR02782 TrbB_P P-type conjugative transfer ATPase TrbB Back     alignment and domain information
>TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily Back     alignment and domain information
>PF00437 T2SE: Type II/IV secretion system protein; InterPro: IPR001482 A number of bacterial proteins, some of which are involved in a general secretion pathway (GSP) for the export of proteins (also called the type II pathway) belong to this group [, ] Back     alignment and domain information
>PF12774 AAA_6: Hydrolytic ATP binding site of dynein motor region D1; PDB: 3VKH_A 3VKG_A 4AKI_A 4AI6_B 4AKH_A 4AKG_A 3QMZ_A Back     alignment and domain information
>PRK08118 topology modulation protein; Reviewed Back     alignment and domain information
>cd01131 PilT Pilus retraction ATPase PilT Back     alignment and domain information
>COG1618 Predicted nucleotide kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK07261 topology modulation protein; Provisional Back     alignment and domain information
>PF03215 Rad17: Rad17 cell cycle checkpoint protein Back     alignment and domain information
>TIGR01420 pilT_fam pilus retraction protein PilT Back     alignment and domain information
>COG2805 PilT Tfp pilus assembly protein, pilus retraction ATPase PilT [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>PF13177 DNA_pol3_delta2: DNA polymerase III, delta subunit; PDB: 1NJF_B 3GLG_G 1XXH_I 1NJG_A 3GLF_B 3GLI_G 1IQP_E 2GNO_A 1SXJ_E 1A5T_A Back     alignment and domain information
>COG4650 RtcR Sigma54-dependent transcription regulator containing an AAA-type ATPase domain and a DNA-binding domain [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>TIGR00764 lon_rel lon-related putative ATP-dependent protease Back     alignment and domain information
>PF07726 AAA_3: ATPase family associated with various cellular activities (AAA); InterPro: IPR011703 This entry includes some of the AAA proteins not detected by the IPR003959 from INTERPRO model Back     alignment and domain information
>PRK11823 DNA repair protein RadA; Provisional Back     alignment and domain information
>cd01124 KaiC KaiC is a circadian clock protein primarily found in cyanobacteria KaiC is a RecA-like ATPase, having both Walker A and Walker B motifs Back     alignment and domain information
>TIGR02012 tigrfam_recA protein RecA Back     alignment and domain information
>cd01121 Sms Sms (bacterial radA) DNA repair protein Back     alignment and domain information
>TIGR01818 ntrC nitrogen regulation protein NR(I) Back     alignment and domain information
>TIGR02533 type_II_gspE general secretory pathway protein E Back     alignment and domain information
>PRK13900 type IV secretion system ATPase VirB11; Provisional Back     alignment and domain information
>PF13191 AAA_16: AAA ATPase domain; PDB: 2V1U_A Back     alignment and domain information
>COG1220 HslU ATP-dependent protease HslVU (ClpYQ), ATPase subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK13833 conjugal transfer protein TrbB; Provisional Back     alignment and domain information
>cd00983 recA RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response Back     alignment and domain information
>PF05621 TniB: Bacterial TniB protein; InterPro: IPR008868 This family consists of several bacterial TniB NTP-binding proteins Back     alignment and domain information
>PRK13894 conjugal transfer ATPase TrbB; Provisional Back     alignment and domain information
>PRK04296 thymidine kinase; Provisional Back     alignment and domain information
>PRK10436 hypothetical protein; Provisional Back     alignment and domain information
>TIGR02525 plasmid_TraJ plasmid transfer ATPase TraJ Back     alignment and domain information
>KOG2170|consensus Back     alignment and domain information
>cd01130 VirB11-like_ATPase Type IV secretory pathway component VirB11, and related ATPases Back     alignment and domain information
>PF00910 RNA_helicase: RNA helicase; InterPro: IPR000605 Helicases have been classified in 5 superfamilies (SF1-SF5) Back     alignment and domain information
>PRK08533 flagellar accessory protein FlaH; Reviewed Back     alignment and domain information
>COG3854 SpoIIIAA ncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF13671 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1_A 1RRC_A 1RPZ_A 3ZVM_A 1YJ5_A 3ZVL_A 3U7E_B Back     alignment and domain information
>KOG1970|consensus Back     alignment and domain information
>KOG0990|consensus Back     alignment and domain information
>PRK09361 radB DNA repair and recombination protein RadB; Provisional Back     alignment and domain information
>PRK15455 PrkA family serine protein kinase; Provisional Back     alignment and domain information
>smart00350 MCM minichromosome maintenance proteins Back     alignment and domain information
>PF00931 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is the NB-ARC domain, a novel signalling motif found in bacteria and eukaryotes, shared by plant resistance gene products and regulators of cell death in animals [] Back     alignment and domain information
>PF06309 Torsin: Torsin; InterPro: IPR010448 This family consists of several eukaryotic torsin proteins Back     alignment and domain information
>PRK00131 aroK shikimate kinase; Reviewed Back     alignment and domain information
>KOG1942|consensus Back     alignment and domain information
>PHA02624 large T antigen; Provisional Back     alignment and domain information
>KOG2227|consensus Back     alignment and domain information
>PRK06067 flagellar accessory protein FlaH; Validated Back     alignment and domain information
>PF03969 AFG1_ATPase: AFG1-like ATPase; InterPro: IPR005654 ATPase family gene 1 (AFG1) ATPase is a 377 amino acid putative protein with an ATPase motif typical of the protein family including SEC18p PAS1, CDC48-VCP and TBP Back     alignment and domain information
>PRK13764 ATPase; Provisional Back     alignment and domain information
>TIGR02538 type_IV_pilB type IV-A pilus assembly ATPase PilB Back     alignment and domain information
>PRK05707 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK10365 transcriptional regulatory protein ZraR; Provisional Back     alignment and domain information
>PF05729 NACHT: NACHT domain Back     alignment and domain information
>cd01128 rho_factor Transcription termination factor rho is a bacterial ATP-dependent RNA/DNA helicase Back     alignment and domain information
>PRK13851 type IV secretion system protein VirB11; Provisional Back     alignment and domain information
>PRK06762 hypothetical protein; Provisional Back     alignment and domain information
>KOG1514|consensus Back     alignment and domain information
>KOG3347|consensus Back     alignment and domain information
>TIGR01618 phage_P_loop phage nucleotide-binding protein Back     alignment and domain information
>TIGR02788 VirB11 P-type DNA transfer ATPase VirB11 Back     alignment and domain information
>PRK09862 putative ATP-dependent protease; Provisional Back     alignment and domain information
>PF13604 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL_A 3E1S_A 3GP8_A Back     alignment and domain information
>COG3284 AcoR Transcriptional activator of acetoin/glycerol metabolism [Secondary metabolites biosynthesis, transport, and catabolism / Transcription] Back     alignment and domain information
>PRK09376 rho transcription termination factor Rho; Provisional Back     alignment and domain information
>PRK09354 recA recombinase A; Provisional Back     alignment and domain information
>PRK03839 putative kinase; Provisional Back     alignment and domain information
>TIGR02031 BchD-ChlD magnesium chelatase ATPase subunit D Back     alignment and domain information
>PRK13947 shikimate kinase; Provisional Back     alignment and domain information
>PF09848 DUF2075: Uncharacterized conserved protein (DUF2075); InterPro: IPR018647 This domain, found in putative ATP/GTP binding proteins, has no known function Back     alignment and domain information
>PRK10536 hypothetical protein; Provisional Back     alignment and domain information
>COG4619 ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>TIGR00416 sms DNA repair protein RadA Back     alignment and domain information
>cd00046 DEXDc DEAD-like helicases superfamily Back     alignment and domain information
>PRK00625 shikimate kinase; Provisional Back     alignment and domain information
>PRK06217 hypothetical protein; Validated Back     alignment and domain information
>TIGR03877 thermo_KaiC_1 KaiC domain protein, Ph0284 family Back     alignment and domain information
>cd03283 ABC_MutS-like MutS-like homolog in eukaryotes Back     alignment and domain information
>PRK06871 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PHA02774 E1; Provisional Back     alignment and domain information
>cd00464 SK Shikimate kinase (SK) is the fifth enzyme in the shikimate pathway, a seven-step biosynthetic pathway which converts erythrose-4-phosphate to chorismic acid, found in bacteria, fungi and plants Back     alignment and domain information
>TIGR02858 spore_III_AA stage III sporulation protein AA Back     alignment and domain information
>TIGR01359 UMP_CMP_kin_fam UMP-CMP kinase family Back     alignment and domain information
>TIGR03499 FlhF flagellar biosynthetic protein FlhF Back     alignment and domain information
>cd01394 radB RadB Back     alignment and domain information
>PRK14532 adenylate kinase; Provisional Back     alignment and domain information
>PF12775 AAA_7: P-loop containing dynein motor region D3; PDB: 4AKI_A 4AI6_B 4AKH_A 4AKG_A 3QMZ_A 3VKH_A 3VKG_A Back     alignment and domain information
>COG0563 Adk Adenylate kinase and related kinases [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK07993 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PRK13949 shikimate kinase; Provisional Back     alignment and domain information
>cd00227 CPT Chloramphenicol (Cm) phosphotransferase (CPT) Back     alignment and domain information
>TIGR02524 dot_icm_DotB Dot/Icm secretion system ATPase DotB Back     alignment and domain information
>PRK00771 signal recognition particle protein Srp54; Provisional Back     alignment and domain information
>cd02021 GntK Gluconate kinase (GntK) catalyzes the phosphoryl transfer from ATP to gluconate Back     alignment and domain information
>cd03221 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is a cytosolic protein required by fungal ribosomes for in vitro protein synthesis and for in vivo growth Back     alignment and domain information
>PRK14974 cell division protein FtsY; Provisional Back     alignment and domain information
>PF01745 IPT: Isopentenyl transferase; InterPro: IPR002648 Isopentenyl transferase / dimethylallyl transferase synthesizes isopentenyladensosine 5'-monophosphate, a cytokinin that induces shoot formation on host plants infected with the Ti plasmid [] Back     alignment and domain information
>TIGR01313 therm_gnt_kin carbohydrate kinase, thermoresistant glucokinase family Back     alignment and domain information
>PRK13765 ATP-dependent protease Lon; Provisional Back     alignment and domain information
>PRK12723 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK14530 adenylate kinase; Provisional Back     alignment and domain information
>PRK14531 adenylate kinase; Provisional Back     alignment and domain information
>COG1066 Sms Predicted ATP-dependent serine protease [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd01428 ADK Adenylate kinase (ADK) catalyzes the reversible phosphoryl transfer from adenosine triphosphates (ATP) to adenosine monophosphates (AMP) and to yield adenosine diphosphates (ADP) Back     alignment and domain information
>PRK04132 replication factor C small subunit; Provisional Back     alignment and domain information
>PRK13948 shikimate kinase; Provisional Back     alignment and domain information
>TIGR03574 selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal Back     alignment and domain information
>cd02020 CMPK Cytidine monophosphate kinase (CMPK) catalyzes the reversible phosphorylation of cytidine monophosphate (CMP) to produce cytidine diphosphate (CDP), using ATP as the preferred phosphoryl donor Back     alignment and domain information
>PF08433 KTI12: Chromatin associated protein KTI12 ; InterPro: IPR013641 This is a family of chromatin associated proteins which interact with the Elongator complex, a component of the elongating form of RNA polymerase II [] Back     alignment and domain information
>PRK06547 hypothetical protein; Provisional Back     alignment and domain information
>PF00448 SRP54: SRP54-type protein, GTPase domain; InterPro: IPR000897 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] Back     alignment and domain information
>PRK11889 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PLN02674 adenylate kinase Back     alignment and domain information
>COG0703 AroK Shikimate kinase [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR03878 thermo_KaiC_2 KaiC domain protein, AF_0795 family Back     alignment and domain information
>COG1373 Predicted ATPase (AAA+ superfamily) [General function prediction only] Back     alignment and domain information
>cd00561 CobA_CobO_BtuR ATP:corrinoid adenosyltransferase BtuR/CobO/CobP Back     alignment and domain information
>TIGR00767 rho transcription termination factor Rho Back     alignment and domain information
>PRK04328 hypothetical protein; Provisional Back     alignment and domain information
>PTZ00111 DNA replication licensing factor MCM4; Provisional Back     alignment and domain information
>PRK05057 aroK shikimate kinase I; Reviewed Back     alignment and domain information
>PTZ00088 adenylate kinase 1; Provisional Back     alignment and domain information
>TIGR00064 ftsY signal recognition particle-docking protein FtsY Back     alignment and domain information
>cd01123 Rad51_DMC1_radA Rad51_DMC1_radA,B Back     alignment and domain information
>COG1102 Cmk Cytidylate kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>cd03216 ABC_Carb_Monos_I This family represents the domain I of the carbohydrate uptake proteins that transport only monosaccharides (Monos) Back     alignment and domain information
>cd03281 ABC_MSH5_euk MutS5 homolog in eukaryotes Back     alignment and domain information
>PRK03731 aroL shikimate kinase II; Reviewed Back     alignment and domain information
>TIGR02655 circ_KaiC circadian clock protein KaiC Back     alignment and domain information
>cd01393 recA_like RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response Back     alignment and domain information
>PF01583 APS_kinase: Adenylylsulphate kinase; InterPro: IPR002891 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases Back     alignment and domain information
>cd03222 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibitor (RLI) is a key enzyme in ribosomal biogenesis, formation of translation preinitiation complexes, and assembly of HIV capsids Back     alignment and domain information
>cd00544 CobU Adenosylcobinamide kinase / adenosylcobinamide phosphate guanyltransferase (CobU) Back     alignment and domain information
>PRK14722 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>TIGR03881 KaiC_arch_4 KaiC domain protein, PAE1156 family Back     alignment and domain information
>TIGR00150 HI0065_YjeE ATPase, YjeE family Back     alignment and domain information
>PRK13946 shikimate kinase; Provisional Back     alignment and domain information
>TIGR03819 heli_sec_ATPase helicase/secretion neighborhood ATPase Back     alignment and domain information
>PLN02200 adenylate kinase family protein Back     alignment and domain information
>PF13245 AAA_19: Part of AAA domain Back     alignment and domain information
>PRK14528 adenylate kinase; Provisional Back     alignment and domain information
>PRK08154 anaerobic benzoate catabolism transcriptional regulator; Reviewed Back     alignment and domain information
>PRK08699 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK08769 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PF13479 AAA_24: AAA domain Back     alignment and domain information
>TIGR01360 aden_kin_iso1 adenylate kinase, isozyme 1 subfamily Back     alignment and domain information
>cd02019 NK Nucleoside/nucleotide kinase (NK) is a protein superfamily consisting of multiple families of enzymes that share structural similarity and are functionally related to the catalysis of the reversible phosphate group transfer from nucleoside triphosphates to nucleosides/nucleotides, nucleoside monophosphates, or sugars Back     alignment and domain information
>COG4962 CpaF Flp pilus assembly protein, ATPase CpaF [Intracellular trafficking and secretion] Back     alignment and domain information
>PF13238 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB_A 3IIM_A 2AXP_A 3KB2_A 1KHT_A 1NKS_A 3H86_C Back     alignment and domain information
>TIGR01351 adk adenylate kinases Back     alignment and domain information
>COG1936 Predicted nucleotide kinase (related to CMP and AMP kinases) [Nucleotide transport and metabolism] Back     alignment and domain information
>cd03115 SRP The signal recognition particle (SRP) mediates the transport to or across the plasma membrane in bacteria and the endoplasmic reticulum in eukaryotes Back     alignment and domain information
>PRK02496 adk adenylate kinase; Provisional Back     alignment and domain information
>PRK06696 uridine kinase; Validated Back     alignment and domain information
>PRK14527 adenylate kinase; Provisional Back     alignment and domain information
>PF01443 Viral_helicase1: Viral (Superfamily 1) RNA helicase; InterPro: IPR000606 This entry includes RNA and DNA helicases Back     alignment and domain information
>PRK06090 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK00279 adk adenylate kinase; Reviewed Back     alignment and domain information
>cd03243 ABC_MutS_homologs The MutS protein initiates DNA mismatch repair by recognizing mispaired and unpaired bases embedded in duplex DNA and activating endo- and exonucleases to remove the mismatch Back     alignment and domain information
>PRK05800 cobU adenosylcobinamide kinase/adenosylcobinamide-phosphate guanylyltransferase; Validated Back     alignment and domain information
>COG1485 Predicted ATPase [General function prediction only] Back     alignment and domain information
>PF06414 Zeta_toxin: Zeta toxin; InterPro: IPR010488 This entry represents a domain originally identified in bacterial zeta toxin proteins, where it comprises the whole protein [] Back     alignment and domain information
>smart00534 MUTSac ATPase domain of DNA mismatch repair MUTS family Back     alignment and domain information
>TIGR02768 TraA_Ti Ti-type conjugative transfer relaxase TraA Back     alignment and domain information
>PHA02530 pseT polynucleotide kinase; Provisional Back     alignment and domain information
>PF13086 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV_A 2XZP_A 2GK6_A 2GK7_A 2GJK_A Back     alignment and domain information
>PF08298 AAA_PrkA: PrkA AAA domain; InterPro: IPR013153 This is entry is found at the N terminus of PrkA proteins - bacterial and archaeal serine kinases approximately 630 residues in length Back     alignment and domain information
>PRK12724 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK10416 signal recognition particle-docking protein FtsY; Provisional Back     alignment and domain information
>cd00267 ABC_ATPase ABC (ATP-binding cassette) transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules Back     alignment and domain information
>PRK04040 adenylate kinase; Provisional Back     alignment and domain information
>PRK08233 hypothetical protein; Provisional Back     alignment and domain information
>cd03280 ABC_MutS2 MutS2 homologs in bacteria and eukaryotes Back     alignment and domain information
>PF05970 PIF1: PIF1-like helicase; InterPro: IPR010285 This entry represents PIF1 helicase and related proteins Back     alignment and domain information
>TIGR01526 nadR_NMN_Atrans nicotinamide-nucleotide adenylyltransferase, NadR type Back     alignment and domain information
>TIGR01448 recD_rel helicase, putative, RecD/TraA family Back     alignment and domain information
>cd02027 APSK Adenosine 5'-phosphosulfate kinase (APSK) catalyzes the phosphorylation of adenosine 5'-phosphosulfate to form 3'-phosphoadenosine 5'-phosphosulfate (PAPS) Back     alignment and domain information
>cd03238 ABC_UvrA The excision repair protein UvrA; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion Back     alignment and domain information
>COG0467 RAD55 RecA-superfamily ATPases implicated in signal transduction [Signal transduction mechanisms] Back     alignment and domain information
>PRK12726 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PF14516 AAA_35: AAA-like domain Back     alignment and domain information
>PRK08099 bifunctional DNA-binding transcriptional repressor/ NMN adenylyltransferase; Provisional Back     alignment and domain information
>COG5008 PilU Tfp pilus assembly protein, ATPase PilU [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>PRK05541 adenylylsulfate kinase; Provisional Back     alignment and domain information
>PF13521 AAA_28: AAA domain; PDB: 1LW7_A Back     alignment and domain information
>PRK14526 adenylate kinase; Provisional Back     alignment and domain information
>PRK05973 replicative DNA helicase; Provisional Back     alignment and domain information
>PRK04182 cytidylate kinase; Provisional Back     alignment and domain information
>cd03228 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein)-like transporters are involved in drug, peptide, and lipid export Back     alignment and domain information
>COG0529 CysC Adenylylsulfate kinase and related kinases [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG2680|consensus Back     alignment and domain information
>TIGR02173 cyt_kin_arch cytidylate kinase, putative Back     alignment and domain information
>PF00406 ADK: Adenylate kinase; InterPro: IPR000850 Adenylate kinases (ADK) are phosphotransferases that catalyse the reversible reaction AMP + MgATP = ADP + MgADP an essential reaction for many processes in living cells Back     alignment and domain information
>PF05707 Zot: Zonular occludens toxin (Zot); InterPro: IPR008900 This entry consists of bacterial and viral proteins which are very similar to the Zonular occludens toxin (Zot) Back     alignment and domain information
>PRK09519 recA DNA recombination protein RecA; Reviewed Back     alignment and domain information
>PRK12608 transcription termination factor Rho; Provisional Back     alignment and domain information
>PRK10078 ribose 1,5-bisphosphokinase; Provisional Back     alignment and domain information
>PF06745 KaiC: KaiC; InterPro: IPR014774 This entry represents a domain within bacterial and archaeal proteins, most of which are hypothetical Back     alignment and domain information
>COG1855 ATPase (PilT family) [General function prediction only] Back     alignment and domain information
>PRK06964 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK01184 hypothetical protein; Provisional Back     alignment and domain information
>PRK14529 adenylate kinase; Provisional Back     alignment and domain information
>KOG2035|consensus Back     alignment and domain information
>TIGR01425 SRP54_euk signal recognition particle protein SRP54 Back     alignment and domain information
>TIGR02238 recomb_DMC1 meiotic recombinase Dmc1 Back     alignment and domain information
>COG0630 VirB11 Type IV secretory pathway, VirB11 components, and related ATPases involved in archaeal flagella biosynthesis [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>cd03247 ABCC_cytochrome_bd The CYD subfamily implicated in cytochrome bd biogenesis Back     alignment and domain information
>PRK10867 signal recognition particle protein; Provisional Back     alignment and domain information
>cd03223 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cassette transporter (Pat) is involved in the import of very long-chain fatty acids (VLCFA) into the peroxisome Back     alignment and domain information
>PRK05703 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>PRK05986 cob(I)alamin adenolsyltransferase/cobinamide ATP-dependent adenolsyltransferase; Validated Back     alignment and domain information
>PRK00889 adenylylsulfate kinase; Provisional Back     alignment and domain information
>KOG1051|consensus Back     alignment and domain information
>cd03246 ABCC_Protease_Secretion This family represents the ABC component of the protease secretion system PrtD, a 60-kDa integral membrane protein sharing 37% identity with HlyB, the ABC component of the alpha-hemolysin secretion pathway, in the C-terminal domain Back     alignment and domain information
>PF03266 NTPase_1: NTPase; InterPro: IPR004948 This entry represents a family of nucleoside-triphosphatases which have activity towards ATP, GTP, CTP, TTP and UTP and may hydrolyse nucleoside diphosphates with lower efficiency [] Back     alignment and domain information
>PLN02199 shikimate kinase Back     alignment and domain information
>PRK14730 coaE dephospho-CoA kinase; Provisional Back     alignment and domain information
>TIGR02655 circ_KaiC circadian clock protein KaiC Back     alignment and domain information
>cd03227 ABC_Class2 ABC-type Class 2 contains systems involved in cellular processes other than transport Back     alignment and domain information
>TIGR02322 phosphon_PhnN phosphonate metabolism protein/1,5-bisphosphokinase (PRPP-forming) PhnN Back     alignment and domain information
>TIGR00708 cobA cob(I)alamin adenosyltransferase Back     alignment and domain information
>COG0194 Gmk Guanylate kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK05480 uridine/cytidine kinase; Provisional Back     alignment and domain information
>TIGR00959 ffh signal recognition particle protein Back     alignment and domain information
>PLN02459 probable adenylate kinase Back     alignment and domain information
>PRK12339 2-phosphoglycerate kinase; Provisional Back     alignment and domain information
>PF12780 AAA_8: P-loop containing dynein motor region D4; InterPro: IPR024317 The 380 kDa motor unit of dynein belongs to the AAA class of chaperone-like ATPases Back     alignment and domain information
>PRK12338 hypothetical protein; Provisional Back     alignment and domain information
>cd03214 ABC_Iron-Siderophores_B12_Hemin ABC transporters, involved in the uptake of siderophores, heme, and vitamin B12, are widely conserved in bacteria and archaea Back     alignment and domain information
>PF02367 UPF0079: Uncharacterised P-loop hydrolase UPF0079; InterPro: IPR003442 This group consists of bacterial proteins, which contain a P-loop Back     alignment and domain information
>PRK00091 miaA tRNA delta(2)-isopentenylpyrophosphate transferase; Reviewed Back     alignment and domain information
>cd02028 UMPK_like Uridine monophosphate kinase_like (UMPK_like) is a family of proteins highly similar to the uridine monophosphate kinase (UMPK, EC 2 Back     alignment and domain information
>cd03287 ABC_MSH3_euk MutS3 homolog in eukaryotes Back     alignment and domain information
>TIGR03880 KaiC_arch_3 KaiC domain protein, AF_0351 family Back     alignment and domain information
>PLN02165 adenylate isopentenyltransferase Back     alignment and domain information
>PRK05917 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PTZ00293 thymidine kinase; Provisional Back     alignment and domain information
>PF00485 PRK: Phosphoribulokinase / Uridine kinase family; InterPro: IPR006083 Phosphoribulokinase (PRK) 2 Back     alignment and domain information
>cd02024 NRK1 Nicotinamide riboside kinase (NRK) is an enzyme involved in the metabolism of nicotinamide adenine dinucleotide (NAD+) Back     alignment and domain information
>KOG2543|consensus Back     alignment and domain information
>PTZ00202 tuzin; Provisional Back     alignment and domain information
>cd03282 ABC_MSH4_euk MutS4 homolog in eukaryotes Back     alignment and domain information
>TIGR00376 DNA helicase, putative Back     alignment and domain information
>COG5271 MDN1 AAA ATPase containing von Willebrand factor type A (vWA) domain [General function prediction only] Back     alignment and domain information
>COG1127 Ttg2A ABC-type transport system involved in resistance to organic solvents, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>cd00071 GMPK Guanosine monophosphate kinase (GMPK, EC 2 Back     alignment and domain information
>PLN03187 meiotic recombination protein DMC1 homolog; Provisional Back     alignment and domain information
>PF00154 RecA: recA bacterial DNA recombination protein; InterPro: IPR013765 The recA gene product is a multifunctional enzyme that plays a role in homologous recombination, DNA repair and induction of the SOS response [] Back     alignment and domain information
>cd00984 DnaB_C DnaB helicase C terminal domain Back     alignment and domain information
>TIGR02236 recomb_radA DNA repair and recombination protein RadA Back     alignment and domain information
>COG4088 Predicted nucleotide kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK09825 idnK D-gluconate kinase; Provisional Back     alignment and domain information
>cd03285 ABC_MSH2_euk MutS2 homolog in eukaryotes Back     alignment and domain information
>cd02022 DPCK Dephospho-coenzyme A kinase (DPCK, EC 2 Back     alignment and domain information
>PRK00300 gmk guanylate kinase; Provisional Back     alignment and domain information
>TIGR00174 miaA tRNA isopentenyltransferase (miaA) Back     alignment and domain information
>smart00487 DEXDc DEAD-like helicases superfamily Back     alignment and domain information
>cd02023 UMPK Uridine monophosphate kinase (UMPK, EC 2 Back     alignment and domain information
>PRK09302 circadian clock protein KaiC; Reviewed Back     alignment and domain information
>PF13555 AAA_29: P-loop containing region of AAA domain Back     alignment and domain information
>PRK14737 gmk guanylate kinase; Provisional Back     alignment and domain information
>PRK10646 ADP-binding protein; Provisional Back     alignment and domain information
>PRK10463 hydrogenase nickel incorporation protein HypB; Provisional Back     alignment and domain information
>PF04665 Pox_A32: Poxvirus A32 protein; InterPro: IPR006758 This entry contains uncharacterised proteins belonging to the B354L family which include the pox virus A32 protein Back     alignment and domain information
>COG0552 FtsY Signal recognition particle GTPase [Intracellular trafficking and secretion] Back     alignment and domain information
>PRK13889 conjugal transfer relaxase TraA; Provisional Back     alignment and domain information
>TIGR03263 guanyl_kin guanylate kinase Back     alignment and domain information
>COG3842 PotA ABC-type spermidine/putrescine transport systems, ATPase components [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR00750 lao LAO/AO transport system ATPase Back     alignment and domain information
>PRK13808 adenylate kinase; Provisional Back     alignment and domain information
>PF13481 AAA_25: AAA domain; PDB: 1G8Y_J 1OLO_A 1NLF_C Back     alignment and domain information
>PF02456 Adeno_IVa2: Adenovirus IVa2 protein; InterPro: IPR003389 Va2 protein can interact with the adenoviral packaging signal and this interaction involves DNA sequences that have previously been demonstrated to be required for packaging [] Back     alignment and domain information
>PRK04301 radA DNA repair and recombination protein RadA; Validated Back     alignment and domain information
>cd01878 HflX HflX subfamily Back     alignment and domain information
>cd00820 PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPCK), a critical gluconeogenic enzyme, catalyzes the first committed step in the diversion of tricarboxylic acid cycle intermediates toward gluconeogenesis Back     alignment and domain information
>TIGR00235 udk uridine kinase Back     alignment and domain information
>PRK06761 hypothetical protein; Provisional Back     alignment and domain information
>KOG0058|consensus Back     alignment and domain information
>PRK07667 uridine kinase; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query197
3hu2_A 489 Structure Of P97 N-D1 R86a Mutant In Complex With A 1e-100
3hu1_A 489 Structure Of P97 N-D1 R95g Mutant In Complex With A 1e-100
1e32_A 458 Structure Of The N-Terminal Domain And The D1 Aaa D 1e-100
3cf1_A 806 Structure Of P97VCP IN COMPLEX WITH ADPADP.ALFX Len 1e-100
3cf1_A 806 Structure Of P97VCP IN COMPLEX WITH ADPADP.ALFX Len 3e-27
1r7r_A 816 The Crystal Structure Of Murine P97VCP AT 3.6A Leng 1e-100
1r7r_A 816 The Crystal Structure Of Murine P97VCP AT 3.6A Leng 3e-27
3hu3_A 489 Structure Of P97 N-D1 R155h Mutant In Complex With 1e-99
2pjh_B193 Strctural Model Of The P97 N Domain- Npl4 Ubd Compl 4e-40
3qwz_A211 Crystal Structure Of Faf1 Ubx-P97n-Domain Complex L 2e-36
3h4m_A 285 Aaa Atpase Domain Of The Proteasome- Activating Nuc 2e-34
4b4t_I 437 Near-Atomic Resolution Structural Model Of The Yeas 1e-32
3qc8_A178 Crystal Structure Of Faf1 Ubx Domain In Complex Wit 3e-31
4b4t_K 428 Near-Atomic Resolution Structural Model Of The Yeas 2e-30
4b4t_J 405 Near-Atomic Resolution Structural Model Of The Yeas 8e-30
4b4t_H 467 Near-Atomic Resolution Structural Model Of The Yeas 7e-29
4b4t_L 437 Near-Atomic Resolution Structural Model Of The Yeas 1e-27
3cf0_A 301 Structure Of D2 Subdomain Of P97VCP IN COMPLEX WITH 2e-27
3tiw_A187 Crystal Structure Of P97n In Complex With The C-Ter 8e-27
3qq7_A186 Crystal Structure Of The P97 N-Terminal Domain Leng 1e-26
4b4t_M 434 Near-Atomic Resolution Structural Model Of The Yeas 8e-26
2x8a_A 274 Human Nuclear Valosin Containing Protein Like (Nvl) 5e-25
2rko_A 331 Crystal Structure Of The Vps4p-Dimer Length = 331 2e-23
3eie_A 322 Crystal Structure Of S.Cerevisiae Vps4 In The So4-B 4e-23
2qp9_X 355 Crystal Structure Of S.Cerevisiae Vps4 Length = 355 5e-23
3eih_A 340 Crystal Structure Of S.Cerevisiae Vps4 In The Prese 5e-23
1lv7_A 257 Crystal Structure Of The Aaa Domain Of Ftsh Length 5e-23
3d8b_A 357 Crystal Structure Of Human Fidgetin-Like Protein 1 6e-23
2ce7_A 476 Edta Treated Length = 476 7e-23
3kds_E 465 Apo-ftsh Crystal Structure Length = 465 4e-22
2zam_A 444 Crystal Structure Of Mouse Skd1VPS4B APO-Form Lengt 8e-21
1xwi_A 322 Crystal Structure Of Vps4b Length = 322 1e-20
2r62_A 268 Crystal Structure Of Helicobacter Pylori Atp Depend 3e-20
3vfd_A 389 Human Spastin Aaa Domain Length = 389 4e-20
3b9p_A 297 Spastin Length = 297 8e-19
2qz4_A 262 Human Paraplegin, Aaa Domain In Complex With Adp Le 2e-18
2dhr_A 499 Whole Cytosolic Region Of Atp-Dependent Metalloprot 4e-18
4eiw_A 508 Whole Cytosolic Region Of Atp-Dependent Metalloprot 5e-18
1iy2_A 278 Crystal Structure Of The Ftsh Atpase Domain From Th 1e-17
1ixz_A 254 Crystal Structure Of The Ftsh Atpase Domain From Th 1e-17
1ixr_C 312 Ruva-Ruvb Complex Length = 312 6e-06
1ixs_B 318 Structure Of Ruvb Complexed With Ruva Domain Iii Le 7e-06
1hqc_A 324 Structure Of Ruvb From Thermus Thermophilus Hb8 Len 7e-06
1ofh_A 310 Asymmetric Complex Between Hslv And I-domain Delete 3e-04
1d2n_A 272 D2 Domain Of N-Ethylmaleimide-Sensitive Fusion Prot 5e-04
1nsf_A 273 D2 Hexamerization Domain Of N-Ethylmaleimide Sensit 5e-04
>pdb|3HU2|A Chain A, Structure Of P97 N-D1 R86a Mutant In Complex With Atpgs Length = 489 Back     alignment and structure

Iteration: 1

Score = 360 bits (925), Expect = e-100, Method: Compositional matrix adjust. Identities = 171/192 (89%), Positives = 184/192 (95%) Query: 6 EGEMSNLFEVYLKPYFLEAYRPVHKDDLFIVRGGMRAVEFKIVDTDPAPYCIVAADTVIH 65 EG NLFEVYLKPYFLEAYRP+ K D+F+VRGGMRAVEFK+V+TDP+PYCIVA DTVIH Sbjct: 124 EGITGNLFEVYLKPYFLEAYRPIRKGDIFLVRGGMRAVEFKVVETDPSPYCIVAPDTVIH 183 Query: 66 CEGDPIKREEEEEASNAVGYDDIGGCRKQLAQIKEMVELPLRHPSLFKAIGVKPPRGILL 125 CEG+PIKRE+EEE+ N VGYDDIGGCRKQLAQIKEMVELPLRHP+LFKAIGVKPPRGILL Sbjct: 184 CEGEPIKREDEEESLNEVGYDDIGGCRKQLAQIKEMVELPLRHPALFKAIGVKPPRGILL 243 Query: 126 YGPPGTGKTLIARAVANETGAFFFLINGPEIMSKLAGESESNLRKAFEEADKNSPSIIFI 185 YGPPGTGKTLIARAVANETGAFFFLINGPEIMSKLAGESESNLRKAFEEA+KN+P+IIFI Sbjct: 244 YGPPGTGKTLIARAVANETGAFFFLINGPEIMSKLAGESESNLRKAFEEAEKNAPAIIFI 303 Query: 186 DELDAIAPKREK 197 DELDAIAPKREK Sbjct: 304 DELDAIAPKREK 315
>pdb|3HU1|A Chain A, Structure Of P97 N-D1 R95g Mutant In Complex With Atpgs Length = 489 Back     alignment and structure
>pdb|1E32|A Chain A, Structure Of The N-Terminal Domain And The D1 Aaa Domain Of Membrane Fusion Atpase P97 Length = 458 Back     alignment and structure
>pdb|3CF1|A Chain A, Structure Of P97VCP IN COMPLEX WITH ADPADP.ALFX Length = 806 Back     alignment and structure
>pdb|3CF1|A Chain A, Structure Of P97VCP IN COMPLEX WITH ADPADP.ALFX Length = 806 Back     alignment and structure
>pdb|1R7R|A Chain A, The Crystal Structure Of Murine P97VCP AT 3.6A Length = 816 Back     alignment and structure
>pdb|1R7R|A Chain A, The Crystal Structure Of Murine P97VCP AT 3.6A Length = 816 Back     alignment and structure
>pdb|3HU3|A Chain A, Structure Of P97 N-D1 R155h Mutant In Complex With Atpgs Length = 489 Back     alignment and structure
>pdb|2PJH|B Chain B, Strctural Model Of The P97 N Domain- Npl4 Ubd Complex Length = 193 Back     alignment and structure
>pdb|3QWZ|A Chain A, Crystal Structure Of Faf1 Ubx-P97n-Domain Complex Length = 211 Back     alignment and structure
>pdb|3H4M|A Chain A, Aaa Atpase Domain Of The Proteasome- Activating Nucleotidase Length = 285 Back     alignment and structure
>pdb|4B4T|I Chain I, Near-Atomic Resolution Structural Model Of The Yeast 26s Proteasome Length = 437 Back     alignment and structure
>pdb|3QC8|A Chain A, Crystal Structure Of Faf1 Ubx Domain In Complex With P97VCP N DOMAIN Reveals The Conserved Fcisp Touch-Turn Motif Of Ubx Domain Suffering Conformational Change Length = 178 Back     alignment and structure
>pdb|4B4T|K Chain K, Near-Atomic Resolution Structural Model Of The Yeast 26s Proteasome Length = 428 Back     alignment and structure
>pdb|4B4T|J Chain J, Near-Atomic Resolution Structural Model Of The Yeast 26s Proteasome Length = 405 Back     alignment and structure
>pdb|4B4T|H Chain H, Near-Atomic Resolution Structural Model Of The Yeast 26s Proteasome Length = 467 Back     alignment and structure
>pdb|4B4T|L Chain L, Near-Atomic Resolution Structural Model Of The Yeast 26s Proteasome Length = 437 Back     alignment and structure
>pdb|3CF0|A Chain A, Structure Of D2 Subdomain Of P97VCP IN COMPLEX WITH ADP Length = 301 Back     alignment and structure
>pdb|3TIW|A Chain A, Crystal Structure Of P97n In Complex With The C-Terminus Of Gp78 Length = 187 Back     alignment and structure
>pdb|3QQ7|A Chain A, Crystal Structure Of The P97 N-Terminal Domain Length = 186 Back     alignment and structure
>pdb|4B4T|M Chain M, Near-Atomic Resolution Structural Model Of The Yeast 26s Proteasome Length = 434 Back     alignment and structure
>pdb|2X8A|A Chain A, Human Nuclear Valosin Containing Protein Like (Nvl), C- Terminal Aaa-Atpase Domain Length = 274 Back     alignment and structure
>pdb|2RKO|A Chain A, Crystal Structure Of The Vps4p-Dimer Length = 331 Back     alignment and structure
>pdb|3EIE|A Chain A, Crystal Structure Of S.Cerevisiae Vps4 In The So4-Bound State Length = 322 Back     alignment and structure
>pdb|2QP9|X Chain X, Crystal Structure Of S.Cerevisiae Vps4 Length = 355 Back     alignment and structure
>pdb|3EIH|A Chain A, Crystal Structure Of S.Cerevisiae Vps4 In The Presence Of Atpgammas Length = 340 Back     alignment and structure
>pdb|1LV7|A Chain A, Crystal Structure Of The Aaa Domain Of Ftsh Length = 257 Back     alignment and structure
>pdb|3D8B|A Chain A, Crystal Structure Of Human Fidgetin-Like Protein 1 In Complex With Adp Length = 357 Back     alignment and structure
>pdb|2CE7|A Chain A, Edta Treated Length = 476 Back     alignment and structure
>pdb|3KDS|E Chain E, Apo-ftsh Crystal Structure Length = 465 Back     alignment and structure
>pdb|2ZAM|A Chain A, Crystal Structure Of Mouse Skd1VPS4B APO-Form Length = 444 Back     alignment and structure
>pdb|1XWI|A Chain A, Crystal Structure Of Vps4b Length = 322 Back     alignment and structure
>pdb|2R62|A Chain A, Crystal Structure Of Helicobacter Pylori Atp Dependent Protease, Ftsh Length = 268 Back     alignment and structure
>pdb|3VFD|A Chain A, Human Spastin Aaa Domain Length = 389 Back     alignment and structure
>pdb|3B9P|A Chain A, Spastin Length = 297 Back     alignment and structure
>pdb|2QZ4|A Chain A, Human Paraplegin, Aaa Domain In Complex With Adp Length = 262 Back     alignment and structure
>pdb|2DHR|A Chain A, Whole Cytosolic Region Of Atp-Dependent Metalloprotease Ftsh (G399l) Length = 499 Back     alignment and structure
>pdb|4EIW|A Chain A, Whole Cytosolic Region Of Atp-Dependent Metalloprotease Ftsh (G399l) Length = 508 Back     alignment and structure
>pdb|1IY2|A Chain A, Crystal Structure Of The Ftsh Atpase Domain From Thermus Thermophilus Length = 278 Back     alignment and structure
>pdb|1IXZ|A Chain A, Crystal Structure Of The Ftsh Atpase Domain From Thermus Thermophilus Length = 254 Back     alignment and structure
>pdb|1IXR|C Chain C, Ruva-Ruvb Complex Length = 312 Back     alignment and structure
>pdb|1IXS|B Chain B, Structure Of Ruvb Complexed With Ruva Domain Iii Length = 318 Back     alignment and structure
>pdb|1HQC|A Chain A, Structure Of Ruvb From Thermus Thermophilus Hb8 Length = 324 Back     alignment and structure
>pdb|1OFH|A Chain A, Asymmetric Complex Between Hslv And I-domain Deleted Hslu (h. Influenzae) Length = 310 Back     alignment and structure
>pdb|1D2N|A Chain A, D2 Domain Of N-Ethylmaleimide-Sensitive Fusion Protein Length = 272 Back     alignment and structure
>pdb|1NSF|A Chain A, D2 Hexamerization Domain Of N-Ethylmaleimide Sensitive Factor (Nsf) Length = 273 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query197
3hu3_A 489 Transitional endoplasmic reticulum ATPase; VCP, tr 1e-101
1ypw_A 806 Transitional endoplasmic reticulum ATPase; AAA, P9 6e-88
1ypw_A 806 Transitional endoplasmic reticulum ATPase; AAA, P9 9e-54
3h4m_A 285 Proteasome-activating nucleotidase; ATPase, PAN, A 4e-65
3cf0_A 301 Transitional endoplasmic reticulum ATPase; AAA, P9 6e-56
2x8a_A 274 Nuclear valosin-containing protein-like; nuclear p 1e-55
1d2n_A 272 N-ethylmaleimide-sensitive fusion protein; hexamer 2e-51
3eie_A 322 Vacuolar protein sorting-associated protein 4; AAA 6e-49
3b9p_A 297 CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc 3e-47
1xwi_A 322 SKD1 protein; VPS4B, AAA ATPase, protein transport 7e-47
3d8b_A 357 Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, s 4e-46
3vfd_A 389 Spastin; ATPase, microtubule severing, hydrolase; 2e-45
2qp9_X 355 Vacuolar protein sorting-associated protein 4; ATP 1e-42
2zan_A 444 Vacuolar protein sorting-associating protein 4B; S 2e-40
3t15_A 293 Ribulose bisphosphate carboxylase/oxygenase activ 4e-39
1ixz_A 254 ATP-dependent metalloprotease FTSH; AAA domain fol 7e-34
2r62_A 268 Cell division protease FTSH homolog; ATPase domain 8e-34
1lv7_A 257 FTSH; alpha/beta domain, four helix bundle, hydrol 2e-33
1iy2_A 278 ATP-dependent metalloprotease FTSH; AAA domain fol 2e-33
2qz4_A 262 Paraplegin; AAA+, SPG7, protease, ADP, structural 8e-33
2ce7_A 476 Cell division protein FTSH; metalloprotease; HET: 5e-31
2dhr_A 499 FTSH; AAA+ protein, hexameric Zn metalloprotease, 2e-30
3qwz_A211 Transitional endoplasmic reticulum ATPase; UBX, P9 3e-30
3tiw_A187 Transitional endoplasmic reticulum ATPase; beta-ba 9e-22
1cz4_A185 VCP-like ATPase; double-PSI beta-barrel, beta-CLAM 1e-15
2c9o_A 456 RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP- 1e-11
3pvs_A 447 Replication-associated recombination protein A; ma 2e-11
3syl_A 309 Protein CBBX; photosynthesis, rubisco activase, AA 1e-10
1sxj_A 516 Activator 1 95 kDa subunit; clamp loader, processi 5e-08
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 7e-08
2w58_A202 DNAI, primosome component (helicase loader); ATP-b 1e-06
1fnn_A 389 CDC6P, cell division control protein 6; ORC1, AAA 1e-06
1hqc_A 324 RUVB; extended AAA-ATPase domain, complex with nuc 1e-06
2qgz_A308 Helicase loader, putative primosome component; str 1e-06
3ec2_A180 DNA replication protein DNAC; helicase loader, rep 2e-06
3nbx_X 500 ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structu 1e-05
2qby_A 386 CDC6 homolog 1, cell division control protein 6 ho 1e-05
2qby_B 384 CDC6 homolog 3, cell division control protein 6 ho 1e-05
1ofh_A 310 ATP-dependent HSL protease ATP-binding subunit HSL 1e-05
3pfi_A 338 Holliday junction ATP-dependent DNA helicase RUVB; 1e-05
1in4_A 334 RUVB, holliday junction DNA helicase RUVB; AAA+-cl 2e-05
2rhm_A 193 Putative kinase; P-loop containing nucleoside trip 5e-05
2chg_A 226 Replication factor C small subunit; DNA-binding pr 7e-05
2chq_A 319 Replication factor C small subunit; DNA-binding pr 1e-04
1iqp_A 327 RFCS; clamp loader, extended AAA-ATPase domain, co 2e-04
1zp6_A 191 Hypothetical protein ATU3015; alpha-beta protein., 3e-04
3te6_A 318 Regulatory protein SIR3; heterochromatin, gene sil 5e-04
1qhx_A178 CPT, protein (chloramphenicol phosphotransferase); 5e-04
3t61_A 202 Gluconokinase; PSI-biology, structural genomics, p 6e-04
3n70_A145 Transport activator; sigma-54, ntpase, PSI, MCSG, 6e-04
>3hu3_A Transitional endoplasmic reticulum ATPase; VCP, transport protein; HET: AGS; 2.20A {Homo sapiens} PDB: 3hu2_A* 3hu1_A* 1e32_A* 1s3s_A* 2pjh_B Length = 489 Back     alignment and structure
 Score =  300 bits (770), Expect = e-101
 Identities = 170/193 (88%), Positives = 183/193 (94%)

Query: 5   PEGEMSNLFEVYLKPYFLEAYRPVHKDDLFIVRGGMRAVEFKIVDTDPAPYCIVAADTVI 64
            EG   NLFEVYLKPYFLEAYRP+ K D+F+V GGMRAVEFK+V+TDP+PYCIVA DTVI
Sbjct: 123 VEGITGNLFEVYLKPYFLEAYRPIRKGDIFLVHGGMRAVEFKVVETDPSPYCIVAPDTVI 182

Query: 65  HCEGDPIKREEEEEASNAVGYDDIGGCRKQLAQIKEMVELPLRHPSLFKAIGVKPPRGIL 124
           HCEG+PIKRE+EEE+ N VGYDDIGGCRKQLAQIKEMVELPLRHP+LFKAIGVKPPRGIL
Sbjct: 183 HCEGEPIKREDEEESLNEVGYDDIGGCRKQLAQIKEMVELPLRHPALFKAIGVKPPRGIL 242

Query: 125 LYGPPGTGKTLIARAVANETGAFFFLINGPEIMSKLAGESESNLRKAFEEADKNSPSIIF 184
           LYGPPGTGKTLIARAVANETGAFFFLINGPEIMSKLAGESESNLRKAFEEA+KN+P+IIF
Sbjct: 243 LYGPPGTGKTLIARAVANETGAFFFLINGPEIMSKLAGESESNLRKAFEEAEKNAPAIIF 302

Query: 185 IDELDAIAPKREK 197
           IDELDAIAPKREK
Sbjct: 303 IDELDAIAPKREK 315


>3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} Length = 285 Back     alignment and structure
>3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} Length = 301 Back     alignment and structure
>2x8a_A Nuclear valosin-containing protein-like; nuclear protein; 2.60A {Homo sapiens} Length = 274 Back     alignment and structure
>1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A* Length = 272 Back     alignment and structure
>3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C Length = 322 Back     alignment and structure
>3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} Length = 297 Back     alignment and structure
>1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens} Length = 322 Back     alignment and structure
>3d8b_A Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, structural genomics consortium, ATP- hydrolase, magnesium, metal-binding, nucleotide-binding; HET: ADP; 2.00A {Homo sapiens} Length = 357 Back     alignment and structure
>3vfd_A Spastin; ATPase, microtubule severing, hydrolase; 3.30A {Homo sapiens} Length = 389 Back     alignment and structure
>2qp9_X Vacuolar protein sorting-associated protein 4; ATPase domain, beta domain, C-terminal helix, ATP-binding, E nucleotide-binding; 2.90A {Saccharomyces cerevisiae} PDB: 2qpa_A* Length = 355 Back     alignment and structure
>2zan_A Vacuolar protein sorting-associating protein 4B; SKD1, VPS4B, AAA ATPase, ATP-binding, coiled coil, membrane, nucleotide-binding, phosphorylation; HET: ATP; 3.00A {Mus musculus} PDB: 2zam_A* 2zao_A* 2jqh_A 2jqk_A 1wr0_A 2jq9_A 2k3w_A 1yxr_A Length = 444 Back     alignment and structure
>3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A Length = 293 Back     alignment and structure
>1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A* Length = 254 Back     alignment and structure
>2r62_A Cell division protease FTSH homolog; ATPase domain, ATP-binding, cell CELL division, hydrolase, membrane, metal-binding; 3.30A {Helicobacter pylori} PDB: 2r65_A* Length = 268 Back     alignment and structure
>1lv7_A FTSH; alpha/beta domain, four helix bundle, hydrolase; 1.50A {Escherichia coli} SCOP: c.37.1.20 Length = 257 Back     alignment and structure
>1iy2_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 3.20A {Thermus thermophilus} SCOP: c.37.1.20 Length = 278 Back     alignment and structure
>2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} Length = 262 Back     alignment and structure
>2ce7_A Cell division protein FTSH; metalloprotease; HET: ADP; 2.44A {Thermotoga maritima} SCOP: a.269.1.1 c.37.1.20 PDB: 2cea_A* 3kds_E* Length = 476 Back     alignment and structure
>2dhr_A FTSH; AAA+ protein, hexameric Zn metalloprotease, hydrolase; HET: ADP; 3.90A {Thermus thermophilus} Length = 499 Back     alignment and structure
>3qwz_A Transitional endoplasmic reticulum ATPase; UBX, P97 binding, transport protein; HET: MLY; 2.00A {Homo sapiens} PDB: 2pjh_B Length = 211 Back     alignment and structure
>3tiw_A Transitional endoplasmic reticulum ATPase; beta-barrel alpha-helix, transport protein ATPase ubiquitin ubiquitin, phosphorylation; 1.80A {Homo sapiens} PDB: 3qq8_A 3qq7_A 3qc8_A Length = 187 Back     alignment and structure
>1cz4_A VCP-like ATPase; double-PSI beta-barrel, beta-CLAM, substrate recognition DOM hydrolase; NMR {Thermoplasma acidophilum} SCOP: b.52.2.3 d.31.1.1 PDB: 1cz5_A Length = 185 Back     alignment and structure
>2c9o_A RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP-binding, chromatin regulator, growth regulation, hydrolase, nuclear protein, DNA recombination; HET: ADP; 2.2A {Homo sapiens} PDB: 2xsz_A* Length = 456 Back     alignment and structure
>3pvs_A Replication-associated recombination protein A; maintenance of genome stability Pro recombination; 2.50A {Escherichia coli} Length = 447 Back     alignment and structure
>3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A* Length = 309 Back     alignment and structure
>1sxj_A Activator 1 95 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Length = 516 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} Length = 202 Back     alignment and structure
>1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 Length = 389 Back     alignment and structure
>1hqc_A RUVB; extended AAA-ATPase domain, complex with nucleotide, hydrolase; HET: ADE; 3.20A {Thermus thermophilus} SCOP: a.4.5.11 c.37.1.20 PDB: 1ixs_B* 1ixr_C* Length = 324 Back     alignment and structure
>2qgz_A Helicase loader, putative primosome component; structural genomics, PSI-2, protein structure initiative; 2.40A {Streptococcus pyogenes serotype M3} Length = 308 Back     alignment and structure
>3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* Length = 180 Back     alignment and structure
>3nbx_X ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structure, rossman fold, hydro; HET: ADP; 2.91A {Escherichia coli} Length = 500 Back     alignment and structure
>2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Length = 386 Back     alignment and structure
>2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Length = 384 Back     alignment and structure
>1ofh_A ATP-dependent HSL protease ATP-binding subunit HSLU; chaperone, hydrolase, ATP-binding; HET: ADP; 2.5A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1ofi_A* Length = 310 Back     alignment and structure
>3pfi_A Holliday junction ATP-dependent DNA helicase RUVB; probable holliday junction DNA helicase; HET: ADP; 2.69A {Campylobacter jejuni subsp} Length = 338 Back     alignment and structure
>1in4_A RUVB, holliday junction DNA helicase RUVB; AAA+-class ATPase, winged-helix domain, ATP hydrolysis, walker A, walker B, sensor 1, sensor 2; HET: ADP; 1.60A {Thermotoga maritima} SCOP: a.4.5.11 c.37.1.20 PDB: 1in5_A* 1in6_A* 1in8_A* 1in7_A* 1j7k_A* Length = 334 Back     alignment and structure
>2rhm_A Putative kinase; P-loop containing nucleoside triphosphate hydrolases fold, S genomics, joint center for structural genomics, JCSG; HET: MSE; 1.70A {Chloroflexus aurantiacus} Length = 193 Back     alignment and structure
>2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} Length = 226 Back     alignment and structure
>2chq_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATP ATP-binding, nucleotide-binding; HET: ANP; 3.5A {Archaeoglobus fulgidus} PDB: 2chv_A Length = 319 Back     alignment and structure
>1iqp_A RFCS; clamp loader, extended AAA-ATPase domain, complex with ADP, replication; HET: ADP; 2.80A {Pyrococcus furiosus} SCOP: a.80.1.1 c.37.1.20 Length = 327 Back     alignment and structure
>1zp6_A Hypothetical protein ATU3015; alpha-beta protein., structural genomics, PSI, protein struc initiative; 3.20A {Agrobacterium tumefaciens str} SCOP: c.37.1.25 Length = 191 Back     alignment and structure
>3te6_A Regulatory protein SIR3; heterochromatin, gene silencing, SIR complex, HMR, HML, TELO AAA+ domain, structural, nucleus, gene RE; 2.80A {Saccharomyces cerevisiae} Length = 318 Back     alignment and structure
>1qhx_A CPT, protein (chloramphenicol phosphotransferase); kinase, antibiotic resistance, phosphorylation, mononucleoti binding fold; HET: ATP; 2.50A {Streptomyces venezuelae} SCOP: c.37.1.3 PDB: 1grr_A* 1grq_A 1qhs_A* 1qhn_A* 1qhy_A* Length = 178 Back     alignment and structure
>3t61_A Gluconokinase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium, nysgrc; 2.20A {Sinorhizobium meliloti} Length = 202 Back     alignment and structure
>3n70_A Transport activator; sigma-54, ntpase, PSI, MCSG, structural genomics, center for structural genomics; 2.80A {Escherichia coli} Length = 145 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query197
3cf2_A 806 TER ATPase, transitional endoplasmic reticulum ATP 100.0
4b4t_J 405 26S protease regulatory subunit 8 homolog; hydrola 99.96
3hu3_A 489 Transitional endoplasmic reticulum ATPase; VCP, tr 99.95
4b4t_I 437 26S protease regulatory subunit 4 homolog; hydrola 99.95
4b4t_L 437 26S protease subunit RPT4; hydrolase, AAA-atpases, 99.95
4b4t_H 467 26S protease regulatory subunit 7 homolog; hydrola 99.95
4b4t_M 434 26S protease regulatory subunit 6A; hydrolase, AAA 99.95
4b4t_K 428 26S protease regulatory subunit 6B homolog; hydrol 99.95
1ypw_A 806 Transitional endoplasmic reticulum ATPase; AAA, P9 99.93
3cf2_A 806 TER ATPase, transitional endoplasmic reticulum ATP 99.9
3cf0_A 301 Transitional endoplasmic reticulum ATPase; AAA, P9 99.88
1xwi_A 322 SKD1 protein; VPS4B, AAA ATPase, protein transport 99.88
3eie_A 322 Vacuolar protein sorting-associated protein 4; AAA 99.88
3h4m_A 285 Proteasome-activating nucleotidase; ATPase, PAN, A 99.86
2qp9_X 355 Vacuolar protein sorting-associated protein 4; ATP 99.86
2qz4_A 262 Paraplegin; AAA+, SPG7, protease, ADP, structural 99.85
2ce7_A 476 Cell division protein FTSH; metalloprotease; HET: 99.85
2x8a_A 274 Nuclear valosin-containing protein-like; nuclear p 99.84
1lv7_A 257 FTSH; alpha/beta domain, four helix bundle, hydrol 99.83
3b9p_A 297 CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc 99.83
2zan_A 444 Vacuolar protein sorting-associating protein 4B; S 99.83
3d8b_A 357 Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, s 99.82
3vfd_A 389 Spastin; ATPase, microtubule severing, hydrolase; 99.82
2r62_A 268 Cell division protease FTSH homolog; ATPase domain 99.81
2dhr_A 499 FTSH; AAA+ protein, hexameric Zn metalloprotease, 99.78
1ixz_A 254 ATP-dependent metalloprotease FTSH; AAA domain fol 99.76
2c9o_A 456 RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP- 99.75
1ypw_A 806 Transitional endoplasmic reticulum ATPase; AAA, P9 99.72
1iy2_A 278 ATP-dependent metalloprotease FTSH; AAA domain fol 99.72
3t15_A 293 Ribulose bisphosphate carboxylase/oxygenase activ 99.7
2z4s_A 440 Chromosomal replication initiator protein DNAA; AA 99.67
3syl_A 309 Protein CBBX; photosynthesis, rubisco activase, AA 99.64
2p65_A187 Hypothetical protein PF08_0063; CLPB, malaria, str 99.58
1jbk_A195 CLPB protein; beta barrel, chaperone; 1.80A {Esche 99.58
3hws_A 363 ATP-dependent CLP protease ATP-binding subunit CL; 99.57
3n70_A145 Transport activator; sigma-54, ntpase, PSI, MCSG, 99.56
1l8q_A 324 Chromosomal replication initiator protein DNAA; AA 99.53
3co5_A143 Putative two-component system transcriptional RES 99.53
1d2n_A 272 N-ethylmaleimide-sensitive fusion protein; hexamer 99.53
3pfi_A 338 Holliday junction ATP-dependent DNA helicase RUVB; 99.52
1ofh_A 310 ATP-dependent HSL protease ATP-binding subunit HSL 99.52
1sxj_A 516 Activator 1 95 kDa subunit; clamp loader, processi 99.49
1um8_A 376 ATP-dependent CLP protease ATP-binding subunit CL; 99.49
3pvs_A 447 Replication-associated recombination protein A; ma 99.48
1hqc_A 324 RUVB; extended AAA-ATPase domain, complex with nuc 99.47
3u61_B 324 DNA polymerase accessory protein 44; AAA+, ATP hyd 99.47
3uk6_A 368 RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding 99.45
2bjv_A 265 PSP operon transcriptional activator; AAA, transcr 99.44
1qvr_A 854 CLPB protein; coiled coil, AAA ATPase, chaperone; 99.43
1r6b_X 758 CLPA protein; AAA+, N-terminal domain, CLPS, cryst 99.41
3te6_A 318 Regulatory protein SIR3; heterochromatin, gene sil 99.4
2v1u_A 387 Cell division control protein 6 homolog; DNA repli 99.38
3m6a_A 543 ATP-dependent protease LA 1; alpha, beta, ATP-bind 99.38
2chg_A 226 Replication factor C small subunit; DNA-binding pr 99.37
1g41_A 444 Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dep 99.35
3cmw_A 1706 Protein RECA, recombinase A; homologous recombinat 99.34
1ojl_A 304 Transcriptional regulatory protein ZRAR; response 99.33
2qby_B 384 CDC6 homolog 3, cell division control protein 6 ho 99.32
3pxg_A 468 Negative regulator of genetic competence CLPC/MEC; 99.32
2qby_A 386 CDC6 homolog 1, cell division control protein 6 ho 99.31
3pxi_A 758 Negative regulator of genetic competence CLPC/MEC; 99.3
3bos_A 242 Putative DNA replication factor; P-loop containing 99.29
4fcw_A 311 Chaperone protein CLPB; AAA domain; HET: ADP; 2.35 99.27
1iqp_A 327 RFCS; clamp loader, extended AAA-ATPase domain, co 99.27
1sxj_B 323 Activator 1 37 kDa subunit; clamp loader, processi 99.26
1fnn_A 389 CDC6P, cell division control protein 6; ORC1, AAA 99.25
3pxi_A 758 Negative regulator of genetic competence CLPC/MEC; 99.24
1sxj_D 353 Activator 1 41 kDa subunit; clamp loader, processi 99.24
1njg_A 250 DNA polymerase III subunit gamma; rossman-like fol 99.24
3ec2_A180 DNA replication protein DNAC; helicase loader, rep 99.24
1r6b_X 758 CLPA protein; AAA+, N-terminal domain, CLPS, cryst 99.24
2chq_A 319 Replication factor C small subunit; DNA-binding pr 99.22
2w58_A202 DNAI, primosome component (helicase loader); ATP-b 99.22
1jr3_A 373 DNA polymerase III subunit gamma; processivity, pr 99.18
1g8p_A 350 Magnesium-chelatase 38 kDa subunit; parallel beta 99.17
1qvr_A 854 CLPB protein; coiled coil, AAA ATPase, chaperone; 99.15
1in4_A 334 RUVB, holliday junction DNA helicase RUVB; AAA+-cl 99.12
2r44_A 331 Uncharacterized protein; putative ATPase, structur 99.12
2qgz_A308 Helicase loader, putative primosome component; str 99.11
1sxj_C 340 Activator 1 40 kDa subunit; clamp loader, processi 99.11
3nbx_X 500 ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structu 99.05
1sxj_E 354 Activator 1 40 kDa subunit; clamp loader, processi 99.02
2kjq_A149 DNAA-related protein; solution structure, NESG, st 99.01
1w5s_A 412 Origin recognition complex subunit 2 ORC2; replica 98.91
1ny5_A 387 Transcriptional regulator (NTRC family); AAA+ ATPa 98.81
2vhj_A 331 Ntpase P4, P4; non- hydrolysable ATP analogue, hyd 98.8
2gno_A 305 DNA polymerase III, gamma subunit-related protein; 98.77
3qwz_A211 Transitional endoplasmic reticulum ATPase; UBX, P9 98.75
1a5t_A 334 Delta prime, HOLB; zinc finger, DNA replication; 2 98.7
2qen_A 350 Walker-type ATPase; unknown function; HET: ADP; 2. 98.7
3dzd_A 368 Transcriptional regulator (NTRC family); sigma43 a 98.69
2fna_A 357 Conserved hypothetical protein; structural genomic 98.64
3k1j_A 604 LON protease, ATP-dependent protease LON; ATP-bind 98.63
3cmu_A 2050 Protein RECA, recombinase A; homologous recombinat 98.62
1tue_A212 Replication protein E1; helicase, replication, E1E 98.6
3f9v_A 595 Minichromosome maintenance protein MCM; replicativ 98.59
2r2a_A199 Uncharacterized protein; zonular occludens toxin, 98.48
2cvh_A 220 DNA repair and recombination protein RADB; filamen 98.3
1ye8_A 178 Protein THEP1, hypothetical UPF0334 kinase-like pr 98.29
2zr9_A 349 Protein RECA, recombinase A; recombination, RECA m 98.26
3hr8_A 356 Protein RECA; alpha and beta proteins (A/B, A+B), 98.25
1xp8_A 366 RECA protein, recombinase A; recombination, radior 98.23
2w0m_A 235 SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus 98.23
4akg_A 2695 Glutathione S-transferase class-MU 26 kDa isozyme 98.23
3upu_A 459 ATP-dependent DNA helicase DDA; RECA-like domain, 98.21
1qhx_A178 CPT, protein (chloramphenicol phosphotransferase); 98.19
1u94_A 356 RECA protein, recombinase A; homologous recombinat 98.18
3cmu_A 2050 Protein RECA, recombinase A; homologous recombinat 98.17
2b8t_A 223 Thymidine kinase; deoxyribonucleoside kinase, zinc 98.17
3jvv_A 356 Twitching mobility protein; hexameric P-loop ATPas 98.16
4akg_A 2695 Glutathione S-transferase class-MU 26 kDa isozyme 98.14
1n0w_A 243 DNA repair protein RAD51 homolog 1; DNA repair, ho 98.12
3vaa_A199 Shikimate kinase, SK; structural genomics, center 98.07
3trf_A 185 Shikimate kinase, SK; amino acid biosynthesis, tra 98.04
1w4r_A195 Thymidine kinase; type II, human, cytosolic, phosp 98.03
1svm_A 377 Large T antigen; AAA+ fold, viral protein; HET: AT 98.02
1v5w_A 343 DMC1, meiotic recombination protein DMC1/LIM15 hom 98.02
2z43_A 324 DNA repair and recombination protein RADA; archaea 98.0
2orw_A 184 Thymidine kinase; TMTK, TP4A, transferase; HET: 4T 98.0
2rhm_A 193 Putative kinase; P-loop containing nucleoside trip 97.99
3io5_A 333 Recombination and repair protein; storage dimer, i 97.97
3iij_A180 Coilin-interacting nuclear ATPase protein; alpha a 97.97
2eyu_A 261 Twitching motility protein PILT; pilus retraction 97.97
2p5t_B 253 PEZT; postsegregational killing system, phosphoryl 97.96
2r8r_A 228 Sensor protein; KDPD, PFAM02702, MCSG, structural 97.96
1z6t_A 591 APAF-1, apoptotic protease activating factor 1; ca 97.95
3kb2_A173 SPBC2 prophage-derived uncharacterized protein YOR 97.94
2fz4_A237 DNA repair protein RAD25; RECA-like domain, DNA da 97.93
2dr3_A 247 UPF0273 protein PH0284; RECA superfamily ATPase, h 97.93
3a4m_A 260 L-seryl-tRNA(SEC) kinase; P-loop motif, walker A m 97.92
2ehv_A 251 Hypothetical protein PH0186; KAIC, RECA ATPase, un 97.91
1kag_A173 SKI, shikimate kinase I; transferase, structural g 97.9
2ewv_A 372 Twitching motility protein PILT; pilus retraction 97.89
2iyv_A 184 Shikimate kinase, SK; transferase, aromatic amino 97.89
1gvn_B 287 Zeta; postsegregational killing system, plasmid; 1 97.89
1u0j_A267 DNA replication protein; AAA+ protein, P-loop atpa 97.89
1zp6_A 191 Hypothetical protein ATU3015; alpha-beta protein., 97.89
1y63_A184 LMAJ004144AAA protein; structural genomics, protei 97.89
1via_A175 Shikimate kinase; structural genomics, transferase 97.88
1zuh_A168 Shikimate kinase; alpha-beta protein, transferase; 97.88
3tiw_A187 Transitional endoplasmic reticulum ATPase; beta-ba 97.86
3dm5_A 443 SRP54, signal recognition 54 kDa protein; protein- 97.85
1vma_A 306 Cell division protein FTSY; TM0570, structural gen 97.84
2ze6_A 253 Isopentenyl transferase; crown GALL tumor, cytokin 97.84
1g5t_A196 COB(I)alamin adenosyltransferase; P-loop protein, 97.83
3lw7_A 179 Adenylate kinase related protein (ADKA-like); AMP, 97.81
2cdn_A 201 Adenylate kinase; phosphoryl transfer, associative 97.8
1e6c_A173 Shikimate kinase; phosphoryl transfer, ADP, shikim 97.79
3kl4_A 433 SRP54, signal recognition 54 kDa protein; signal r 97.79
4a74_A 231 DNA repair and recombination protein RADA; hydrola 97.78
2c95_A 196 Adenylate kinase 1; transferase, AP4A, nucleotide 97.78
1tev_A 196 UMP-CMP kinase; ploop, NMP binding region, LID reg 97.78
3tlx_A 243 Adenylate kinase 2; structural genomics, structura 97.77
3t61_A 202 Gluconokinase; PSI-biology, structural genomics, p 97.77
1aky_A 220 Adenylate kinase; ATP:AMP phosphotransferase, myok 97.76
1pzn_A 349 RAD51, DNA repair and recombination protein RAD51, 97.75
1zd8_A 227 GTP:AMP phosphotransferase mitochondrial; ATP:AMP 97.75
3cm0_A 186 Adenylate kinase; ATP-binding, cytoplasm, nucleoti 97.74
2vli_A 183 Antibiotic resistance protein; transferase, tunica 97.73
3dl0_A 216 Adenylate kinase; phosphotransferase, zinc coordin 97.72
2pt5_A168 Shikimate kinase, SK; aromatic amino acid biosynth 97.72
3fb4_A 216 Adenylate kinase; psychrophIle, phosphotransferase 97.72
1qf9_A 194 UMP/CMP kinase, protein (uridylmonophosphate/cytid 97.71
1ly1_A 181 Polynucleotide kinase; PNK, phosphatase, transfera 97.71
3sfz_A 1249 APAF-1, apoptotic peptidase activating factor 1; a 97.71
3e1s_A 574 Exodeoxyribonuclease V, subunit RECD; alpha and be 97.71
1kht_A 192 Adenylate kinase; phosphotransferase, signaling pr 97.7
2bwj_A 199 Adenylate kinase 5; phosphoryl transfer reaction, 97.7
3lda_A 400 DNA repair protein RAD51; DNA binding protein, ATP 97.7
1knq_A175 Gluconate kinase; ALFA/beta structure, transferase 97.7
1ak2_A 233 Adenylate kinase isoenzyme-2; nucleoside monophosp 97.7
4eun_A200 Thermoresistant glucokinase; putative sugar kinase 97.69
2pez_A179 Bifunctional 3'-phosphoadenosine 5'- phosphosulfat 97.69
3be4_A 217 Adenylate kinase; malaria, cryptosporidium parvum 97.69
3uie_A200 Adenylyl-sulfate kinase 1, chloroplastic; rossmann 97.68
2pt7_A330 CAG-ALFA; ATPase, protein-protein complex, type IV 97.68
3umf_A 217 Adenylate kinase; rossmann fold, transferase; 2.05 97.67
1zak_A 222 Adenylate kinase; ATP:AMP-phosphotransferase, tran 97.67
1ukz_A 203 Uridylate kinase; transferase; HET: ADP AMP; 1.90A 97.66
2ga8_A 359 Hypothetical 39.9 kDa protein; YFR007W, YFH7, unkn 97.66
1p9r_A 418 General secretion pathway protein E; bacterial typ 97.66
2i1q_A 322 DNA repair and recombination protein RADA; ATPase, 97.64
1nks_A 194 Adenylate kinase; thermophilic, transferase; HET: 97.64
3cmw_A 1706 Protein RECA, recombinase A; homologous recombinat 97.63
3sr0_A 206 Adenylate kinase; phosphoryl transfer analogue, AL 97.63
3crm_A 323 TRNA delta(2)-isopentenylpyrophosphate transferase 97.61
2a5y_B 549 CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis 97.6
3f8t_A 506 Predicted ATPase involved in replication control, 97.6
2pbr_A 195 DTMP kinase, thymidylate kinase; transferase, nucl 97.59
2zts_A 251 Putative uncharacterized protein PH0186; KAIC like 97.59
2jaq_A 205 Deoxyguanosine kinase; transferase, deoxyribonucle 97.57
1cke_A 227 CK, MSSA, protein (cytidine monophosphate kinase); 97.57
2r6a_A 454 DNAB helicase, replicative helicase; replication, 97.57
1e4v_A 214 Adenylate kinase; transferase(phosphotransferase); 97.55
3nwj_A 250 ATSK2; P loop, shikimate, nucleoside monophosphate 97.54
2xb4_A 223 Adenylate kinase; ATP-binding, nucleotide-binding, 97.54
2v54_A 204 DTMP kinase, thymidylate kinase; nucleotide biosyn 97.54
2qor_A 204 Guanylate kinase; phosphotransferase, purine metab 97.53
2z0h_A 197 DTMP kinase, thymidylate kinase; ATP-binding, nucl 97.53
3vkg_A 3245 Dynein heavy chain, cytoplasmic; AAA+ protein, mol 97.53
2if2_A 204 Dephospho-COA kinase; alpha-beta protein, structur 97.52
2oap_1 511 GSPE-2, type II secretion system protein; hexameri 97.51
2yvu_A186 Probable adenylyl-sulfate kinase; transferase, str 97.49
1xx6_A191 Thymidine kinase; NESG, northeast structural genom 97.48
3foz_A 316 TRNA delta(2)-isopentenylpyrophosphate transferas; 97.47
3a8t_A 339 Adenylate isopentenyltransferase; rossmann fold pr 97.45
3r20_A 233 Cytidylate kinase; structural genomics, seattle st 97.45
3ake_A 208 Cytidylate kinase; CMP kinase, CMP complex, open c 97.44
2grj_A 192 Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosp 97.42
2bbw_A 246 Adenylate kinase 4, AK4; nucleotide kinase, nucleo 97.41
2plr_A 213 DTMP kinase, probable thymidylate kinase; TMP-bind 97.4
2q6t_A 444 DNAB replication FORK helicase; hydrolase; 2.90A { 97.4
2yhs_A 503 FTSY, cell division protein FTSY; cell cycle, prot 97.39
4e22_A 252 Cytidylate kinase; P-loop, CMP/ATP binding, transf 97.38
1ex7_A 186 Guanylate kinase; substrate-induced FIT, domain mo 97.38
3exa_A 322 TRNA delta(2)-isopentenylpyrophosphate transferase 97.38
1kgd_A180 CASK, peripheral plasma membrane CASK; maguk, guan 97.37
1m7g_A 211 Adenylylsulfate kinase; APS kinase, transferase, s 97.37
2px0_A296 Flagellar biosynthesis protein FLHF; SRP GTPase, f 97.36
1jjv_A 206 Dephospho-COA kinase; P-loop nucleotide-binding fo 97.36
1uj2_A 252 Uridine-cytidine kinase 2; alpha/beta mononucleoti 97.34
4b3f_X 646 DNA-binding protein smubp-2; hydrolase, helicase; 97.34
1uf9_A 203 TT1252 protein; P-loop, nucleotide binding domain, 97.33
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 97.33
2j41_A 207 Guanylate kinase; GMP, GMK, transferase, ATP-bindi 97.32
2wwf_A 212 Thymidilate kinase, putative; transferase, malaria 97.32
1vht_A 218 Dephospho-COA kinase; structural genomics, transfe 97.29
2bdt_A 189 BH3686; alpha-beta protein, structural genomics, P 97.27
3tr0_A 205 Guanylate kinase, GMP kinase; purines, pyrimidines 97.27
3b6e_A216 Interferon-induced helicase C domain-containing P; 97.27
3d3q_A 340 TRNA delta(2)-isopentenylpyrophosphate transferase 97.27
3tau_A 208 Guanylate kinase, GMP kinase; structural genomics, 97.27
2qt1_A 207 Nicotinamide riboside kinase 1; non-protein kinase 97.25
3zvl_A416 Bifunctional polynucleotide phosphatase/kinase; hy 97.25
1zu4_A 320 FTSY; GTPase, signal recognition particle, SRP, re 97.25
3e70_C 328 DPA, signal recognition particle receptor; FTSY, S 97.23
1q3t_A 236 Cytidylate kinase; nucleotide monophosphate kinase 97.23
2h92_A 219 Cytidylate kinase; rossmann fold, transferase; HET 97.23
2qmh_A205 HPR kinase/phosphorylase; V267F mutation, ATP-bind 97.22
1rz3_A201 Hypothetical protein rbstp0775; MCSG, structural g 97.21
2v3c_C 432 SRP54, signal recognition 54 kDa protein; nucleoti 97.21
1nn5_A 215 Similar to deoxythymidylate kinase (thymidylate K; 97.2
1htw_A158 HI0065; nucleotide-binding fold, structural genomi 97.19
1lvg_A 198 Guanylate kinase, GMP kinase; transferase; HET: AD 97.18
2jv2_A83 Putative uncharacterized protein PH1500; AAA ATPas 97.18
3eph_A 409 TRNA isopentenyltransferase; transferase, alternat 97.17
2gza_A361 Type IV secretion system protein VIRB11; ATPase, h 97.16
2j9r_A214 Thymidine kinase; TK1, DNK, lasso, transferase, AT 97.15
1ltq_A 301 Polynucleotide kinase; phosphatase, alpha/beta, P- 97.15
3a00_A 186 Guanylate kinase, GMP kinase; domain movement, dim 97.14
1z6g_A 218 Guanylate kinase; structural genomics, SGC, struct 97.14
2j37_W 504 Signal recognition particle 54 kDa protein (SRP54) 97.14
2f6r_A 281 COA synthase, bifunctional coenzyme A synthase; 18 97.12
1tf7_A 525 KAIC; homohexamer, hexamer, circadian clock protei 97.12
3c8u_A 208 Fructokinase; YP_612366.1, putative fructose trans 97.12
3ney_A 197 55 kDa erythrocyte membrane protein; structural ge 97.09
3asz_A 211 Uridine kinase; cytidine phosphorylation, transfer 97.09
1c9k_A 180 COBU, adenosylcobinamide kinase; alpha/beta struct 97.09
1cr0_A 296 DNA primase/helicase; RECA-type protein fold, tran 97.07
2axn_A 520 6-phosphofructo-2-kinase/fructose-2,6- biphosphata 97.05
1znw_A 207 Guanylate kinase, GMP kinase; ATP:GMP-phosphotrans 97.03
3fdi_A 201 Uncharacterized protein; cytidylate kinase like pr 97.03
2v9p_A 305 Replication protein E1; AAA+ molecular motor, DNA 97.02
1s96_A 219 Guanylate kinase, GMP kinase; E.coli, dimer, SAD, 97.0
3bh0_A 315 DNAB-like replicative helicase; ATPase, replicatio 96.98
2xau_A 773 PRE-mRNA-splicing factor ATP-dependent RNA helica; 96.97
2xxa_A 433 Signal recognition particle protein; protein trans 96.96
1x6v_B 630 Bifunctional 3'-phosphoadenosine 5'- phosphosulfat 96.95
3b9q_A 302 Chloroplast SRP receptor homolog, alpha subunit CP 96.95
2jeo_A 245 Uridine-cytidine kinase 1; UCK, transferase, ATP-b 96.95
3thx_B 918 DNA mismatch repair protein MSH3; ABC family ATPas 96.93
1j8m_F297 SRP54, signal recognition 54 kDa protein; signalin 96.93
4gp7_A171 Metallophosphoesterase; polynucleotide kinase phos 96.92
1odf_A 290 YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser 96.88
1ls1_A295 Signal recognition particle protein; FFH, SRP54, S 96.87
2og2_A 359 Putative signal recognition particle receptor; nuc 96.84
1gtv_A 214 TMK, thymidylate kinase; transferase, transferase 96.83
3lnc_A 231 Guanylate kinase, GMP kinase; ALS collaborative cr 96.82
1a7j_A 290 Phosphoribulokinase; transferase, calvin cycle; 2. 96.8
2orv_A 234 Thymidine kinase; TP4A (P1-(5'-adenosyl)P4-(5'- (2 96.79
4eaq_A 229 DTMP kinase, thymidylate kinase; structural genomi 96.78
1nlf_A 279 Regulatory protein REPA; replicative DNA helicase 96.76
1sky_E 473 F1-ATPase, F1-ATP synthase; F1FO ATP synthase, alp 96.76
3tif_A 235 Uncharacterized ABC transporter ATP-binding prote; 96.73
3thx_A 934 DNA mismatch repair protein MSH2; ABC family ATPas 96.73
3p32_A 355 Probable GTPase RV1496/MT1543; structural genomics 96.73
3hdt_A 223 Putative kinase; structura genomics, PSI-2, protei 96.72
3gmt_A 230 Adenylate kinase; ssgcid, ATP-BIN cytoplasm, nucle 96.72
3tqf_A181 HPR(Ser) kinase; transferase, hydrolase; 2.80A {Co 96.72
2qm8_A 337 GTPase/ATPase; G protein, G3E, metallochaperone, c 96.7
1m8p_A573 Sulfate adenylyltransferase; rossmann fold, phosph 96.68
2fwr_A 472 DNA repair protein RAD25; DNA unwinding, XPB, DNA 96.68
2hf9_A 226 Probable hydrogenase nickel incorporation protein 96.68
2i3b_A 189 HCR-ntpase, human cancer-related ntpase; AAA, ross 96.67
2cbz_A 237 Multidrug resistance-associated protein 1; ABC pro 96.65
3aez_A 312 Pantothenate kinase; transferase, homodimer, COA b 96.65
1xjc_A169 MOBB protein homolog; structural genomics, midwest 96.65
1np6_A174 Molybdopterin-guanine dinucleotide biosynthesis pr 96.63
2ffh_A 425 Protein (FFH); SRP54, signal recognition particle, 96.63
1rj9_A 304 FTSY, signal recognition protein; SRP-GTPase domai 96.59
4a1f_A 338 DNAB helicase, replicative DNA helicase; hydrolase 96.59
2pcj_A 224 ABC transporter, lipoprotein-releasing system ATP- 96.58
1b0u_A 262 Histidine permease; ABC transporter, transport pro 96.57
2onk_A 240 Molybdate/tungstate ABC transporter, ATP-binding p 96.55
1mv5_A 243 LMRA, multidrug resistance ABC transporter ATP-bin 96.54
3bgw_A 444 DNAB-like replicative helicase; ATPase, replicatio 96.52
3kta_A182 Chromosome segregation protein SMC; structural mai 96.52
2zu0_C 267 Probable ATP-dependent transporter SUFC; iron-sulf 96.52
2ged_A193 SR-beta, signal recognition particle receptor beta 96.52
1sgw_A 214 Putative ABC transporter; structural genomics, P p 96.5
3fvq_A 359 Fe(3+) IONS import ATP-binding protein FBPC; nucle 96.5
3vkw_A 446 Replicase large subunit; alpha/beta domain, helica 96.49
2olj_A 263 Amino acid ABC transporter; ABC domain, ATPase, hy 96.49
2ghi_A 260 Transport protein; multidrug resistance protein, M 96.49
3cr8_A 552 Sulfate adenylyltranferase, adenylylsulfate kinase 96.48
2ixe_A 271 Antigen peptide transporter 1; ABC ATPase, hydrola 96.47
3e2i_A219 Thymidine kinase; Zn-binding, ATP-binding, DNA syn 96.47
2d2e_A 250 SUFC protein; ABC-ATPase, SUF protein, 310-helix, 96.47
1sq5_A 308 Pantothenate kinase; P-loop, transferase; HET: PAU 96.47
1g6h_A 257 High-affinity branched-chain amino acid transport 96.46
2pze_A 229 Cystic fibrosis transmembrane conductance regulat; 96.45
1vpl_A 256 ABC transporter, ATP-binding protein; TM0544, stru 96.45
1ji0_A 240 ABC transporter; ATP binding protein, structural g 96.43
2yz2_A 266 Putative ABC transporter ATP-binding protein TM_0; 96.43
3gfo_A 275 Cobalt import ATP-binding protein CBIO 1; structur 96.43
2ff7_A 247 Alpha-hemolysin translocation ATP-binding protein 96.43
2it1_A 362 362AA long hypothetical maltose/maltodextrin trans 96.42
3b85_A 208 Phosphate starvation-inducible protein; PHOH2, ATP 96.41
2yyz_A 359 Sugar ABC transporter, ATP-binding protein; sugar 96.41
1v43_A 372 Sugar-binding transport ATP-binding protein; ATPas 96.41
3rlf_A 381 Maltose/maltodextrin import ATP-binding protein M; 96.41
1wb9_A 800 DNA mismatch repair protein MUTS; DNA-binding, ATP 96.4
3tqc_A 321 Pantothenate kinase; biosynthesis of cofactors, pr 96.39
4g1u_C 266 Hemin import ATP-binding protein HMUV; membrane tr 96.39
2qi9_C 249 Vitamin B12 import ATP-binding protein BTUD; inner 96.39
2gk6_A 624 Regulator of nonsense transcripts 1; UPF1, helicas 96.37
1bif_A 469 6-phosphofructo-2-kinase/ fructose-2,6-bisphospha; 96.37
2ocp_A 241 DGK, deoxyguanosine kinase; protein-nucleotide com 96.36
4i1u_A 210 Dephospho-COA kinase; structural genomics, niaid, 96.36
1z47_A 355 CYSA, putative ABC-transporter ATP-binding protein 96.36
3d31_A 348 Sulfate/molybdate ABC transporter, ATP-binding pro 96.36
2ihy_A 279 ABC transporter, ATP-binding protein; ATPase, ABC 96.32
4edh_A 213 DTMP kinase, thymidylate kinase; structural genomi 96.31
2nq2_C 253 Hypothetical ABC transporter ATP-binding protein H 96.31
2p67_A 341 LAO/AO transport system kinase; ARGK, structural G 96.29
1g29_1 372 MALK, maltose transport protein MALK; ATPase, acti 96.28
1g8f_A511 Sulfate adenylyltransferase; alpha-beta protein, b 96.28
2wsm_A 221 Hydrogenase expression/formation protein (HYPB); m 96.27
3h1t_A 590 Type I site-specific restriction-modification syst 96.27
1gm5_A 780 RECG; helicase, replication restart; HET: DNA ADP; 96.26
1q57_A 503 DNA primase/helicase; dntpase, DNA replication, tr 96.26
3sop_A 270 Neuronal-specific septin-3; hydrolase; HET: GDP; 2 96.24
1cz4_A185 VCP-like ATPase; double-PSI beta-barrel, beta-CLAM 96.22
1lw7_A 365 Transcriptional regulator NADR; NMN, NMN adenylyl 96.2
1p5z_B 263 DCK, deoxycytidine kinase; nucleoside kinase, P-lo 96.2
3gd7_A 390 Fusion complex of cystic fibrosis transmembrane co 96.19
1oxx_K 353 GLCV, glucose, ABC transporter, ATP binding protei 96.17
4ag6_A 392 VIRB4 ATPase, type IV secretory pathway VIRB4 comp 96.16
2pjz_A 263 Hypothetical protein ST1066; ATP binding protein, 96.15
2f9l_A 199 RAB11B, member RAS oncogene family; RAB11B GTPase, 96.13
2f1r_A171 Molybdopterin-guanine dinucleotide biosynthesis pr 96.12
2bbs_A 290 Cystic fibrosis transmembrane conductance regulato 96.12
1oix_A191 RAS-related protein RAB-11A; small G protein, intr 96.1
3tmk_A 216 Thymidylate kinase; phosphotransferase; HET: T5A; 96.09
1nrj_B 218 SR-beta, signal recognition particle receptor beta 96.08
1wp9_A 494 ATP-dependent RNA helicase, putative; ATPase, DNA 96.07
2npi_A 460 Protein CLP1; CLP1-PCF11 complex, ATP binding, ter 96.07
2gks_A546 Bifunctional SAT/APS kinase; transferase, sulfuryl 96.07
2qtf_A 364 Protein HFLX, GTP-binding protein; beta-alpha-barr 96.05
3tui_C 366 Methionine import ATP-binding protein METN; ABC-tr 96.04
1f2t_A149 RAD50 ABC-ATPase; DNA double-strand break repair, 96.01
3nh6_A 306 ATP-binding cassette SUB-family B member 6, mitoc; 96.01
1ewq_A 765 DNA mismatch repair protein MUTS; multiple domains 96.01
2wjy_A 800 Regulator of nonsense transcripts 1; nonsense medi 96.0
2dyk_A161 GTP-binding protein; GTPase, ribosome-binding prot 96.0
3v9p_A 227 DTMP kinase, thymidylate kinase; ssgcid, STRU geno 95.95
3k53_A 271 Ferrous iron transport protein B; GTPase fold, hel 95.95
1tf7_A 525 KAIC; homohexamer, hexamer, circadian clock protei 95.93
3oiy_A 414 Reverse gyrase helicase domain; topoisomerase, DNA 95.93
1z2a_A168 RAS-related protein RAB-23; RAB GTPase, vesicular 95.92
1w36_D 608 RECD, exodeoxyribonuclease V alpha chain; recombin 95.89
2dpy_A 438 FLII, flagellum-specific ATP synthase; beta barrel 95.89
2o8b_B 1022 DNA mismatch repair protein MSH6; DNA damage respo 95.88
2zej_A 184 Dardarin, leucine-rich repeat kinase 2; parkinson' 95.88
1kao_A167 RAP2A; GTP-binding protein, small G protein, GDP, 95.87
2wji_A165 Ferrous iron transport protein B homolog; membrane 95.87
3lv8_A 236 DTMP kinase, thymidylate kinase; structural genomi 95.85
1nij_A 318 Hypothetical protein YJIA; structural genomics, P- 95.85
3tbk_A 555 RIG-I helicase domain; DECH helicase, ATP binding, 95.85
1tq4_A 413 IIGP1, interferon-inducible GTPase; interferon gam 95.84
3vkg_A 3245 Dynein heavy chain, cytoplasmic; AAA+ protein, mol 95.83
2v6i_A 431 RNA helicase; membrane, hydrolase, transmembrane, 95.82
1ek0_A170 Protein (GTP-binding protein YPT51); vesicular tra 95.79
2ce2_X166 GTPase HRAS; signaling protein, guanine nucleotide 95.79
1u8z_A168 RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNH 95.77
2lkc_A178 Translation initiation factor IF-2; NMR {Geobacill 95.76
2nzj_A175 GTP-binding protein REM 1; GDP/GTP binding, GTP hy 95.76
1z0j_A170 RAB-22, RAS-related protein RAB-22A; RAB GTPase, R 95.76
3ld9_A 223 DTMP kinase, thymidylate kinase; ssgcid, NIH, niai 95.76
2vp4_A 230 Deoxynucleoside kinase; ATP-binding, DNA synthesis 95.75
2qag_B 427 Septin-6, protein NEDD5; cell cycle, cell division 95.74
1z08_A170 RAS-related protein RAB-21; RAB GTPase, vesicular 95.74
1wms_A177 RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, p 95.73
1upt_A171 ARL1, ADP-ribosylation factor-like protein 1; hydr 95.71
1ky3_A182 GTP-binding protein YPT7P; vesicular traffic, GTP 95.71
2obl_A 347 ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O 95.71
1pui_A 210 ENGB, probable GTP-binding protein ENGB; structura 95.68
1c1y_A167 RAS-related protein RAP-1A; GTP-binding proteins, 95.67
1g16_A170 RAS-related protein SEC4; G protein RAB, signaling 95.67
1ko7_A314 HPR kinase/phosphatase; protein kinase, phosphotra 95.67
1r2q_A170 RAS-related protein RAB-5A; GTPase, GNP, atomic re 95.66
2xzl_A 802 ATP-dependent helicase NAM7; hydrolase-RNA complex 95.64
2wjg_A 188 FEOB, ferrous iron transport protein B homolog; me 95.63
3iby_A 256 Ferrous iron transport protein B; G protein, G dom 95.63
1r8s_A164 ADP-ribosylation factor 1; protein transport/excha 95.63
4a2p_A 556 RIG-I, retinoic acid inducible protein I; hydrolas 95.63
2erx_A172 GTP-binding protein DI-RAS2; GTP hydrolysis, trans 95.62
3bc1_A 195 RAS-related protein RAB-27A; RAB27, GTPase, RAB, s 95.61
3q85_A169 GTP-binding protein REM 2; G-domain, CAV2 beta, si 95.61
3dmq_A 968 RNA polymerase-associated protein RAPA; SWF2/SNF2, 95.58
4tmk_A 213 Protein (thymidylate kinase); ATP:DTMP phosphotran 95.57
3a1s_A 258 Iron(II) transport protein B; FEOB, iron transport 95.56
3q72_A166 GTP-binding protein RAD; G-domain, CAV2 beta, sign 95.56
1z0f_A179 RAB14, member RAS oncogene family; RAB GTPase, ves 95.55
4dsu_A 189 GTPase KRAS, isoform 2B; small G-protein, signalin 95.53
3ice_A 422 Transcription termination factor RHO; transcriptio 95.51
2fn4_A181 P23, RAS-related protein R-RAS; GDP/GTP binding, G 95.5
3clv_A 208 RAB5 protein, putative; malaria, GTPase, structura 95.5
2y8e_A179 RAB-protein 6, GH09086P, RAB6; hydrolase, nucleoti 95.49
3con_A190 GTPase NRAS; structural genomics consortium, SGC, 95.49
2oil_A193 CATX-8, RAS-related protein RAB-25; G-protein, GDP 95.49
2hxs_A178 RAB-26, RAS-related protein RAB-28; GTPase, signal 95.47
2a9k_A187 RAS-related protein RAL-A; bacterial ADP-ribosyltr 95.47
3tw8_B181 RAS-related protein RAB-35; longin domain, RAB GTP 95.47
2efe_B181 Small GTP-binding protein-like; GEF, GTPase, VPS9, 95.47
1m7b_A184 RND3/RHOE small GTP-binding protein; small GTPase, 95.46
2gj8_A172 MNME, tRNA modification GTPase TRME; G-domain dime 95.45
3qks_A 203 DNA double-strand break repair RAD50 ATPase; RECA- 95.44
2atv_A196 RERG, RAS-like estrogen-regulated growth inhibitor 95.41
2bme_A186 RAB4A, RAS-related protein RAB4A; GTP-binding prot 95.41
1mh1_A 186 RAC1; GTP-binding, GTPase, small G-protein, RHO fa 95.39
3kkq_A183 RAS-related protein M-RAS; GTP-binding, GTPase, si 95.39
1svi_A195 GTP-binding protein YSXC; ENGB, GTPase, GDP, hydro 95.38
3b1v_A 272 Ferrous iron uptake transporter protein B; G prote 95.38
3bfv_A 271 CAPA1, CAPB2, membrane protein CAPA1, protein tyro 95.38
2g6b_A180 RAS-related protein RAB-26; G-protein, GTP analogu 95.37
1yrb_A 262 ATP(GTP)binding protein; GTPase, P-loop, rossman f 95.37
1yqt_A 538 RNAse L inhibitor; ATP-binding cassette, ribosome 95.35
3ihw_A184 Centg3; RAS, centaurin, GTPase, structural genomic 95.34
1knx_A312 Probable HPR(Ser) kinase/phosphatase; HPR kinase, 95.33
3t1o_A 198 Gliding protein MGLA; G domain containing protein, 95.31
3tkl_A 196 RAS-related protein RAB-1A; vesicle trafficking, p 95.3
3c5c_A187 RAS-like protein 12; GDP, GTPase, structural genom 95.3
3hjn_A 197 DTMP kinase, thymidylate kinase; ATP-binding, nucl 95.3
2p5s_A199 RAS and EF-hand domain containing; G-protein, RAB, 95.3
2gf9_A189 RAS-related protein RAB-3D; G-protein, structural 95.3
1m2o_B190 GTP-binding protein SAR1, GTP binding protein; zin 95.28
3bwd_D182 RAC-like GTP-binding protein ARAC6; G domain, cyto 95.27
1jr3_D 343 DNA polymerase III, delta subunit; processivity, p 95.27
2eyq_A 1151 TRCF, transcription-repair coupling factor; MFD, S 95.27
2bov_A 206 RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, 95.26
3i8s_A 274 Ferrous iron transport protein B; GTPase, GPCR, ir 95.26
1vg8_A 207 RAS-related protein RAB-7; GTP-binding protein, pr 95.24
3euj_A 483 Chromosome partition protein MUKB, linker; MUKB, M 95.24
2cxx_A 190 Probable GTP-binding protein ENGB; structural geno 95.23
3pqc_A195 Probable GTP-binding protein ENGB; rossmann fold, 95.23
1z06_A189 RAS-related protein RAB-33B; RAB GTPase, RAB33B GT 95.23
1oyw_A 523 RECQ helicase, ATP-dependent DNA helicase; winged 95.22
3qf7_A 365 RAD50; ABC-ATPase, ATPase, hydrolase; HET: ANP; 1. 95.22
4hlc_A 205 DTMP kinase, thymidylate kinase; TMK, MRSA, pipiri 95.22
2a5j_A191 RAS-related protein RAB-2B; GTPase, signal transdu 95.21
2gxq_A207 Heat resistant RNA dependent ATPase; RNA helicase, 95.21
2rcn_A358 Probable GTPase ENGC; YJEQ, circularly permuted, G 95.21
1zd9_A188 ADP-ribosylation factor-like 10B; transport protei 95.2
1x3s_A 195 RAS-related protein RAB-18; GTPase, GNP, structura 95.19
3dz8_A191 RAS-related protein RAB-3B; GDP, GTPase, structura 95.18
1e9r_A 437 Conjugal transfer protein TRWB; coupling protein, 95.18
3cio_A 299 ETK, tyrosine-protein kinase ETK; WZC, escherichia 95.17
2fg5_A192 RAB-22B, RAS-related protein RAB-31; G-protein, GT 95.17
3reg_A194 RHO-like small GTPase; cytoskeleton, nucleotide-bi 95.16
3t5g_A181 GTP-binding protein RHEB; immunoglobulin-like beta 95.16
2iwr_A178 Centaurin gamma 1; ANK repeat, zinc-finger, GTP-bi 95.15
4gl2_A 699 Interferon-induced helicase C domain-containing P; 95.15
3b5x_A 582 Lipid A export ATP-binding/permease protein MSBA; 95.14
2b6h_A192 ADP-ribosylation factor 5; membrane trafficking, G 95.14
1qhl_A 227 Protein (cell division protein MUKB); SMC, chromos 95.12
2yv5_A302 YJEQ protein; hydrolase, GTPase, permutation, stru 95.09
2www_A 349 Methylmalonic aciduria type A protein, mitochondri 95.09
1fzq_A181 ADP-ribosylation factor-like protein 3; protein-GD 95.08
1zbd_A 203 Rabphilin-3A; G protein, effector, RABCDR, synapti 95.07
2bcg_Y 206 Protein YP2, GTP-binding protein YPT1; RABGTPase, 95.07
2gf0_A 199 GTP-binding protein DI-RAS1; GDP/GTP binding, GTP 95.07
3cph_A 213 RAS-related protein SEC4; RAB GTPase, prenylation, 95.06
1ksh_A186 ARF-like protein 2; small GTPase, small GTP-bindin 95.04
3oes_A201 GTPase rhebl1; small GTPase, structural genomics, 95.04
1qde_A224 EIF4A, translation initiation factor 4A; DEAD box 95.04
2fh5_B 214 SR-beta, signal recognition particle receptor beta 95.03
1u0l_A301 Probable GTPase ENGC; permutation, OB-fold, zinc-f 95.01
1gwn_A205 RHO-related GTP-binding protein RHOE; GTPase, inac 94.99
1moz_A183 ARL1, ADP-ribosylation factor-like protein 1; GTP- 94.98
>3cf2_A TER ATPase, transitional endoplasmic reticulum ATPase, valosi; AAA, CDC48, ERAD, transport protein; HET: ADP ANP; 3.50A {Mus musculus} PDB: 3cf1_A* 3cf3_A* 1r7r_A* Back     alignment and structure
Probab=100.00  E-value=1.2e-32  Score=245.91  Aligned_cols=189  Identities=89%  Similarity=1.430  Sum_probs=176.8

Q ss_pred             cchhhHHHHhHHHhhhcCcccccCCEEEEecCcceEEEEEEEecCCCeEEEcCceEEEEcCCCCcchhHHhhcCCCCccc
Q psy6208           8 EMSNLFEVYLKPYFLEAYRPVHKDDLFIVRGGMRAVEFKIVDTDPAPYCIVAADTVIHCEGDPIKREEEEEASNAVGYDD   87 (197)
Q Consensus         8 ~~~~~~~~f~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~   87 (197)
                      .....+..++++||.+.++++..|+.+.+......+.|+|+.++|.+.+.+...|.+.+...+..........+.++|+|
T Consensus       126 ~~~~~~~~~l~~~~~~~~~~v~~gd~~~v~~~~~~~~f~V~~~~P~~~~~v~~~T~i~~~~~~~~~~~~~~~~~~v~~~d  205 (806)
T 3cf2_A          126 ITGNLFEVYLKPYFLEAYRPIRKGDIFLVRGGMRAVEFKVVETDPSPYCIVAPDTVIHCEGEPIKREDEEESLNEVGYDD  205 (806)
T ss_dssp             CCSCHHHHTHHHHHTTTCCEEETTCEEEECCTTSCEEEEEEEESSSSEEECCTTSBCCBCSCCBCCCTTSCCSSSCCGGG
T ss_pred             cchhHHHHHHHHHHHhcCCcccCCCEEEEecCCcEEEEEEEEEeCCCCeEECCCcEEEEeccccCcccccccCCCCChhh
Confidence            34567888999999999999999999999999999999999999999999999999998887776655555667899999


Q ss_pred             ccCcHHHHHHHHHHHHhcccChhhHhhhCCCCCCceEEECCCCCcHHHHHHHHHHHhCCeEEEEechhhhhhccCccHHH
Q psy6208          88 IGGCRKQLAQIKEMVELPLRHPSLFKAIGVKPPRGILLYGPPGTGKTLIARAVANETGAFFFLINGPEIMSKLAGESESN  167 (197)
Q Consensus        88 i~g~~~~~~~l~~~v~~~~~~~~~~~~~~~~~~~~ill~G~~GtGKT~la~ala~~~~~~~~~v~~~~~~~~~~~~~~~~  167 (197)
                      |+|+++++++|++.+..++.+|+.|..+|+.++++||||||||||||++|+++|++++.+++.++++++.+.+.++++..
T Consensus       206 IgGl~~~~~~l~e~v~~pl~~p~~f~~~g~~~p~GILL~GPPGTGKT~LAraiA~elg~~~~~v~~~~l~sk~~gese~~  285 (806)
T 3cf2_A          206 IGGCRKQLAQIKEMVELPLRHPALFKAIGVKPPRGILLYGPPGTGKTLIARAVANETGAFFFLINGPEIMSKLAGESESN  285 (806)
T ss_dssp             CCSCCTTHHHHHHHHHHHHHCCGGGTSCCCCCCCEEEEECCTTSCHHHHHHHHHTTTTCEEEEEEHHHHHSSCTTHHHHH
T ss_pred             hcCHHHHHHHHHHHHHHHccCHHHHhhcCCCCCCeEEEECCCCCCHHHHHHHHHHHhCCeEEEEEhHHhhcccchHHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHhcCCCeEEEEcccCccCcccC
Q psy6208         168 LRKAFEEADKNSPSIIFIDELDAIAPKRE  196 (197)
Q Consensus       168 ~~~~~~~a~~~~~~vl~lDeid~l~~~r~  196 (197)
                      ++.+|+.|...+|+||||||+|.|+++|+
T Consensus       286 lr~lF~~A~~~~PsIIfIDEiDal~~~r~  314 (806)
T 3cf2_A          286 LRKAFEEAEKNAPAIIFIDELDAIAPKRE  314 (806)
T ss_dssp             HHHHHHHHTTSCSEEEEEESGGGTCCTTT
T ss_pred             HHHHHHHHHHcCCeEEEEehhcccccccC
Confidence            99999999999999999999999999875



>4b4t_J 26S protease regulatory subunit 8 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3hu3_A Transitional endoplasmic reticulum ATPase; VCP, transport protein; HET: AGS; 2.20A {Homo sapiens} PDB: 3hu2_A* 3hu1_A* 1e32_A* 1s3s_A* Back     alignment and structure
>4b4t_I 26S protease regulatory subunit 4 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_L 26S protease subunit RPT4; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_H 26S protease regulatory subunit 7 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_M 26S protease regulatory subunit 6A; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_K 26S protease regulatory subunit 6B homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3cf2_A TER ATPase, transitional endoplasmic reticulum ATPase, valosi; AAA, CDC48, ERAD, transport protein; HET: ADP ANP; 3.50A {Mus musculus} PDB: 3cf1_A* 3cf3_A* 1r7r_A* Back     alignment and structure
>3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} Back     alignment and structure
>1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens} Back     alignment and structure
>3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C Back     alignment and structure
>3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} Back     alignment and structure
>2qp9_X Vacuolar protein sorting-associated protein 4; ATPase domain, beta domain, C-terminal helix, ATP-binding, E nucleotide-binding; 2.90A {Saccharomyces cerevisiae} PDB: 2qpa_A* Back     alignment and structure
>2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} Back     alignment and structure
>2ce7_A Cell division protein FTSH; metalloprotease; HET: ADP; 2.44A {Thermotoga maritima} SCOP: a.269.1.1 c.37.1.20 PDB: 2cea_A* 3kds_E* Back     alignment and structure
>2x8a_A Nuclear valosin-containing protein-like; nuclear protein; 2.60A {Homo sapiens} Back     alignment and structure
>1lv7_A FTSH; alpha/beta domain, four helix bundle, hydrolase; 1.50A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} Back     alignment and structure
>2zan_A Vacuolar protein sorting-associating protein 4B; SKD1, VPS4B, AAA ATPase, ATP-binding, coiled coil, membrane, nucleotide-binding, phosphorylation; HET: ATP; 3.00A {Mus musculus} PDB: 2zam_A* 2zao_A* 2jqh_A 2jqk_A 1wr0_A 2jq9_A 2k3w_A 1yxr_A Back     alignment and structure
>3d8b_A Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, structural genomics consortium, ATP- hydrolase, magnesium, metal-binding, nucleotide-binding; HET: ADP; 2.00A {Homo sapiens} Back     alignment and structure
>3vfd_A Spastin; ATPase, microtubule severing, hydrolase; 3.30A {Homo sapiens} Back     alignment and structure
>2r62_A Cell division protease FTSH homolog; ATPase domain, ATP-binding, cell CELL division, hydrolase, membrane, metal-binding; 3.30A {Helicobacter pylori} PDB: 2r65_A* Back     alignment and structure
>2dhr_A FTSH; AAA+ protein, hexameric Zn metalloprotease, hydrolase; HET: ADP; 3.90A {Thermus thermophilus} Back     alignment and structure
>1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A* Back     alignment and structure
>2c9o_A RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP-binding, chromatin regulator, growth regulation, hydrolase, nuclear protein, DNA recombination; HET: ADP; 2.2A {Homo sapiens} PDB: 2xsz_A* Back     alignment and structure
>1iy2_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 3.20A {Thermus thermophilus} SCOP: c.37.1.20 Back     alignment and structure
>3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A Back     alignment and structure
>2z4s_A Chromosomal replication initiator protein DNAA; AAA+ ATPase, domain III (ATPase domain), ATP-binding, cytoplasm, DNA replication; HET: ADP; 3.00A {Thermotoga maritima} PDB: 2z4r_A* Back     alignment and structure
>3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A* Back     alignment and structure
>2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum} Back     alignment and structure
>1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>3hws_A ATP-dependent CLP protease ATP-binding subunit CL; CLPXP, AAA+ molecular machine, hexamer, asymmetric,, ATP-BIN chaperone, metal-binding; HET: ADP; 3.25A {Escherichia coli} PDB: 3hte_A Back     alignment and structure
>3n70_A Transport activator; sigma-54, ntpase, PSI, MCSG, structural genomics, center for structural genomics; 2.80A {Escherichia coli} Back     alignment and structure
>1l8q_A Chromosomal replication initiator protein DNAA; AAA+, helix-turn-helix, nucleotide-binding, DNA binding, REP initiation, DNA binding protein; HET: ADP; 2.70A {Aquifex aeolicus} SCOP: a.4.12.2 c.37.1.20 PDB: 3r8f_A* 2hcb_A* Back     alignment and structure
>3co5_A Putative two-component system transcriptional RES regulator; structural genomics, APC89341.1; 2.40A {Neisseria gonorrhoeae} Back     alignment and structure
>1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A* Back     alignment and structure
>3pfi_A Holliday junction ATP-dependent DNA helicase RUVB; probable holliday junction DNA helicase; HET: ADP; 2.69A {Campylobacter jejuni subsp} Back     alignment and structure
>1ofh_A ATP-dependent HSL protease ATP-binding subunit HSLU; chaperone, hydrolase, ATP-binding; HET: ADP; 2.5A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1ofi_A* Back     alignment and structure
>1sxj_A Activator 1 95 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1um8_A ATP-dependent CLP protease ATP-binding subunit CL; CLPP binding loop, chaperone; HET: ADP; 2.60A {Helicobacter pylori} SCOP: c.37.1.20 Back     alignment and structure
>3pvs_A Replication-associated recombination protein A; maintenance of genome stability Pro recombination; 2.50A {Escherichia coli} Back     alignment and structure
>1hqc_A RUVB; extended AAA-ATPase domain, complex with nucleotide, hydrolase; HET: ADE; 3.20A {Thermus thermophilus} SCOP: a.4.5.11 c.37.1.20 PDB: 1ixs_B* 1ixr_C* Back     alignment and structure
>3u61_B DNA polymerase accessory protein 44; AAA+, ATP hydrolase, clamp loader, sliding clamp, primer-TEM DNA, DNA binding protein-DNA complex; HET: DNA ADP 08T; 3.20A {Enterobacteria phage T4} PDB: 3u5z_B* 3u60_B* Back     alignment and structure
>3uk6_A RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding, hydrolase; HET: ADP; 2.95A {Homo sapiens} PDB: 2xsz_D* Back     alignment and structure
>2bjv_A PSP operon transcriptional activator; AAA, transcription activation, gene regulation, sigma54 activator, enhancer binding protein, PSPF; 1.7A {Escherichia coli} PDB: 2bjw_A 2c96_A* 2c98_A* 2c99_A* 2c9c_A* 2vii_A* Back     alignment and structure
>1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 Back     alignment and structure
>1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X* Back     alignment and structure
>3te6_A Regulatory protein SIR3; heterochromatin, gene silencing, SIR complex, HMR, HML, TELO AAA+ domain, structural, nucleus, gene RE; 2.80A {Saccharomyces cerevisiae} Back     alignment and structure
>2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix} Back     alignment and structure
>3m6a_A ATP-dependent protease LA 1; alpha, beta, ATP-binding, hydrolase, nucleotide-binding, Pro serine protease, stress response; HET: ADP; 3.40A {Bacillus subtilis} PDB: 1x37_A Back     alignment and structure
>2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} Back     alignment and structure
>1g41_A Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dependent proteolysis, chaperone; HET: ADP; 2.30A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1g3i_A* 1im2_A* 1kyi_A* 1g4a_E* 1g4b_E 1yyf_A* 1do0_A* 1do2_A* 1e94_E* 1hqy_E* 1ht1_E* 1ht2_E* Back     alignment and structure
>3cmw_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 2.80A {Escherichia coli} PDB: 3cmt_A* 3cmx_A* 3cmv_A* Back     alignment and structure
>1ojl_A Transcriptional regulatory protein ZRAR; response regulator, two component system, AAA domain, NTRC family, DNA-binding; HET: ATP; 3.0A {Salmonella typhimurium} Back     alignment and structure
>2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>3pxg_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 3.65A {Bacillus subtilis} Back     alignment and structure
>2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis} Back     alignment and structure
>3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A Back     alignment and structure
>4fcw_A Chaperone protein CLPB; AAA domain; HET: ADP; 2.35A {Thermus thermophilus} PDB: 4fcv_A* 4fd2_A* 4fct_A* Back     alignment and structure
>1iqp_A RFCS; clamp loader, extended AAA-ATPase domain, complex with ADP, replication; HET: ADP; 2.80A {Pyrococcus furiosus} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1sxj_B Activator 1 37 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis} Back     alignment and structure
>1sxj_D Activator 1 41 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A* Back     alignment and structure
>3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* Back     alignment and structure
>1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X* Back     alignment and structure
>2chq_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATP ATP-binding, nucleotide-binding; HET: ANP; 3.5A {Archaeoglobus fulgidus} PDB: 2chv_A Back     alignment and structure
>2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} Back     alignment and structure
>1jr3_A DNA polymerase III subunit gamma; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1xxh_B* 3glh_B* 3glf_B* 3gli_B* 3glg_B* 1xxi_B* Back     alignment and structure
>1g8p_A Magnesium-chelatase 38 kDa subunit; parallel beta sheet, P-loop, rossman fold, AAA+, photosynthesis, metal transport; 2.10A {Rhodobacter capsulatus} SCOP: c.37.1.20 PDB: 2x31_G Back     alignment and structure
>1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 Back     alignment and structure
>1in4_A RUVB, holliday junction DNA helicase RUVB; AAA+-class ATPase, winged-helix domain, ATP hydrolysis, walker A, walker B, sensor 1, sensor 2; HET: ADP; 1.60A {Thermotoga maritima} SCOP: a.4.5.11 c.37.1.20 PDB: 1in5_A* 1in6_A* 1in8_A* 1in7_A* 1j7k_A* Back     alignment and structure
>2r44_A Uncharacterized protein; putative ATPase, structural genomics, joint center for struc genomics, JCSG; HET: MSE PG4; 2.00A {Cytophaga hutchinsonii atcc 33406} Back     alignment and structure
>2qgz_A Helicase loader, putative primosome component; structural genomics, PSI-2, protein structure initiative; 2.40A {Streptococcus pyogenes serotype M3} Back     alignment and structure
>1sxj_C Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3nbx_X ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structure, rossman fold, hydro; HET: ADP; 2.91A {Escherichia coli} Back     alignment and structure
>1sxj_E Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B} Back     alignment and structure
>1w5s_A Origin recognition complex subunit 2 ORC2; replication, CDC6, DNA replication initiation, DNA BIND protein, AAA+ ATPase; HET: ADP; 2.4A {Aeropyrum pernix} SCOP: a.4.5.11 c.37.1.20 PDB: 1w5t_A* Back     alignment and structure
>1ny5_A Transcriptional regulator (NTRC family); AAA+ ATPase, sigma54 activator, bacterial transcription, DIM transcription; HET: ADP; 2.40A {Aquifex aeolicus} SCOP: c.23.1.1 c.37.1.20 PDB: 1ny6_A* 3m0e_A* 1zy2_A* Back     alignment and structure
>2vhj_A Ntpase P4, P4; non- hydrolysable ATP analogue, hydrolase, virus dsRNA, molecular motor, packaging ATPase, hexameric helicase; HET: ADP; 1.80A {Pseudomonas phage PHI12} PDB: 2vhq_A* 1w44_A* 1w46_A* 1w47_A* 1w48_A* 1w49_A* 1w4a_A* 1w4b_A* 1w4c_A 2vht_A* 2vhu_A* 2vhc_A* Back     alignment and structure
>2gno_A DNA polymerase III, gamma subunit-related protein; structural genomics, joint center for structural genomics, J protein structure initiative; HET: DNA; 2.00A {Thermotoga maritima} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3qwz_A Transitional endoplasmic reticulum ATPase; UBX, P97 binding, transport protein; HET: MLY; 2.00A {Homo sapiens} PDB: 2pjh_B Back     alignment and structure
>1a5t_A Delta prime, HOLB; zinc finger, DNA replication; 2.20A {Escherichia coli K12} SCOP: a.80.1.1 c.37.1.20 PDB: 1jr3_E* 1xxh_E* 1xxi_E* 3glf_E* 3glg_E* 3glh_E* 3gli_E* Back     alignment and structure
>2qen_A Walker-type ATPase; unknown function; HET: ADP; 2.25A {Pyrococcus abyssi} Back     alignment and structure
>3dzd_A Transcriptional regulator (NTRC family); sigma43 activator, AAA+ ATPase, response regulator, transcriptional activator, ATP-binding; HET: ADP; 2.40A {Aquifex aeolicus} PDB: 1zit_A 2jrl_A Back     alignment and structure
>2fna_A Conserved hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE ADP; 2.00A {Sulfolobus solfataricus} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>3k1j_A LON protease, ATP-dependent protease LON; ATP-binding, nucleotide-binding, Pro hydrolase; HET: ADP PE8; 2.00A {Thermococcus onnurineus} Back     alignment and structure
>3cmu_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 4.20A {Escherichia coli} Back     alignment and structure
>1tue_A Replication protein E1; helicase, replication, E1E2 complex, AAA+ protein; 2.10A {Human papillomavirus type 18} SCOP: c.37.1.20 Back     alignment and structure
>3f9v_A Minichromosome maintenance protein MCM; replicative helicase, DNA replication, MCM complex, AAA+ Pro ATP-binding, DNA-binding, helicase; 4.35A {Sulfolobus solfataricus} Back     alignment and structure
>2r2a_A Uncharacterized protein; zonular occludens toxin, structural genomics, APC84050.2, PS protein structure initiative; HET: MSE; 1.82A {Neisseria meningitidis MC58} Back     alignment and structure
>2cvh_A DNA repair and recombination protein RADB; filament formation, homologous recombination, ATPase domain, hyperthermophIle; HET: DNA; 2.20A {Thermococcus kodakarensis} PDB: 2cvf_A* Back     alignment and structure
>1ye8_A Protein THEP1, hypothetical UPF0334 kinase-like protein AQ_1292; mixed alpha-beta protein, rossman fold, signaling protein, transferase; 1.40A {Aquifex aeolicus} SCOP: c.37.1.11 Back     alignment and structure
>2zr9_A Protein RECA, recombinase A; recombination, RECA mutants, DNA-repair, ATP-binding, DNA DA recombination, DNA repair, DNA-binding; HET: DTP; 2.50A {Mycobacterium smegmatis str} PDB: 2zr0_A* 2zra_A* 2zrb_A 2zrm_A* 1ubc_A* 1ubf_A* 1ubg_A* 1ube_A* 2g88_A* 2odw_A* 2oe2_A 2oep_A* 2oes_A 2ofo_A 2zr7_A 2odn_A* 2zrn_A 2zro_A* 2zrp_A* 2zre_A* ... Back     alignment and structure
>3hr8_A Protein RECA; alpha and beta proteins (A/B, A+B), ATP-binding, cytoplasm, damage, DNA recombination, DNA repair, DNA-binding; 1.95A {Thermotoga maritima} Back     alignment and structure
>1xp8_A RECA protein, recombinase A; recombination, radioresistance, DNA-repair, ATPase, DNA-BIND protein, DNA binding protein; HET: AGS; 2.50A {Deinococcus radiodurans} SCOP: c.37.1.11 d.48.1.1 Back     alignment and structure
>2w0m_A SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus solfataricus P2} Back     alignment and structure
>4akg_A Glutathione S-transferase class-MU 26 kDa isozyme heavy chain cytoplasmic; motor protein, AAA+ protein, ASCE protein, P-loop ntpase; HET: ATP ADP; 3.30A {Schistosoma japonicum} PDB: 4ai6_A* 4akh_A* 4aki_A* 3qmz_A Back     alignment and structure
>3upu_A ATP-dependent DNA helicase DDA; RECA-like domain, SH3 domain, PIN-tower interface, coupling hydrolysis to DNA unwinding, ssDNA; 3.30A {Enterobacteria phage T4} Back     alignment and structure
>1qhx_A CPT, protein (chloramphenicol phosphotransferase); kinase, antibiotic resistance, phosphorylation, mononucleoti binding fold; HET: ATP; 2.50A {Streptomyces venezuelae} SCOP: c.37.1.3 PDB: 1grr_A* 1grq_A 1qhs_A* 1qhn_A* 1qhy_A* Back     alignment and structure
>1u94_A RECA protein, recombinase A; homologous recombination, ATPase, DNA repair, DNA binding protein; 1.90A {Escherichia coli} SCOP: c.37.1.11 d.48.1.1 PDB: 1u98_A 1u99_A 1xms_A* 1xmv_A* 2rec_A 2reb_A 1n03_A* 1rea_A 1aa3_A Back     alignment and structure
>3cmu_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 4.20A {Escherichia coli} Back     alignment and structure
>2b8t_A Thymidine kinase; deoxyribonucleoside kinase, zinc-binding domain, TK1, UU-TK, transferase; HET: THM; 2.00A {Ureaplasma parvum} SCOP: c.37.1.24 g.39.1.14 PDB: 2uz3_A* Back     alignment and structure
>3jvv_A Twitching mobility protein; hexameric P-loop ATPase, secretion ATPase, ATP-binding, FIMB nucleotide-binding, transport; HET: ACP CIT; 2.60A {Pseudomonas aeruginosa} PDB: 3jvu_A* Back     alignment and structure
>4akg_A Glutathione S-transferase class-MU 26 kDa isozyme heavy chain cytoplasmic; motor protein, AAA+ protein, ASCE protein, P-loop ntpase; HET: ATP ADP; 3.30A {Schistosoma japonicum} PDB: 4ai6_A* 4akh_A* 4aki_A* 3qmz_A Back     alignment and structure
>1n0w_A DNA repair protein RAD51 homolog 1; DNA repair, homologous recombination, breast cancer susceptibility, RECA-like ATPase, protein complex; HET: DNA MSE; 1.70A {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>3vaa_A Shikimate kinase, SK; structural genomics, center for structural genomics of infec diseases, csgid, metal binding, transferase; 1.70A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3trf_A Shikimate kinase, SK; amino acid biosynthesis, transferase; 2.60A {Coxiella burnetii} Back     alignment and structure
>1w4r_A Thymidine kinase; type II, human, cytosolic, phosphorylation, transferase; HET: TTP; 1.83A {Homo sapiens} PDB: 1xbt_A* 2wvj_A* 2j87_A* Back     alignment and structure
>1svm_A Large T antigen; AAA+ fold, viral protein; HET: ATP; 1.94A {Simian virus 40} SCOP: c.37.1.20 PDB: 1svl_A* 1svo_A 1n25_A 2h1l_A Back     alignment and structure
>1v5w_A DMC1, meiotic recombination protein DMC1/LIM15 homolog; DNA-binding protein, ring protein, octamer, AAA ATPase; 3.20A {Homo sapiens} SCOP: c.37.1.11 PDB: 2zjb_A Back     alignment and structure
>2z43_A DNA repair and recombination protein RADA; archaea, filament, DNA binding, molecular SWI RECA, DMC1; HET: DNA; 1.93A {Sulfolobus solfataricus} PDB: 2bke_A* 2dfl_A* 2zub_A* 2zuc_A* 2zud_A* Back     alignment and structure
>2orw_A Thymidine kinase; TMTK, TP4A, transferase; HET: 4TA; 1.50A {Thermotoga maritima} PDB: 2qpo_A 2qq0_A* 2qqe_A* Back     alignment and structure
>2rhm_A Putative kinase; P-loop containing nucleoside triphosphate hydrolases fold, S genomics, joint center for structural genomics, JCSG; HET: MSE; 1.70A {Chloroflexus aurantiacus} Back     alignment and structure
>3io5_A Recombination and repair protein; storage dimer, inactive conformation, RECA like core domain, binding, DNA damage, DNA recombination; 2.40A {Enterobacteria phage T4} Back     alignment and structure
>3iij_A Coilin-interacting nuclear ATPase protein; alpha and beta proteins (A/B), protein binding, transferase, phosphotransferase; HET: ADP; 1.76A {Homo sapiens} SCOP: c.37.1.1 PDB: 3iik_A 3iil_A* 3iim_A* 1rkb_A Back     alignment and structure
>2eyu_A Twitching motility protein PILT; pilus retraction motor, C-terminal domain PILT, protein transport; 1.87A {Aquifex aeolicus} Back     alignment and structure
>2p5t_B PEZT; postsegregational killing system, phosphoryltransferase, HEL helix motif, transcription regulator; 3.20A {Streptococcus pneumoniae} Back     alignment and structure
>2r8r_A Sensor protein; KDPD, PFAM02702, MCSG, structural genomics, protein structure initiative, midwest center for structural genomics, kinase; 2.30A {Pseudomonas syringae PV} Back     alignment and structure
>1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens} Back     alignment and structure
>3kb2_A SPBC2 prophage-derived uncharacterized protein YORR; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; HET: G3D; 2.20A {Bacillus subtilis} SCOP: c.37.1.1 PDB: 2axp_A* Back     alignment and structure
>2fz4_A DNA repair protein RAD25; RECA-like domain, DNA damage recognition domain, DNA binding; HET: DNA; 2.40A {Archaeoglobus fulgidus} SCOP: c.37.1.19 Back     alignment and structure
>2dr3_A UPF0273 protein PH0284; RECA superfamily ATPase, hexamer, structural genomics; HET: ADP; 2.00A {Pyrococcus horikoshii} Back     alignment and structure
>3a4m_A L-seryl-tRNA(SEC) kinase; P-loop motif, walker A motif, ATP binding motif, ATP- binding, nucleotide-binding, transferase; HET: ADP; 1.79A {Methanocaldococcus jannaschii} PDB: 3a4l_A* 3a4n_A 3am1_A* 3add_A* 3adc_A* 3adb_A* Back     alignment and structure
>1kag_A SKI, shikimate kinase I; transferase, structural genomics, PSI, protein structure initiative; 2.05A {Escherichia coli} SCOP: c.37.1.2 Back     alignment and structure
>2ewv_A Twitching motility protein PILT; pilus retraction motor, ATPase, hexameric PILT, protein TRAN; HET: ADP; 2.80A {Aquifex aeolicus} PDB: 2eww_A* 2gsz_A* Back     alignment and structure
>2iyv_A Shikimate kinase, SK; transferase, aromatic amino acid biosynthesis, P-loop kinase, metal- binding, shikimate pathway; HET: ADP; 1.35A {Mycobacterium tuberculosis} SCOP: c.37.1.2 PDB: 2iyr_A* 2iyq_A* 2iyt_A 2iyu_A* 2iys_A* 2iyw_A* 2iyx_A* 2iyy_A* 2iyz_A* 2g1k_A* 1l4y_A* 1u8a_A* 1we2_A* 1zyu_A* 2dfn_A* 2dft_A* 2g1j_A 1l4u_A* 3baf_A* Back     alignment and structure
>1gvn_B Zeta; postsegregational killing system, plasmid; 1.95A {Streptococcus pyogenes} SCOP: c.37.1.21 PDB: 3q8x_B* Back     alignment and structure
>1u0j_A DNA replication protein; AAA+ protein, P-loop atpases, helicase; HET: DNA ADP; 2.10A {Adeno-associated virus - 2} SCOP: c.37.1.20 PDB: 1s9h_A Back     alignment and structure
>1zp6_A Hypothetical protein ATU3015; alpha-beta protein., structural genomics, PSI, protein struc initiative; 3.20A {Agrobacterium tumefaciens str} SCOP: c.37.1.25 Back     alignment and structure
>1y63_A LMAJ004144AAA protein; structural genomics, protein structure initiative, PSI, SGPP structural genomics of pathogenic protozoa consortium; HET: ADP; 1.70A {Leishmania major} SCOP: c.37.1.1 Back     alignment and structure
>1via_A Shikimate kinase; structural genomics, transferase; HET: MSE; 1.57A {Campylobacter jejuni} SCOP: c.37.1.2 Back     alignment and structure
>1zuh_A Shikimate kinase; alpha-beta protein, transferase; 1.80A {Helicobacter pylori} PDB: 1zui_A* 3hr7_A 3muf_A* 3mrs_A 3n2e_A* Back     alignment and structure
>3tiw_A Transitional endoplasmic reticulum ATPase; beta-barrel alpha-helix, transport protein ATPase ubiquitin ubiquitin, phosphorylation; 1.80A {Homo sapiens} PDB: 3qq8_A 3qq7_A 3qc8_A Back     alignment and structure
>3dm5_A SRP54, signal recognition 54 kDa protein; protein-RNA, signal recognition particle, SRP-GTPase, protein targeting, cytoplasm, GTP-binding; HET: GDP; 2.51A {Pyrococcus furiosus} Back     alignment and structure
>1vma_A Cell division protein FTSY; TM0570, structural genomics, JCS protein structure initiative, PSI, joint center for structu genomics; HET: CIT; 1.60A {Thermotoga maritima} SCOP: a.24.13.1 c.37.1.10 Back     alignment and structure
>2ze6_A Isopentenyl transferase; crown GALL tumor, cytokinin biosynthesis; HET: DST AMP; 2.10A {Agrobacterium tumefaciens} PDB: 2ze5_A* 2ze7_A* 2ze8_A Back     alignment and structure
>1g5t_A COB(I)alamin adenosyltransferase; P-loop protein, cobalamin biosynthesis, RECA fold; HET: ATP; 1.80A {Salmonella typhimurium} SCOP: c.37.1.11 PDB: 1g5r_A* 1g64_A* Back     alignment and structure
>3lw7_A Adenylate kinase related protein (ADKA-like); AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 2.30A {Sulfolobus solfataricus} PDB: 3h0k_A Back     alignment and structure
>2cdn_A Adenylate kinase; phosphoryl transfer, associative mechanism, ATP-binding, nucleotide biosynthesis, nucleotide-binding, transferase; HET: ADP; 1.9A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1p4s_A Back     alignment and structure
>1e6c_A Shikimate kinase; phosphoryl transfer, ADP, shikimate pathway, P-loop protein, transferase; 1.8A {Erwinia chrysanthemi} SCOP: c.37.1.2 PDB: 1shk_A 2shk_A* Back     alignment and structure
>3kl4_A SRP54, signal recognition 54 kDa protein; signal recognition particle, SRP, SRP54, FFH, signal sequenc peptide; 3.50A {Sulfolobus solfataricus} PDB: 1qzx_A 1qzw_A Back     alignment and structure
>4a74_A DNA repair and recombination protein RADA; hydrolase, recombinase; HET: DNA ANP; 1.48A {Pyrococcus furiosus} PDB: 4a6x_A* 4a6p_A* 4a7o_A* Back     alignment and structure
>2c95_A Adenylate kinase 1; transferase, AP4A, nucleotide kinase, transferase ATP-bindi; HET: B4P; 1.71A {Homo sapiens} PDB: 1z83_A* 3adk_A Back     alignment and structure
>1tev_A UMP-CMP kinase; ploop, NMP binding region, LID region, conformational changes, transferase; 2.10A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>3tlx_A Adenylate kinase 2; structural genomics, structural genomics consortium, SGC, RO fold, transferase, ATP binding, phosphorylation; HET: ADP ATP AMP; 2.75A {Plasmodium falciparum} Back     alignment and structure
>3t61_A Gluconokinase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium, nysgrc; 2.20A {Sinorhizobium meliloti} Back     alignment and structure
>1aky_A Adenylate kinase; ATP:AMP phosphotransferase, myokinase, transferase (phosphotransferase); HET: AP5; 1.63A {Saccharomyces cerevisiae} SCOP: c.37.1.1 g.41.2.1 PDB: 2aky_A* 3aky_A* 1dvr_A* Back     alignment and structure
>1pzn_A RAD51, DNA repair and recombination protein RAD51, RADA; heptameric ring, heptamer, ring, oligomer, RAD51 polymerizat motif; HET: DNA; 2.85A {Pyrococcus furiosus} SCOP: a.60.4.1 c.37.1.11 Back     alignment and structure
>1zd8_A GTP:AMP phosphotransferase mitochondrial; ATP:AMP phosphotransferase, myokinase, structural genomics, structural genomics consortium, SGC; 1.48A {Homo sapiens} PDB: 2ak3_A* Back     alignment and structure
>3cm0_A Adenylate kinase; ATP-binding, cytoplasm, nucleotide biosynthesis, nucleotide-binding, transferase, structural genomics; 1.80A {Thermus thermophilus} Back     alignment and structure
>2vli_A Antibiotic resistance protein; transferase, tunicamycin, phosphotransferase; 1.95A {Deinococcus radiodurans} Back     alignment and structure
>3dl0_A Adenylate kinase; phosphotransferase, zinc coordination, ATP-binding, binding, nucleotide biosynthesis, nucleotide-binding, trans; HET: AP5; 1.58A {Bacillus subtilis} PDB: 1p3j_A* 2ori_A* 2eu8_A* 2oo7_A* 2p3s_A* 2qaj_A* 2osb_A* 3dkv_A* 1zin_A* 1zio_A* 1zip_A* 1s3g_A* Back     alignment and structure
>2pt5_A Shikimate kinase, SK; aromatic amino acid biosynthesis, P-loop kinase, SHI kinase, shikimate pathway; 2.10A {Aquifex aeolicus} Back     alignment and structure
>3fb4_A Adenylate kinase; psychrophIle, phosphotransferase, ATP-binding, nucleotide-binding, transferase; HET: AP5; 2.00A {Marinibacillus marinus} Back     alignment and structure
>1qf9_A UMP/CMP kinase, protein (uridylmonophosphate/cytidylmonophosphate kinase); nucleoside monophosphate kinase, NMP kinase; HET: ADP C5P; 1.70A {Dictyostelium discoideum} SCOP: c.37.1.1 PDB: 1uke_A* 2ukd_A* 3ukd_A* 4ukd_A* 5ukd_A* Back     alignment and structure
>1ly1_A Polynucleotide kinase; PNK, phosphatase, transferase; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.1 Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>3e1s_A Exodeoxyribonuclease V, subunit RECD; alpha and beta protein, ATP-binding, nucleotide-binding, HYD; 2.20A {Deinococcus radiodurans} PDB: 3gp8_A 3gpl_A* Back     alignment and structure
>1kht_A Adenylate kinase; phosphotransferase, signaling protein, transferase; HET: AMP; 2.50A {Methanococcus voltae} SCOP: c.37.1.1 PDB: 3h86_B* 1ki9_A Back     alignment and structure
>2bwj_A Adenylate kinase 5; phosphoryl transfer reaction, transferase; HET: AMP; 2.3A {Homo sapiens} Back     alignment and structure
>3lda_A DNA repair protein RAD51; DNA binding protein, ATP-binding, DNA damage, DNA recombinat repair, nucleotide-binding; HET: DNA; 2.50A {Saccharomyces cerevisiae} PDB: 1szp_A* Back     alignment and structure
>1knq_A Gluconate kinase; ALFA/beta structure, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.17 PDB: 1ko1_A 1ko4_A 1ko5_A* 1ko8_A* 1kof_A* Back     alignment and structure
>1ak2_A Adenylate kinase isoenzyme-2; nucleoside monophosphate kinase, phosphotransferase; 1.92A {Bos taurus} SCOP: c.37.1.1 g.41.2.1 PDB: 2ak2_A 2c9y_A* Back     alignment and structure
>4eun_A Thermoresistant glucokinase; putative sugar kinase, enzyme function initiative, EFI, STRU genomics, transferase; 1.60A {Janibacter SP} Back     alignment and structure
>2pez_A Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthetase 1 (PAPS synthetase...; NMP-kinase fold, protein in complex with nucleic acid; HET: GGZ DAT; 1.40A {Homo sapiens} PDB: 2pey_A* 2ax4_A* Back     alignment and structure
>3be4_A Adenylate kinase; malaria, cryptosporidium parvum nonprotein inhibitors, nucleotide-binding, transferase; HET: AP5; 1.60A {Cryptosporidium parvum iowa II} Back     alignment and structure
>3uie_A Adenylyl-sulfate kinase 1, chloroplastic; rossmann fold, transferase-transferase complex; HET: ADX ANP; 1.79A {Arabidopsis thaliana} SCOP: c.37.1.0 PDB: 4fxp_A* Back     alignment and structure
>2pt7_A CAG-ALFA; ATPase, protein-protein complex, type IV secretion, hydrolas binding complex; 2.40A {Helicobacter pylori} SCOP: c.37.1.11 PDB: 1nly_A* 1nlz_A 1opx_A* 1g6o_A Back     alignment and structure
>3umf_A Adenylate kinase; rossmann fold, transferase; 2.05A {Schistosoma mansoni} Back     alignment and structure
>1zak_A Adenylate kinase; ATP:AMP-phosphotransferase, transferase; HET: AP5; 3.50A {Zea mays} SCOP: c.37.1.1 g.41.2.1 Back     alignment and structure
>1ukz_A Uridylate kinase; transferase; HET: ADP AMP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1uky_A* Back     alignment and structure
>2ga8_A Hypothetical 39.9 kDa protein; YFR007W, YFH7, unknown function; HET: CME; 1.77A {Saccharomyces cerevisiae} PDB: 2gaa_A* Back     alignment and structure
>1p9r_A General secretion pathway protein E; bacterial type II secretion system cytoplasmic protein - GSPE, putative ATPase/ ATP binding protein; 2.50A {Vibrio cholerae} SCOP: c.37.1.11 PDB: 1p9w_A* Back     alignment and structure
>2i1q_A DNA repair and recombination protein RADA; ATPase, recombinase, ATP complex, calcium stimulation, RECA, DMC1; HET: DNA ANP; 1.90A {Methanococcus voltae} SCOP: a.60.4.1 c.37.1.11 PDB: 1xu4_A* 2b21_A* 2fpk_A* 2fpl_A* 2fpm_A* 1t4g_A* 3fyh_A* 2f1j_A* 2f1i_A* 2f1h_A* 3ntu_A* 3ewa_A* 3ew9_A* 3etl_A* 4dc9_A* 2gdj_A* Back     alignment and structure
>1nks_A Adenylate kinase; thermophilic, transferase; HET: AMP ADP; 2.57A {Sulfolobus acidocaldarius} SCOP: c.37.1.1 Back     alignment and structure
>3cmw_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 2.80A {Escherichia coli} PDB: 3cmt_A* 3cmx_A* 3cmv_A* Back     alignment and structure
>3sr0_A Adenylate kinase; phosphoryl transfer analogue, ALF4, transferase (phosphotran phosphoryl transfer, nucleotide-binding; HET: ADP AMP; 1.56A {Aquifex aeolicus} PDB: 2rh5_A 2rgx_A* Back     alignment and structure
>3crm_A TRNA delta(2)-isopentenylpyrophosphate transferase; ATP-binding, nucleotide-binding, nucleotidyltransferase, tRNA processing; 1.90A {Pseudomonas aeruginosa} PDB: 3crq_A 3crr_A Back     alignment and structure
>2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A* Back     alignment and structure
>3f8t_A Predicted ATPase involved in replication control, CDC46/MCM family; helicase, MCM homolog, DNA replication, ATP-binding, DNA-binding; 1.90A {Methanopyrus kandleri AV19} Back     alignment and structure
>2pbr_A DTMP kinase, thymidylate kinase; transferase, nucleotide biosynthesis, TMP-binding, A binding, structural genomics, NPPSFA; 1.96A {Aquifex aeolicus} Back     alignment and structure
>2zts_A Putative uncharacterized protein PH0186; KAIC like protein, ATP-binding, nucleotide-binding, ATP- binding protein; HET: ADP; 2.07A {Pyrococcus horikoshii} Back     alignment and structure
>2jaq_A Deoxyguanosine kinase; transferase, deoxyribonucleoside kinase; HET: DCP; 2.3A {Mycoplasma mycoides subsp} PDB: 2jat_A* 2jas_A* Back     alignment and structure
>1cke_A CK, MSSA, protein (cytidine monophosphate kinase); nucleotide monophosphate kinase,, transferase; 1.75A {Escherichia coli} SCOP: c.37.1.1 PDB: 1kdo_A* 1kdp_A* 1kdr_A* 1kdt_A* 2cmk_A* 2fem_A 2feo_A* Back     alignment and structure
>2r6a_A DNAB helicase, replicative helicase; replication, DNAB; 2.90A {Geobacillus stearothermophilus} PDB: 2r6c_A 2r6d_A 2r6e_A 2vyf_A 2vye_A Back     alignment and structure
>1e4v_A Adenylate kinase; transferase(phosphotransferase); HET: AP5; 1.85A {Escherichia coli} SCOP: c.37.1.1 g.41.2.1 PDB: 1e4y_A* 1ake_A* 1ank_A* 2eck_A* 3hpq_A* 4ake_A 3hpr_A* Back     alignment and structure
>3nwj_A ATSK2; P loop, shikimate, nucleoside monophosphate kinase, shikimat ATP binding, chloroplast, transferase; 2.35A {Arabidopsis thaliana} Back     alignment and structure
>2xb4_A Adenylate kinase; ATP-binding, nucleotide-binding, transferase; HET: SRT; 1.80A {Desulfovibrio gigas} PDB: 3l0s_A* 3l0p_A* Back     alignment and structure
>2v54_A DTMP kinase, thymidylate kinase; nucleotide biosynthesis, ATP-binding, nucleotide-binding, poxvirus, transferase; HET: TYD POP; 2.4A {Vaccinia virus copenhagen} PDB: 2w0s_A* Back     alignment and structure
>2qor_A Guanylate kinase; phosphotransferase, purine metabolism, structural genomics, structural genomics of pathogenic protozoa consortium; HET: 5GP POP; 1.80A {Plasmodium vivax} Back     alignment and structure
>3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* Back     alignment and structure
>2if2_A Dephospho-COA kinase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 3.00A {Aquifex aeolicus} Back     alignment and structure
>2oap_1 GSPE-2, type II secretion system protein; hexameric ATPase, hydrolase; HET: ANP; 2.95A {Archaeoglobus fulgidus} PDB: 2oaq_1 Back     alignment and structure
>2yvu_A Probable adenylyl-sulfate kinase; transferase, structural genomics, NPPSFA, national P protein structural and functional analyses; 2.10A {Aeropyrum pernix} Back     alignment and structure
>1xx6_A Thymidine kinase; NESG, northeast structural genomics consortium, protein STRU initiative, PSI, structural genomics, DNA synthesis; HET: ADP; 2.00A {Clostridium acetobutylicum} SCOP: c.37.1.24 g.39.1.14 Back     alignment and structure
>3foz_A TRNA delta(2)-isopentenylpyrophosphate transferas; nucleoside modification, isopentenyl-tRNA transferase, transferase-RNA complex; 2.50A {Escherichia coli k-12} PDB: 2zxu_A* 2zm5_A Back     alignment and structure
>3a8t_A Adenylate isopentenyltransferase; rossmann fold protein; HET: ATP; 2.37A {Humulus lupulus} Back     alignment and structure
>3r20_A Cytidylate kinase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, ADP, DCMP, D transferase; 2.00A {Mycobacterium smegmatis} SCOP: c.37.1.0 PDB: 3r8c_A 4die_A* Back     alignment and structure
>3ake_A Cytidylate kinase; CMP kinase, CMP complex, open conformation, nucleotide metab transferase; HET: C5P; 1.50A {Thermus thermophilus} PDB: 3akc_A* 3akd_A* Back     alignment and structure
>2grj_A Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosphocoenzyme kinase, structural genomics, joint center for structural GE JCSG; HET: ADP COD; 2.60A {Thermotoga maritima} Back     alignment and structure
>2bbw_A Adenylate kinase 4, AK4; nucleotide kinase, nucleotide binding, human, structura genomics, structural genomics consortium, SGC, transferase; HET: GP5; 2.05A {Homo sapiens} PDB: 2ar7_A* 3ndp_A Back     alignment and structure
>2plr_A DTMP kinase, probable thymidylate kinase; TMP-binding, ATP-binding, structural GEN NPPSFA; HET: 1PE PGE EPE PG4; 1.60A {Sulfolobus tokodaii} Back     alignment and structure
>2q6t_A DNAB replication FORK helicase; hydrolase; 2.90A {Thermus aquaticus} Back     alignment and structure
>2yhs_A FTSY, cell division protein FTSY; cell cycle, protein targeting, simibi class GTPase, GTP-BIND membrane, nucleotide-binding; 1.60A {Escherichia coli} PDB: 2qy9_A 2xxa_B* 1fts_A Back     alignment and structure
>4e22_A Cytidylate kinase; P-loop, CMP/ATP binding, transferase; 2.32A {Yersinia pseudotuberculosis} Back     alignment and structure
>1ex7_A Guanylate kinase; substrate-induced FIT, domain movement, GMP, ATP, substrate specificity, X-RAY diffraction, transferase; HET: 5GP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1ex6_A* 1gky_A* 3sqk_A 4f4j_A Back     alignment and structure
>3exa_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.30A {Bacillus halodurans} PDB: 2qgn_A Back     alignment and structure
>1kgd_A CASK, peripheral plasma membrane CASK; maguk, guanylate kinase like domain, protein binding; 1.31A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>1m7g_A Adenylylsulfate kinase; APS kinase, transferase, sulfate Met nucleotide 2 kinase; HET: AV2 ADX ADP; 1.43A {Penicillium chrysogenum} SCOP: c.37.1.4 PDB: 1d6j_A* 1m7h_A* 3cr7_A* Back     alignment and structure
>2px0_A Flagellar biosynthesis protein FLHF; SRP GTPase, flagellum, protein transport, biosynthetic protein; HET: GNP; 3.00A {Bacillus subtilis} PDB: 2px3_A* 3syn_A* Back     alignment and structure
>1jjv_A Dephospho-COA kinase; P-loop nucleotide-binding fold, structure 2 function project, S2F, structural genomics, transferase; HET: ATP; 2.00A {Haemophilus influenzae} SCOP: c.37.1.1 Back     alignment and structure
>1uj2_A Uridine-cytidine kinase 2; alpha/beta mononucleotide-binding HOLD, transferase; HET: C5P ADP; 1.80A {Homo sapiens} SCOP: c.37.1.6 PDB: 1uei_A* 1uej_A* 1udw_A 1ufq_A* 1xrj_A* Back     alignment and structure
>4b3f_X DNA-binding protein smubp-2; hydrolase, helicase; 2.50A {Homo sapiens} PDB: 4b3g_A Back     alignment and structure
>1uf9_A TT1252 protein; P-loop, nucleotide binding domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: ATP; 2.80A {Thermus thermophilus} SCOP: c.37.1.1 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Back     alignment and structure
>2j41_A Guanylate kinase; GMP, GMK, transferase, ATP-binding, nucleotide- binding; HET: 5GP; 1.9A {Staphylococcus aureus} Back     alignment and structure
>2wwf_A Thymidilate kinase, putative; transferase, malaria; HET: TMP ADP; 1.89A {Plasmodium falciparum} PDB: 2wwg_A* 2wwh_A* 2wwi_A* Back     alignment and structure
>1vht_A Dephospho-COA kinase; structural genomics, transferase; HET: BA3; 1.59A {Escherichia coli} SCOP: c.37.1.1 PDB: 1vhl_A* 1viy_A 1t3h_A 1n3b_A Back     alignment and structure
>2bdt_A BH3686; alpha-beta protein, structural genomics, PSI, protein struct initiative, northeast structural genomics consortium, NESG, function; 2.40A {Bacillus halodurans} SCOP: c.37.1.25 Back     alignment and structure
>3tr0_A Guanylate kinase, GMP kinase; purines, pyrimidines, nucleosides, nucleotides, transferase; HET: 5GP; 1.85A {Coxiella burnetii} Back     alignment and structure
>3b6e_A Interferon-induced helicase C domain-containing P; DECH, DEXD/H RNA-binding helicase, innate immunity, IFIH1, S genomics; 1.60A {Homo sapiens} Back     alignment and structure
>3d3q_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2; 2.70A {Staphylococcus epidermidis atcc 12228} Back     alignment and structure
>3tau_A Guanylate kinase, GMP kinase; structural genomics, center for structural genomics of infec diseases, csgid, putative guanylate kinase; HET: MSE; 2.05A {Listeria monocytogenes} Back     alignment and structure
>2qt1_A Nicotinamide riboside kinase 1; non-protein kinase, NAD+, NRK1, nicotinic acid riboside kinase activity, NAD biosynthesis; HET: NNR; 1.32A {Homo sapiens} PDB: 2qsy_A* 2qsz_A* 2qt0_A* 2p0e_A* 2qg6_A* 2ql6_A* Back     alignment and structure
>3zvl_A Bifunctional polynucleotide phosphatase/kinase; hydrolase-transferase complex, base excision repair, BER, non-homologous END-joining, NHEJ; 1.65A {Mus musculus} PDB: 3zvm_A* 3zvn_A* 1yj5_A 3u7e_B* 3u7f_B* 3u7h_B* 3u7g_A* Back     alignment and structure
>1zu4_A FTSY; GTPase, signal recognition particle, SRP, receptor, protein transport; 1.95A {Mycoplasma mycoides} PDB: 1zu5_A Back     alignment and structure
>3e70_C DPA, signal recognition particle receptor; FTSY, SRP-GTPase, protein-targeting, transport protein; HET: GDP; 1.97A {Pyrococcus furiosus} PDB: 3dmd_B 3dm9_B* Back     alignment and structure
>1q3t_A Cytidylate kinase; nucleotide monophosphate kinase, CMP kinase, transferase; NMR {Streptococcus pneumoniae} SCOP: c.37.1.1 Back     alignment and structure
>2h92_A Cytidylate kinase; rossmann fold, transferase; HET: C5P PG4; 2.30A {Staphylococcus aureus} Back     alignment and structure
>2qmh_A HPR kinase/phosphorylase; V267F mutation, ATP-binding, carbohydrate metabolism, magnesium, metal-binding, multifunctional enzyme; 2.60A {Lactobacillus casei} PDB: 1jb1_A 1kkl_A 1kkm_A* Back     alignment and structure
>1rz3_A Hypothetical protein rbstp0775; MCSG, structural genomics, PSI, protein structure initiative; 1.90A {Geobacillus stearothermophilus} SCOP: c.37.1.6 Back     alignment and structure
>2v3c_C SRP54, signal recognition 54 kDa protein; nucleotide-binding, signal recognition particle, GTP-binding, RNA-binding; 2.50A {Methanocaldococcus jannaschii} PDB: 3ndb_B Back     alignment and structure
>1nn5_A Similar to deoxythymidylate kinase (thymidylate K; P-loop, D4TMP, transferase; HET: 2DT ANP; 1.50A {Homo sapiens} SCOP: c.37.1.1 PDB: 1e2e_A* 1e2d_A* 1e2g_A* 1e2q_A* 1e99_A* 1e9a_A* 1e9b_A* 1nmx_A* 1nmz_A* 1nn0_A* 1nn1_A* 1e2f_A* 1nn3_A* 2xx3_A* 1e9c_A* 1e9d_A* 1e9e_A* 1e98_A* 1nmy_A* 1e9f_A* Back     alignment and structure
>1htw_A HI0065; nucleotide-binding fold, structural genomics, structure 2 function project, S2F, unknown function; HET: ADP; 1.70A {Haemophilus influenzae} SCOP: c.37.1.18 PDB: 1fl9_A Back     alignment and structure
>1lvg_A Guanylate kinase, GMP kinase; transferase; HET: ADP 5GP; 2.10A {Mus musculus} SCOP: c.37.1.1 Back     alignment and structure
>2jv2_A Putative uncharacterized protein PH1500; AAA ATPase NC-domain-like, unknown function; NMR {Pyrococcus horikoshii} Back     alignment and structure
>3eph_A TRNA isopentenyltransferase; transferase, alternative initiation, ATP-binding, cytoplasm, mitochondrion, nucleotide-binding, nucleus; 2.95A {Saccharomyces cerevisiae} PDB: 3epj_A 3epk_A* 3epl_A* Back     alignment and structure
>2gza_A Type IV secretion system protein VIRB11; ATPase, hydrolase; 2.60A {Brucella suis} Back     alignment and structure
>2j9r_A Thymidine kinase; TK1, DNK, lasso, transferase, ATP-binding, deoxyribonucleoside kinase, DNA synthesis, phosphate accept nucleotide-binding; HET: THM; 2.7A {Bacillus anthracis} PDB: 2ja1_A* Back     alignment and structure
>1ltq_A Polynucleotide kinase; phosphatase, alpha/beta, P-loop, transferase; HET: ADP; 2.33A {Enterobacteria phage T4} SCOP: c.108.1.9 c.37.1.1 PDB: 1rc8_A* 1rpz_A* 1rrc_A* 2ia5_A Back     alignment and structure
>1z6g_A Guanylate kinase; structural genomics, SGC, structural genom consortium, transferase; HET: EPE; 2.18A {Plasmodium falciparum} Back     alignment and structure
>2j37_W Signal recognition particle 54 kDa protein (SRP54); ribosome, SRP, translation/RNA; 8.00A {Canis SP} PDB: 1wgw_A Back     alignment and structure
>2f6r_A COA synthase, bifunctional coenzyme A synthase; 18044849, bifunctional coenzyme A synthase (COA synthase), S genomics; HET: ACO UNL; 1.70A {Mus musculus} Back     alignment and structure
>1tf7_A KAIC; homohexamer, hexamer, circadian clock protein; HET: ATP; 2.80A {Synechococcus SP} SCOP: c.37.1.11 c.37.1.11 PDB: 3s1a_A* 1u9i_A* 2gbl_A* 3dvl_A* 3k0a_A* 3k09_A* 3jzm_A* 3k0e_A* 4dug_A* 3ua2_A* 3k0c_A* 3k0f_A* Back     alignment and structure
>3c8u_A Fructokinase; YP_612366.1, putative fructose transport system kinase, STRU genomics, joint center for structural genomics, JCSG; 1.95A {Silicibacter SP} Back     alignment and structure
>3ney_A 55 kDa erythrocyte membrane protein; structural genomics consortium, SGC, 55 kDa erythrocyte MEMB protein; 2.26A {Homo sapiens} SCOP: c.37.1.0 Back     alignment and structure
>3asz_A Uridine kinase; cytidine phosphorylation, transferase; HET: C5P; 2.25A {Thermus thermophilus} PDB: 3asy_A* Back     alignment and structure
>1c9k_A COBU, adenosylcobinamide kinase; alpha/beta structure rossmann fold P-loop, transferase; HET: 5GP; 2.20A {Salmonella typhimurium} SCOP: c.37.1.11 PDB: 1cbu_A Back     alignment and structure
>1cr0_A DNA primase/helicase; RECA-type protein fold, transferase; HET: DNA; 2.30A {Enterobacteria phage T7} SCOP: c.37.1.11 PDB: 1cr1_A* 1cr2_A* 1cr4_A* 1e0j_A* 1e0k_A* Back     alignment and structure
>2axn_A 6-phosphofructo-2-kinase/fructose-2,6- biphosphatase 3 (6PF-2-K/FRU- 2,6-P2ASE brain/placenta-type...; bifunctional enzyme, EDTA complex; HET: F6P EDT ADP; 2.10A {Homo sapiens} PDB: 2dwo_A* 2dwp_A* 2i1v_B* 3qpu_A* 3qpv_A* 3qpw_A* Back     alignment and structure
>1znw_A Guanylate kinase, GMP kinase; ATP:GMP-phosphotransferase, TR; 2.10A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1znx_A* 1zny_A* 1znz_A* 1s4q_A 1z8f_A Back     alignment and structure
>3fdi_A Uncharacterized protein; cytidylate kinase like protein, PSI, MCSG, PRK04182 class ME structural genomics, protein structure initiative; 2.20A {Eubacterium ventriosum} Back     alignment and structure
>2v9p_A Replication protein E1; AAA+ molecular motor, DNA replication, DNA translocation, nucleotide-binding, DNA-binding; 3.00A {Bovine papillomavirus type 1} PDB: 2gxa_A* Back     alignment and structure
>1s96_A Guanylate kinase, GMP kinase; E.coli, dimer, SAD, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.1 PDB: 2an9_A* 2anb_A* 2anc_A 2f3r_A* 2f3t_A* Back     alignment and structure
>3bh0_A DNAB-like replicative helicase; ATPase, replication; 2.35A {Bacillus phage SPP1} Back     alignment and structure
>2xau_A PRE-mRNA-splicing factor ATP-dependent RNA helica; hydrolase, ribosome biogenesis, ATPase, ATP-binding, OB-fold; HET: ADP; 1.90A {Saccharomyces cerevisiae} PDB: 3kx2_B* Back     alignment and structure
>2xxa_A Signal recognition particle protein; protein transport, RNA/RNA binding protein, hydrolase, gtpas; HET: GCP; 3.94A {Escherichia coli} PDB: 2j28_9 Back     alignment and structure
>1x6v_B Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthethase 1; transferase, ATP sulfurylase, APS kinase, PAPS; HET: ADP; 1.75A {Homo sapiens} SCOP: b.122.1.3 c.26.1.5 c.37.1.4 PDB: 1xjq_B* 1xnj_B* 2qjf_A* 2ofx_A* 2ofw_A* Back     alignment and structure
>3b9q_A Chloroplast SRP receptor homolog, alpha subunit CPFTSY; protein translocation, GTP-binding, nucleotide-binding, protein transport; 1.75A {Arabidopsis thaliana} Back     alignment and structure
>2jeo_A Uridine-cytidine kinase 1; UCK, transferase, ATP-binding, nucleoside kinase, nucleotide-binding; 2.50A {Homo sapiens} PDB: 2uvq_A* Back     alignment and structure
>3thx_B DNA mismatch repair protein MSH3; ABC family ATPase, mismatch recognition, mismatched unpaired DNA binding protein-DNA complex; HET: DNA ADP; 2.70A {Homo sapiens} PDB: 3thw_B* 3thy_B* 3thz_B* Back     alignment and structure
>1j8m_F SRP54, signal recognition 54 kDa protein; signaling protein; 2.00A {Acidianus ambivalens} SCOP: a.24.13.1 c.37.1.10 PDB: 1j8y_F Back     alignment and structure
>4gp7_A Metallophosphoesterase; polynucleotide kinase phosphatase, RNA repair, transferase; HET: ATP CIT; 2.00A {Clostridium thermocellum} PDB: 4gp6_A* Back     alignment and structure
>1odf_A YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser2 intergenic region; yeast protein, ATP binding protein; 2.25A {Saccharomyces cerevisiae} SCOP: c.37.1.6 Back     alignment and structure
>1ls1_A Signal recognition particle protein; FFH, SRP54, SRP, GTPase, ultrahigh resolution, protein transport; 1.10A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 1jpn_B* 1jpj_A* 1ry1_U* 2j45_A* 1o87_A* 2c04_A* 2j46_A* 1rj9_B* 2c03_A* 2j7p_A* 1okk_A* 2cnw_A* 1ng1_A* 2xkv_A 3ng1_A 1ffh_A 2ng1_A* Back     alignment and structure
>2og2_A Putative signal recognition particle receptor; nucleotide-binding, protein transport; 2.00A {Arabidopsis thaliana} Back     alignment and structure
>1gtv_A TMK, thymidylate kinase; transferase, transferase (ATP:TMP phosphotransferase); HET: TYD TMP; 1.55A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1g3u_A* 1gsi_A* 1mrn_A* 1mrs_A* 1n5i_A* 1n5j_A* 1n5k_A* 1n5l_A* 1w2g_A* 1w2h_A* Back     alignment and structure
>3lnc_A Guanylate kinase, GMP kinase; ALS collaborative crystallography, emerald biostructures, ATP-binding, cytoplasm, nucleotide-binding; HET: 5GP; 1.95A {Anaplasma phagocytophilum} Back     alignment and structure
>1a7j_A Phosphoribulokinase; transferase, calvin cycle; 2.50A {Rhodobacter sphaeroides} SCOP: c.37.1.6 Back     alignment and structure
>2orv_A Thymidine kinase; TP4A (P1-(5'-adenosyl)P4-(5'- (2'deoxythymidil))tetraphosphate, transferase; HET: 4TA; 2.30A {Homo sapiens} SCOP: c.37.1.24 g.39.1.14 Back     alignment and structure
>4eaq_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, MTBI, transferase; HET: ATM; 1.85A {Staphylococcus aureus subsp} PDB: 4dwj_A* 4f4i_A Back     alignment and structure
>1nlf_A Regulatory protein REPA; replicative DNA helicase structural changes, replication; 1.95A {Escherichia coli} SCOP: c.37.1.11 PDB: 1g8y_A 1olo_A Back     alignment and structure
>1sky_E F1-ATPase, F1-ATP synthase; F1FO ATP synthase, alpha3BETA3 SUBC F1-ATPase, hydrolase; 3.20A {Bacillus SP} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 Back     alignment and structure
>3tif_A Uncharacterized ABC transporter ATP-binding prote; nucleotide-binding domain, ABC transporter ATPase; HET: ADP; 1.80A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} PDB: 1l2t_A* 1f3o_A* Back     alignment and structure
>3thx_A DNA mismatch repair protein MSH2; ABC family ATPase, mismatch recognition, mismatched unpaired DNA binding protein-DNA complex; HET: DNA ADP; 2.70A {Homo sapiens} PDB: 2o8c_A* 2o8d_A* 2o8f_A* 3thw_A* 2o8b_A* 3thy_A* 3thz_A* 2o8e_A* Back     alignment and structure
>3p32_A Probable GTPase RV1496/MT1543; structural genomics, seattle structural genomics center for infectious disease, ssgcid, MEAB, MMAA; HET: GDP PGE; 1.90A {Mycobacterium tuberculosis} PDB: 3md0_A* 4gt1_A* 3nxs_A* 3tk1_A* Back     alignment and structure
>3hdt_A Putative kinase; structura genomics, PSI-2, protein structure initiative, midwest CENT structural genomics, MCSG; 2.79A {Clostridium symbiosum atcc 14940} Back     alignment and structure
>3gmt_A Adenylate kinase; ssgcid, ATP-BIN cytoplasm, nucleotide biosynthesis, nucleotide-BIND transferase, structural genomics; 2.10A {Burkholderia pseudomallei 1710B} Back     alignment and structure
>3tqf_A HPR(Ser) kinase; transferase, hydrolase; 2.80A {Coxiella burnetii} Back     alignment and structure
>2qm8_A GTPase/ATPase; G protein, G3E, metallochaperone, chaperone; HET: MSE; 1.70A {Methylobacterium extorquens} SCOP: c.37.1.10 PDB: 2qm7_A* Back     alignment and structure
>1m8p_A Sulfate adenylyltransferase; rossmann fold, phosphosulfate binding, T-state; HET: PPS; 2.60A {Penicillium chrysogenum} SCOP: b.122.1.3 c.26.1.5 c.37.1.15 PDB: 1i2d_A* Back     alignment and structure
>2fwr_A DNA repair protein RAD25; DNA unwinding, XPB, DNA binding protein; HET: DNA; 2.60A {Archaeoglobus fulgidus} SCOP: c.37.1.19 c.37.1.19 PDB: 2fzl_A* Back     alignment and structure
>2hf9_A Probable hydrogenase nickel incorporation protein HYPB; alpha and beta protein; HET: GSP; 1.90A {Methanocaldococcus jannaschii} PDB: 2hf8_A* Back     alignment and structure
>2i3b_A HCR-ntpase, human cancer-related ntpase; AAA, rossmann, hydrolase; NMR {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>2cbz_A Multidrug resistance-associated protein 1; ABC proteins, MRP1/ABCC1, nucleotide-binding domain, ATP- binding, hydrolysis, transport; HET: ATP; 1.5A {Homo sapiens} Back     alignment and structure
>3aez_A Pantothenate kinase; transferase, homodimer, COA biosynthesis, nucleotide binding binding, cytoplasm, nucleotide-binding; HET: GDP PAZ; 2.20A {Mycobacterium tuberculosis} PDB: 2ges_A* 2geu_A* 2gev_A* 2zs7_A* 2zs8_A* 2zs9_A* 2zsa_A* 2zsb_A* 2zsd_A* 2zse_A* 2zsf_A* 2get_A* 3af0_A* 3af1_A* 3af2_A* 3af3_A* 3af4_A* 3avp_A* 3avo_A* 3avq_A* Back     alignment and structure
>1xjc_A MOBB protein homolog; structural genomics, midwest center for structural GEN PSI, protein structure initiative, MCSG; 2.10A {Geobacillus stearothermophilus} SCOP: c.37.1.10 Back     alignment and structure
>1np6_A Molybdopterin-guanine dinucleotide biosynthesis protein B; mixed alpha-beta fold, elongated beta-sheet, walker A motif, P-loop structural motif; 1.90A {Escherichia coli} SCOP: c.37.1.10 PDB: 1p9n_A Back     alignment and structure
>2ffh_A Protein (FFH); SRP54, signal recognition particle, GTPase, M domain, RNA-binding, signal sequence-binding, helix-turn-helix, protein targeting; 3.20A {Thermus aquaticus} SCOP: a.24.13.1 a.36.1.1 c.37.1.10 PDB: 2iy3_A Back     alignment and structure
>1rj9_A FTSY, signal recognition protein; SRP-GTPase domain, heterodimer, nucleotide twinning, protein complex, protein transport; HET: GCP; 1.90A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 2q9c_A* 2q9b_A* 2q9a_A* 1okk_D* 2xkv_D 2iyl_D* 2cnw_D* 2j7p_D* Back     alignment and structure
>4a1f_A DNAB helicase, replicative DNA helicase; hydrolase, DNA replication, ATPase; HET: FLC; 2.50A {Helicobacter pylori} Back     alignment and structure
>2pcj_A ABC transporter, lipoprotein-releasing system ATP-binding protein; structural genomics; 1.70A {Aquifex aeolicus} PDB: 2pcl_A Back     alignment and structure
>1b0u_A Histidine permease; ABC transporter, transport protein; HET: ATP; 1.50A {Salmonella typhimurium} SCOP: c.37.1.12 Back     alignment and structure
>2onk_A Molybdate/tungstate ABC transporter, ATP-binding protein; membrane protein; 3.10A {Archaeoglobus fulgidus} SCOP: c.37.1.12 Back     alignment and structure
>1mv5_A LMRA, multidrug resistance ABC transporter ATP-binding and permease protein; asymmetric dimer, tetramer, P-glycoprotein; HET: ATP ADP; 3.10A {Lactococcus lactis} SCOP: c.37.1.12 Back     alignment and structure
>3bgw_A DNAB-like replicative helicase; ATPase, replication; 3.91A {Bacillus phage SPP1} Back     alignment and structure
>3kta_A Chromosome segregation protein SMC; structural maintenance of chromosomes, ABC ATPase, CFTR adenylate kinase, AP5A, transferase; HET: AP5; 1.63A {Pyrococcus furiosus} PDB: 1xex_A* 1xew_X* Back     alignment and structure
>2zu0_C Probable ATP-dependent transporter SUFC; iron-sulfur cluster, ABC-ATPase, ATP-binding, cytoplasm, nucleotide-binding; HET: MES; 2.20A {Escherichia coli} PDB: 2d3w_A Back     alignment and structure
>2ged_A SR-beta, signal recognition particle receptor beta subunit; protein transport, G protein, proline isomerization, circular permutation; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>1sgw_A Putative ABC transporter; structural genomics, P protein structure initiative, southeast collaboratory for S genomics, secsg; 1.70A {Pyrococcus furiosus} SCOP: c.37.1.12 Back     alignment and structure
>3fvq_A Fe(3+) IONS import ATP-binding protein FBPC; nucleotide binding domain, ABC motor domain, ferric iron TRA ATP-binding, cell inner membrane; HET: ATP; 1.90A {Neisseria gonorrhoeae} Back     alignment and structure
>3vkw_A Replicase large subunit; alpha/beta domain, helicase, transferase; 1.90A {Tomato mosaic virus} Back     alignment and structure
>2olj_A Amino acid ABC transporter; ABC domain, ATPase, hydrolase; HET: ADP; 2.05A {Geobacillus stearothermophilus} PDB: 2olk_A* 2ouk_A 2q0h_A* 3c4j_A* 3c41_J* Back     alignment and structure
>2ghi_A Transport protein; multidrug resistance protein, MDR, structural genomics, structural genomics consortium, SGC; 2.20A {Plasmodium yoelii yoelii str} Back     alignment and structure
>3cr8_A Sulfate adenylyltranferase, adenylylsulfate kinase; APS kinase, transferase, sulfate metabolism, nucleotide 2 kinase; 2.95A {Thiobacillus denitrificans} Back     alignment and structure
>2ixe_A Antigen peptide transporter 1; ABC ATPase, hydrolase; HET: ATP; 2.0A {Rattus norvegicus} PDB: 2ixg_A* 2ixf_A* 1jj7_A* Back     alignment and structure
>3e2i_A Thymidine kinase; Zn-binding, ATP-binding, DNA synthesis, nucleotide-B transferase; HET: MSE; 2.01A {Staphylococcus aureus} Back     alignment and structure
>2d2e_A SUFC protein; ABC-ATPase, SUF protein, 310-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics, binding; 1.70A {Thermus thermophilus} PDB: 2d2f_A* Back     alignment and structure
>1sq5_A Pantothenate kinase; P-loop, transferase; HET: PAU ADP; 2.20A {Escherichia coli} SCOP: c.37.1.6 PDB: 1esm_A* 1esn_A* Back     alignment and structure
>1g6h_A High-affinity branched-chain amino acid transport ATP-binding protein; beta-core domain; HET: ADP; 1.60A {Methanocaldococcus jannaschii} SCOP: c.37.1.12 PDB: 1gaj_A 1g9x_A* Back     alignment and structure
>2pze_A Cystic fibrosis transmembrane conductance regulat; NBD, ABC transporter, CFTR, hydrolase; HET: ATP; 1.70A {Homo sapiens} PDB: 2pzg_A* 2pzf_A* 1ckx_A 1cky_A 1ckw_A 1ckz_A Back     alignment and structure
>1vpl_A ABC transporter, ATP-binding protein; TM0544, structural GENO joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.10A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>1ji0_A ABC transporter; ATP binding protein, structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; HET: ATP; 2.00A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>2yz2_A Putative ABC transporter ATP-binding protein TM_0; cobalt transport, TM02 hydrolase, inner membrane, membrane, nucleotide-binding; 2.30A {Thermotoga maritima} Back     alignment and structure
>3gfo_A Cobalt import ATP-binding protein CBIO 1; structural genomics, cell membrane, cobalt transport, hydrolase, ION transport; 2.30A {Clostridium perfringens atcc 13124} Back     alignment and structure
>2ff7_A Alpha-hemolysin translocation ATP-binding protein HLYB; ABC-transporter, transport protein; HET: ADP; 1.60A {Escherichia coli} SCOP: c.37.1.12 PDB: 2ffb_A* 2fgk_A* 2ffa_A* 2fgj_A* 2pmk_A* 3b5j_A* 1mt0_A 1xef_A* Back     alignment and structure
>2it1_A 362AA long hypothetical maltose/maltodextrin transport ATP-binding protein; structural genomics, NPPSFA; 1.94A {Pyrococcus horikoshii} Back     alignment and structure
>3b85_A Phosphate starvation-inducible protein; PHOH2, ATPase, PFAM: PF02562, ST genomics, PSI-2, protein structure initiative; 2.35A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>2yyz_A Sugar ABC transporter, ATP-binding protein; sugar transport, alpha and beta proteins (A/B) TM0421, structural genomics, NPPSFA; 2.11A {Thermotoga maritima} Back     alignment and structure
>1v43_A Sugar-binding transport ATP-binding protein; ATPase, active transport, sugar uptake and regulation, transport protein; 2.20A {Pyrococcus horikoshii} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 1vci_A* Back     alignment and structure
>3rlf_A Maltose/maltodextrin import ATP-binding protein M; integral membrane protein, ATPase, ABC transporter, membrane transmembrane; HET: UMQ MAL PGV ANP; 2.20A {Escherichia coli} PDB: 1q1e_A 1q12_A* 2awo_A* 3fh6_A 3puv_A* 3puw_A* 3pux_A* 3puy_A* 3puz_A* 3pv0_A* 2awn_A* 2r6g_A* 1q1b_A Back     alignment and structure
>1wb9_A DNA mismatch repair protein MUTS; DNA-binding, ATP-binding, DNA binding, DNA repair, mismatch recognition; HET: DNA ADP; 2.10A {Escherichia coli} SCOP: a.113.1.1 c.37.1.12 c.55.6.1 d.75.2.1 PDB: 1wbb_A* 1e3m_A* 1oh5_A* 1oh6_A* 1oh7_A* 1oh8_A* 1w7a_A* 2wtu_A* 1wbd_A* 1ng9_A* 3k0s_A* Back     alignment and structure
>3tqc_A Pantothenate kinase; biosynthesis of cofactors, prosthetic groups, carriers, TRAN; HET: ADP; 2.30A {Coxiella burnetii} Back     alignment and structure
>4g1u_C Hemin import ATP-binding protein HMUV; membrane transporter, type II ABC importer, HMUT, plasma MEM transport protein-hydrolase complex; 3.01A {Yersinia pestis} Back     alignment and structure
>2qi9_C Vitamin B12 import ATP-binding protein BTUD; inner membrane, membrane, transmembrane, transport, ATP- binding, hydrolase, nucleotide-binding, periplasm; HET: 1PE; 2.60A {Escherichia coli} PDB: 1l7v_C* 4dbl_C Back     alignment and structure
>2gk6_A Regulator of nonsense transcripts 1; UPF1, helicase, NMD, hydrolase; HET: ADP; 2.40A {Homo sapiens} PDB: 2gjk_A* 2gk7_A 2xzo_A* 2xzp_A Back     alignment and structure
>1bif_A 6-phosphofructo-2-kinase/ fructose-2,6-bisphospha; transferase (phospho), phosphatase, hydrolase (phosp glycolysis, bifunctional enzyme; HET: AGS; 2.00A {Rattus norvegicus} SCOP: c.37.1.7 c.60.1.4 PDB: 3bif_A* 2bif_A* 1k6m_A* 1c80_A* 1c7z_A* 1c81_A* 1tip_A* 1fbt_A Back     alignment and structure
>2ocp_A DGK, deoxyguanosine kinase; protein-nucleotide complex, transferase; HET: DTP; 2.80A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>4i1u_A Dephospho-COA kinase; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.05A {Burkholderia vietnamiensis} PDB: 4i1v_A* Back     alignment and structure
>1z47_A CYSA, putative ABC-transporter ATP-binding protein; alpha/beta motif, beta sandwich, ligand binding protein; 1.90A {Alicyclobacillus acidocaldarius} Back     alignment and structure
>3d31_A Sulfate/molybdate ABC transporter, ATP-binding protein; ATP-binding, nucleotide-binding, membrane, transmembrane, transport protein; 3.00A {Methanosarcina acetivorans} SCOP: b.40.6.3 c.37.1.12 Back     alignment and structure
>2ihy_A ABC transporter, ATP-binding protein; ATPase, ABC cassette, hydrolase; HET: MSE; 1.90A {Staphylococcus aureus} Back     alignment and structure
>4edh_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology; HET: TMP ADP; 1.32A {Pseudomonas aeruginosa PAO1} PDB: 4e5u_A* 4esh_A* 4gmd_A* 3uwk_A* 3uwo_A* 3uxm_A* Back     alignment and structure
>2nq2_C Hypothetical ABC transporter ATP-binding protein HI1470; putative iron chelatin ABC transporter, nucleotide binding domain; 2.40A {Haemophilus influenzae} Back     alignment and structure
>2p67_A LAO/AO transport system kinase; ARGK, structural GEN PSI-2, protein structure initiative, NEW YORK SGX research for structural genomics; 1.80A {Escherichia coli} SCOP: c.37.1.10 Back     alignment and structure
>1g29_1 MALK, maltose transport protein MALK; ATPase, active transport, maltose uptake and regulation, sugar binding protein; 1.90A {Thermococcus litoralis} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 2d62_A Back     alignment and structure
>1g8f_A Sulfate adenylyltransferase; alpha-beta protein, beta-barrel, rossmann-fold, kinase fold; 1.95A {Saccharomyces cerevisiae} SCOP: b.122.1.3 c.26.1.5 c.37.1.15 PDB: 1g8g_A* 1g8h_A* 1j70_A 1jec_A 1jed_A* 1jee_A* Back     alignment and structure
>2wsm_A Hydrogenase expression/formation protein (HYPB); metal binding protein; 2.30A {Archaeoglobus fulgidus} Back     alignment and structure
>3h1t_A Type I site-specific restriction-modification system, R (restriction) subunit; hydrolase, restriction enzyme HSDR, ATP-binding; 2.30A {Vibrio vulnificus} Back     alignment and structure
>1gm5_A RECG; helicase, replication restart; HET: DNA ADP; 3.24A {Thermotoga maritima} SCOP: a.24.21.1 b.40.4.9 c.37.1.19 c.37.1.19 Back     alignment and structure
>1q57_A DNA primase/helicase; dntpase, DNA replication, transferase; HET: DNA; 3.45A {Enterobacteria phage T7} SCOP: c.37.1.11 e.13.1.2 Back     alignment and structure
>3sop_A Neuronal-specific septin-3; hydrolase; HET: GDP; 2.88A {Homo sapiens} Back     alignment and structure
>1cz4_A VCP-like ATPase; double-PSI beta-barrel, beta-CLAM, substrate recognition DOM hydrolase; NMR {Thermoplasma acidophilum} SCOP: b.52.2.3 d.31.1.1 PDB: 1cz5_A Back     alignment and structure
>1lw7_A Transcriptional regulator NADR; NMN, NMN adenylyl transferase, ribosylnicotinamide KINA transferase; HET: NAD; 2.90A {Haemophilus influenzae} SCOP: c.26.1.3 c.37.1.1 Back     alignment and structure
>1p5z_B DCK, deoxycytidine kinase; nucleoside kinase, P-loop, ARAC, cytarabine, transferase; HET: AR3 ADP; 1.60A {Homo sapiens} SCOP: c.37.1.1 PDB: 1p60_A* 1p61_B* 1p62_B* 2a7q_A* 2qrn_A* 2qro_A* 3exk_A* 3hp1_A* 2no7_A* 2no1_A* 2no6_A* 2no0_A* 2no9_A* 2noa_A* 2zi5_A* 2zi4_A* 2zi6_A* 2zi7_B* 2zia_A* 3kfx_A* ... Back     alignment and structure
>3gd7_A Fusion complex of cystic fibrosis transmembrane conductance regulator, residues 1193-1427...; CFTR, ABC transporter, nucleotide binding domain, NBD; HET: B44; 2.70A {Homo sapiens} Back     alignment and structure
>1oxx_K GLCV, glucose, ABC transporter, ATP binding protein; ABC-ATPase, ATP-binding cassette, ATPase, transport protein; 1.45A {Sulfolobus solfataricus} SCOP: b.40.6.3 c.37.1.12 PDB: 1oxs_C 1oxt_A 1oxu_A* 1oxv_A* Back     alignment and structure
>4ag6_A VIRB4 ATPase, type IV secretory pathway VIRB4 components-like P; hydrolase, type IV secretion, conjugation; 2.35A {Thermoanaerobacter pseudethanolicus} PDB: 4ag5_A Back     alignment and structure
>2pjz_A Hypothetical protein ST1066; ATP binding protein, structural genomics, NPPSFA; 1.90A {Sulfolobus tokodaii} Back     alignment and structure
>2f9l_A RAB11B, member RAS oncogene family; RAB11B GTPase, vesicle transport, hydrolase; HET: GDP; 1.55A {Homo sapiens} SCOP: c.37.1.8 PDB: 2f9m_A* 1yzk_A* 2hv8_A* 2gzd_A* 2gzh_A* 2d7c_A* 3bfk_A* Back     alignment and structure
>2f1r_A Molybdopterin-guanine dinucleotide biosynthesis protein B (MOBB); structural genomics, PSI, protein structure initiative; 2.10A {Archaeoglobus fulgidus} Back     alignment and structure
>2bbs_A Cystic fibrosis transmembrane conductance regulator; ATP binding cassette, transport protein; HET: ATP; 2.05A {Homo sapiens} PDB: 2bbt_A* 1xmi_A* 1xmj_A* 2bbo_A* 3si7_A* 1r0w_A 1q3h_A 1r0x_A* 1r0y_A* 1r0z_A* 1r10_A* 1xf9_A* 1xfa_A* Back     alignment and structure
>1oix_A RAS-related protein RAB-11A; small G protein, intracellular trafficking, GTP-binding, lipoprotein, prenylation, protein transport; HET: GDP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1oiw_A* 1oiv_A* 3rwo_B* 3rwm_B* Back     alignment and structure
>3tmk_A Thymidylate kinase; phosphotransferase; HET: T5A; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 2tmk_A* 1tmk_A* Back     alignment and structure
>1nrj_B SR-beta, signal recognition particle receptor beta subunit; transmembrane, endoplasmic reticulum, GTP-binding; HET: GTP; 1.70A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>1wp9_A ATP-dependent RNA helicase, putative; ATPase, DNA replication, DNA repair, DNA recombina hydrolase; 2.90A {Pyrococcus furiosus} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>2npi_A Protein CLP1; CLP1-PCF11 complex, ATP binding, ternary complex, transcript; HET: ATP; 2.95A {Saccharomyces cerevisiae} Back     alignment and structure
>2gks_A Bifunctional SAT/APS kinase; transferase, sulfurylase; HET: ADP; 2.31A {Aquifex aeolicus} Back     alignment and structure
>2qtf_A Protein HFLX, GTP-binding protein; beta-alpha-barrels, nucleotide-binding, nucleotide binding protein; 2.00A {Sulfolobus solfataricus P2} PDB: 2qth_A* 3kxi_A* 3kxl_A 3kxk_A Back     alignment and structure
>3tui_C Methionine import ATP-binding protein METN; ABC-transporter, type I ABC type importer, methionine uptake transporter, membrane protein; HET: ADP; 2.90A {Escherichia coli} PDB: 3tuj_C 3tuz_C* 3dhw_C Back     alignment and structure
>1f2t_A RAD50 ABC-ATPase; DNA double-strand break repair, replication; 1.60A {Pyrococcus furiosus} SCOP: c.37.1.12 PDB: 1f2u_A* 1us8_A* Back     alignment and structure
>3nh6_A ATP-binding cassette SUB-family B member 6, mitoc; ABC-transporter, ABCB6, nucleotide binding domain, heme BIOS transport protein; 2.00A {Homo sapiens} PDB: 3nh9_A* 3nha_A* 3nhb_A* Back     alignment and structure
>1ewq_A DNA mismatch repair protein MUTS; multiple domains of protein, mostly mixed alpha-beta structures, one domain is entirely helical; HET: DNA; 2.20A {Thermus aquaticus} SCOP: a.113.1.1 c.37.1.12 c.55.6.1 d.75.2.1 PDB: 1nne_A* 1fw6_A* 1ewr_A* Back     alignment and structure
>2wjy_A Regulator of nonsense transcripts 1; nonsense mediated decay, zinc-finger, ATP-binding, metal-BIN UPF2, UPF1, helicase, hydrolase; 2.50A {Homo sapiens} PDB: 2wjv_A 2iyk_A Back     alignment and structure
>2dyk_A GTP-binding protein; GTPase, ribosome-binding protein, structural genomics; HET: GDP; 1.96A {Thermus thermophilus} Back     alignment and structure
>3v9p_A DTMP kinase, thymidylate kinase; ssgcid, STRU genomics, seattle structural genomics center for infectious transferase; 1.90A {Burkholderia thailandensis} Back     alignment and structure
>3k53_A Ferrous iron transport protein B; GTPase fold, helical bundle, G-protein, prokaryote, GTP-BIND nucleotide-binding, metal transport; 2.70A {Pyrococcus furiosus} Back     alignment and structure
>1tf7_A KAIC; homohexamer, hexamer, circadian clock protein; HET: ATP; 2.80A {Synechococcus SP} SCOP: c.37.1.11 c.37.1.11 PDB: 3s1a_A* 1u9i_A* 2gbl_A* 3dvl_A* 3k0a_A* 3k09_A* 3jzm_A* 3k0e_A* 4dug_A* 3ua2_A* 3k0c_A* 3k0f_A* Back     alignment and structure
>3oiy_A Reverse gyrase helicase domain; topoisomerase, DNA supercoiling, archaea, isomeras; 2.35A {Thermotoga maritima} PDB: 3p4y_A 3p4x_A* Back     alignment and structure
>1z2a_A RAS-related protein RAB-23; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 1.90A {Mus musculus} SCOP: c.37.1.8 PDB: 1z22_A* Back     alignment and structure
>1w36_D RECD, exodeoxyribonuclease V alpha chain; recombination, helicase, hydrolase, DNA repair; HET: DNA; 3.1A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 PDB: 3k70_D* Back     alignment and structure
>2dpy_A FLII, flagellum-specific ATP synthase; beta barrel, alpha-beta structure, hydrolase; HET: ADP; 2.40A {Salmonella typhimurium} Back     alignment and structure
>2o8b_B DNA mismatch repair protein MSH6; DNA damage response, somatic hypermutat protein-DNA complex, DNA mispair, cancer; HET: DNA ADP; 2.75A {Homo sapiens} PDB: 2o8c_B* 2o8d_B* 2o8e_B* 2o8f_B* Back     alignment and structure
>2zej_A Dardarin, leucine-rich repeat kinase 2; parkinson'S disease, LRRK2, ROC, GTPase, ROCO, ATP-B disease mutation, GTP-binding, GTPase activation; HET: GDP; 2.00A {Homo sapiens} PDB: 3d6t_B* Back     alignment and structure
>1kao_A RAP2A; GTP-binding protein, small G protein, GDP, RAS; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2rap_A* 3rap_R* Back     alignment and structure
>2wji_A Ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GNP; 1.90A {Methanocaldococcus jannaschii} PDB: 2wjj_A* 2wjh_A* Back     alignment and structure
>3lv8_A DTMP kinase, thymidylate kinase; structural genomics, in diseases, center for structural genomics of infectious DISE ATP-binding; HET: ADP TMP TYD; 1.80A {Vibrio cholerae o1 biovar eltor} PDB: 3n2i_A* Back     alignment and structure
>1nij_A Hypothetical protein YJIA; structural genomics, P-loop protein, GTP binding, structure function project, S2F, unknown function; 2.00A {Escherichia coli} SCOP: c.37.1.10 d.237.1.1 Back     alignment and structure
>3tbk_A RIG-I helicase domain; DECH helicase, ATP binding, hydrolase; HET: ANP; 2.14A {Mus musculus} Back     alignment and structure
>1tq4_A IIGP1, interferon-inducible GTPase; interferon gamma, dimer, immunology, signaling protein; HET: GDP; 1.95A {Mus musculus} SCOP: c.37.1.8 PDB: 1tqd_A* 1tq6_A* 1tpz_A* 1tq2_A* Back     alignment and structure
>3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* Back     alignment and structure
>2v6i_A RNA helicase; membrane, hydrolase, transmembrane, RNA replication, viral replication, nucleotide-binding; 2.10A {Kokobera virus} PDB: 2v6j_A Back     alignment and structure
>1ek0_A Protein (GTP-binding protein YPT51); vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase; HET: MHO GNP GDP; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>2ce2_X GTPase HRAS; signaling protein, guanine nucleotide binding protein, fluor membrane, lipoprotein, palmitate, prenylation; HET: GDP XY2; 1.0A {Homo sapiens} PDB: 2cl0_X* 2cl6_X* 2cl7_X* 2clc_X* 2evw_X* 2cld_X* 1aa9_A* 1ioz_A* 1q21_A* 6q21_A* 3k9l_A* 3k9n_A* 1ctq_A* 1bkd_R 1crp_A* 1crq_A* 1crr_A* 121p_A* 1gnp_A* 1gnq_A* ... Back     alignment and structure
>1u8z_A RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNHP, GDP, GTPase, signaling protein; HET: GDP; 1.50A {Saguinus oedipus} SCOP: c.37.1.8 PDB: 1u8y_A* 1u90_A* 1uad_A* 1zc3_A* 1zc4_A* 2kwi_A* 2ke5_A* Back     alignment and structure
>2lkc_A Translation initiation factor IF-2; NMR {Geobacillus stearothermophilus} PDB: 2lkd_A* Back     alignment and structure
>2nzj_A GTP-binding protein REM 1; GDP/GTP binding, GTP hydrolysis, RAD and GEM like GTP protein 1, structural genomics; HET: GDP; 2.50A {Homo sapiens} Back     alignment and structure
>1z0j_A RAB-22, RAS-related protein RAB-22A; RAB GTPase, RAB22 GTPase, rabenosyn, endosomal trafficking; HET: GTP; 1.32A {Mus musculus} SCOP: c.37.1.8 PDB: 1yvd_A* Back     alignment and structure
>3ld9_A DTMP kinase, thymidylate kinase; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, ehrlich chaffeensis; 2.15A {Ehrlichia chaffeensis} Back     alignment and structure
>2vp4_A Deoxynucleoside kinase; ATP-binding, DNA synthesis, phosphoprotein, feedback inhibition, deoxyribonucleoside kinase, salvage pathway; HET: DCP; 2.20A {Drosophila melanogaster} SCOP: c.37.1.1 PDB: 1j90_A* 2jj8_A* 2vp2_A* 1oe0_A* 2vp5_A* 2vp6_A* 2vp9_A* 2vpp_A* 2vqs_A* 2vp0_A* 1ot3_A* 2jcs_A* 1zm7_A* 1zmx_A* Back     alignment and structure
>2qag_B Septin-6, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Back     alignment and structure
>1z08_A RAS-related protein RAB-21; RAB GTPase, vesicular trafficking, protein transport; HET: GNP; 1.80A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ot3_B 1yzu_A* 1z0i_A 1yzt_A* Back     alignment and structure
>1wms_A RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, protein transport; HET: GDP; 1.25A {Homo sapiens} SCOP: c.37.1.8 PDB: 1s8f_A* 1yzl_A* 2ocb_A* Back     alignment and structure
>1upt_A ARL1, ADP-ribosylation factor-like protein 1; hydrolase/protein-binding, complex (GTPase/golgin), golgin-245, GRIP, golgin, GTPase, G-protein; HET: GTP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1r4a_A* Back     alignment and structure
>1ky3_A GTP-binding protein YPT7P; vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase, endocytosis/exocytosis complex; HET: GDP; 1.35A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ky2_A* Back     alignment and structure
>2obl_A ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O127} PDB: 2obm_A* Back     alignment and structure
>1pui_A ENGB, probable GTP-binding protein ENGB; structural genomics, nysgxrc T16, GTPase, PSI, protein structure initiative; 2.00A {Escherichia coli} SCOP: c.37.1.8 Back     alignment and structure
>1c1y_A RAS-related protein RAP-1A; GTP-binding proteins, protein-protein complex, effectors, signaling protein; HET: GTP; 1.90A {Homo sapiens} SCOP: c.37.1.8 PDB: 3kuc_A* 1gua_A* 3cf6_R* 3brw_D* Back     alignment and structure
>1g16_A RAS-related protein SEC4; G protein RAB, signaling protein, endocytosis/exocytosis complex; HET: GDP; 1.80A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1g17_A* 2ocy_C 2eqb_A Back     alignment and structure
>1ko7_A HPR kinase/phosphatase; protein kinase, phosphotransfer, protein phosphatase, dual activity, product, substrate, transferase, hydrolase; 1.95A {Staphylococcus xylosus} SCOP: c.98.2.1 c.91.1.2 Back     alignment and structure
>1r2q_A RAS-related protein RAB-5A; GTPase, GNP, atomic resolution, protein transport; HET: GNP; 1.05A {Homo sapiens} SCOP: c.37.1.8 PDB: 1n6h_A* 1tu4_A* 1tu3_A* 1n6k_A* 1n6i_A* 1n6l_A* 1n6o_A* 1n6p_A* 1n6n_A* 1n6r_A* 3mjh_A* 1z0d_A* 1huq_A* 2hei_A* 1z07_A* Back     alignment and structure
>2xzl_A ATP-dependent helicase NAM7; hydrolase-RNA complex, NMD, RNA degradation, allosteric REGU; HET: ADP 1PE; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2wjg_A FEOB, ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GDP; 2.20A {Methanocaldococcus jannaschii} Back     alignment and structure
>3iby_A Ferrous iron transport protein B; G protein, G domain, iron uptake, cell inner membrane, cell GTP-binding, ION transport, membrane; 2.50A {Legionella pneumophila} Back     alignment and structure
>1r8s_A ADP-ribosylation factor 1; protein transport/exchange factor, protein transport-exchang complex; HET: GDP; 1.46A {Bos taurus} SCOP: c.37.1.8 PDB: 1re0_A* 1s9d_A* 1u81_A* 1r8q_A* 1rrf_A* 1rrg_A* 1hur_A* 1o3y_A* 1j2j_A* 2j59_A* 1mr3_F* 2k5u_A* 3lrp_A* 3tjz_A* 3rd1_A* 2ksq_A* 2a5d_A* 2a5f_A* 2j5x_A* 1e0s_A* ... Back     alignment and structure
>4a2p_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.00A {Anas platyrhynchos} PDB: 4a36_A* Back     alignment and structure
>2erx_A GTP-binding protein DI-RAS2; GTP hydrolysis, transport protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3bc1_A RAS-related protein RAB-27A; RAB27, GTPase, RAB, signaling protein, GDPNP, SLP2A, exophil GTP-binding, lipoprotein, membrane, methylation; HET: GNP; 1.80A {Mus musculus} PDB: 2iey_A* 2if0_A* 2zet_A* Back     alignment and structure
>3q85_A GTP-binding protein REM 2; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.76A {Mus musculus} SCOP: c.37.1.8 PDB: 4aii_A* Back     alignment and structure
>3dmq_A RNA polymerase-associated protein RAPA; SWF2/SNF2, transcription factor, RNA polymerase recycling, activator, ATP-binding, DNA-binding; 3.20A {Escherichia coli K12} Back     alignment and structure
>4tmk_A Protein (thymidylate kinase); ATP:DTMP phosphotransferase, transferase; HET: T5A; 1.98A {Escherichia coli} SCOP: c.37.1.1 PDB: 5tmp_A* Back     alignment and structure
>3a1s_A Iron(II) transport protein B; FEOB, iron transporter, small GTPase, G protein, GDI; HET: GDP; 1.50A {Thermotoga maritima} PDB: 3a1t_A* 3a1u_A* 3a1v_A* 3a1w_A Back     alignment and structure
>3q72_A GTP-binding protein RAD; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.66A {Homo sapiens} SCOP: c.37.1.8 PDB: 3q7p_A* 3q7q_A* 2gjs_A* 2dpx_A* Back     alignment and structure
>1z0f_A RAB14, member RAS oncogene family; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 2.15A {Homo sapiens} SCOP: c.37.1.8 PDB: 2aed_A* 4drz_A* Back     alignment and structure
>4dsu_A GTPase KRAS, isoform 2B; small G-protein, signaling, hydrolase; HET: GDP; 1.70A {Homo sapiens} PDB: 4dsn_A* 4dst_A* 4dso_A* Back     alignment and structure
>3ice_A Transcription termination factor RHO; transcription, ATPase, hexamer, helicase, RNA, RECA, OB fold ATP-binding, hydrolase; HET: MSE ADP SPD; 2.80A {Escherichia coli k-12} PDB: 1pv4_A 1pvo_A* 1xpo_A* 1xpr_A* 1xpu_A* 2ht1_A Back     alignment and structure
>2fn4_A P23, RAS-related protein R-RAS; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ery_A* Back     alignment and structure
>3clv_A RAB5 protein, putative; malaria, GTPase, structural genomics, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.89A {Plasmodium falciparum} Back     alignment and structure
>2y8e_A RAB-protein 6, GH09086P, RAB6; hydrolase, nucleotide binding, GTP binding; HET: GNP; 1.39A {Drosophila melanogaster} PDB: 3cwz_A* 1yzq_A* 2gil_A* 2e9s_A* 2fe4_A* 2ffq_A* 1d5c_A* Back     alignment and structure
>3con_A GTPase NRAS; structural genomics consortium, SGC, GDP, oncogene, disease mutation, golgi apparatus, GTP-binding, lipoprotein membrane, methylation; HET: GDP; 1.65A {Homo sapiens} PDB: 2pmx_A* 3gft_A* 4q21_A* Back     alignment and structure
>2oil_A CATX-8, RAS-related protein RAB-25; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.30A {Homo sapiens} Back     alignment and structure
>2hxs_A RAB-26, RAS-related protein RAB-28; GTPase, signaling protein; HET: G3D; 1.10A {Homo sapiens} PDB: 2hy4_A* 3e5h_A* Back     alignment and structure
>2a9k_A RAS-related protein RAL-A; bacterial ADP-ribosyltransferase, RAL, RHO, GD binding; HET: GDP NAD; 1.73A {Homo sapiens} SCOP: c.37.1.8 PDB: 2a78_A* Back     alignment and structure
>3tw8_B RAS-related protein RAB-35; longin domain, RAB GTPase, guanine exchange factor; 2.10A {Homo sapiens} Back     alignment and structure
>2efe_B Small GTP-binding protein-like; GEF, GTPase, VPS9, nucleotide, transport protein; HET: GNH; 2.08A {Arabidopsis thaliana} PDB: 2efd_B 2efc_B* 2efh_B* Back     alignment and structure
>1m7b_A RND3/RHOE small GTP-binding protein; small GTPase, signaling protein; HET: GTP; 2.00A {Homo sapiens} SCOP: c.37.1.8 PDB: 2v55_B* Back     alignment and structure
>2gj8_A MNME, tRNA modification GTPase TRME; G-domain dimer, alpha-beta-sandwich, hydrolase; HET: GDP; 1.70A {Escherichia coli BL21} SCOP: c.37.1.8 PDB: 2gj9_A* 2gja_A* 1rfl_A Back     alignment and structure
>3qks_A DNA double-strand break repair RAD50 ATPase; RECA-like fold, coiled-coils, ATPase, exonuclease, endonucle binding, DNA binding; HET: DNA; 2.10A {Pyrococcus furiosus} PDB: 3qkr_A* Back     alignment and structure
>2atv_A RERG, RAS-like estrogen-regulated growth inhibitor; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2bme_A RAB4A, RAS-related protein RAB4A; GTP-binding protein, vesicular transport, endocytosis, prenylation, protein transport, transport; HET: GNP; 1.57A {Homo sapiens} SCOP: c.37.1.8 PDB: 2bmd_A* 1yu9_A* 1z0k_A* Back     alignment and structure
>1mh1_A RAC1; GTP-binding, GTPase, small G-protein, RHO family, RAS super family; HET: GNP; 1.38A {Homo sapiens} SCOP: c.37.1.8 PDB: 1hh4_A* 2p2l_A* 2h7v_A* 1g4u_R* 1i4d_D* 1i4l_D* 2vrw_A 1e96_A* 1i4t_D* 2rmk_A* 2yin_C 1ryf_A* 1ryh_A* 3su8_A* 3sua_A* 2fju_A* 1he1_C* 2nz8_A 1foe_B 3bji_C ... Back     alignment and structure
>3kkq_A RAS-related protein M-RAS; GTP-binding, GTPase, signaling protein; HET: GDP; 1.20A {Mus musculus} SCOP: c.37.1.8 PDB: 3kkp_A* 3kko_A* 3pit_A* 3pir_A* 1x1r_A* 1x1s_A* Back     alignment and structure
>1svi_A GTP-binding protein YSXC; ENGB, GTPase, GDP, hydrolase; HET: GDP; 1.95A {Bacillus subtilis} SCOP: c.37.1.8 PDB: 1sul_A* 1svw_A* Back     alignment and structure
>3b1v_A Ferrous iron uptake transporter protein B; G protein, iron transport, GTPase, transmembrane, potassium; HET: GGM; 1.85A {Streptococcus thermophilus} PDB: 3b1w_A* 3lx5_A* 3lx8_A* 3ss8_A* 3b1z_A 3b1y_A* 3b1x_A* 3tah_A* Back     alignment and structure
>3bfv_A CAPA1, CAPB2, membrane protein CAPA1, protein tyrosine kinase; chimerical protein, P-loop protein, capsule biogenesis/degradation; HET: ADP; 1.80A {Staphylococcus aureus} PDB: 2ved_A* Back     alignment and structure
>2g6b_A RAS-related protein RAB-26; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, unknown function; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1yrb_A ATP(GTP)binding protein; GTPase, P-loop, rossman fold, GDP, HYDR; HET: GDP; 1.75A {Pyrococcus abyssi} SCOP: c.37.1.10 PDB: 1yr6_A* 1yr8_A* 1yr9_A* 1yra_A* 1yr7_A* 2oxr_A* Back     alignment and structure
>1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus} Back     alignment and structure
>3ihw_A Centg3; RAS, centaurin, GTPase, structural genomics, structural genomics consortium, SGC, alternative splicing, ANK repeat, cytoplasm, GTP-binding; 1.92A {Homo sapiens} SCOP: c.37.1.0 Back     alignment and structure
>1knx_A Probable HPR(Ser) kinase/phosphatase; HPR kinase, HPR kinase/phosphatase, HPRK/P, P-loop, walker A BOX, catabolite repression; 2.50A {Mycoplasma pneumoniae} SCOP: c.98.2.1 c.91.1.2 Back     alignment and structure
>3t1o_A Gliding protein MGLA; G domain containing protein, bacterial GTPase, bacterial POL motility, POLE localisation, alpha/beta protein; HET: GDP; 1.90A {Thermus thermophilus} PDB: 3t12_A* 3t1q_A* 3t1t_A* 3t1v_A* Back     alignment and structure
>3tkl_A RAS-related protein RAB-1A; vesicle trafficking, protein transport-protein binding compl; HET: GTP; 2.18A {Homo sapiens} Back     alignment and structure
>3c5c_A RAS-like protein 12; GDP, GTPase, structural genomics consortium, SGC, limited proteolysis, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.85A {Homo sapiens} Back     alignment and structure
>3hjn_A DTMP kinase, thymidylate kinase; ATP-binding, nucleotide biosynth nucleotide-binding, transferase, structural genomics; HET: ADP TYD; 2.10A {Thermotoga maritima} Back     alignment and structure
>2p5s_A RAS and EF-hand domain containing; G-protein, RAB, GDP, structural genomics, SGC, structural genomics consortium, signaling protein; HET: GDP; 2.15A {Homo sapiens} Back     alignment and structure
>2gf9_A RAS-related protein RAB-3D; G-protein, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.53A {Homo sapiens} PDB: 3rab_A* Back     alignment and structure
>1m2o_B GTP-binding protein SAR1, GTP binding protein; zinc-finger, beta barrel, VWA domain, gelsolin domain,; HET: GNP; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 2qtv_B* Back     alignment and structure
>3bwd_D RAC-like GTP-binding protein ARAC6; G domain, cytoplasm, lipoprotein, membrane, methylation, nucleotide-binding, prenylation, ----; HET: GDP; 1.53A {Arabidopsis thaliana} PDB: 2nty_C* 2wbl_C Back     alignment and structure
>1jr3_D DNA polymerase III, delta subunit; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1jqj_C* 1xxh_A* 1xxi_A* 3glf_A* 3glg_A* 3glh_A* 3gli_A* Back     alignment and structure
>2eyq_A TRCF, transcription-repair coupling factor; MFD, SF2 ATPase, hydrolase; HET: EPE; 3.20A {Escherichia coli} SCOP: b.34.18.1 c.37.1.19 c.37.1.19 c.37.1.19 c.37.1.19 d.315.1.1 Back     alignment and structure
>2bov_A RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, RAla, GTPase, ribosylating toxin, GTP-binding, lipoprotein, prenylation; HET: GDP; 2.66A {Homo sapiens} Back     alignment and structure
>3i8s_A Ferrous iron transport protein B; GTPase, GPCR, iron uptake, FEO, cell inner membrane, cell ME GTP-binding, ION transport, membrane; 1.80A {Escherichia coli} PDB: 3i8x_A* 3i92_A* 3hyr_A 3hyt_A* 2wic_A* 2wib_A* 2wia_A* Back     alignment and structure
>1vg8_A RAS-related protein RAB-7; GTP-binding protein, protein transport; HET: GNP; 1.70A {Rattus norvegicus} SCOP: c.37.1.8 PDB: 1vg0_B* 3law_A* 1t91_A* 1yhn_A* 1vg1_A* 1vg9_B* Back     alignment and structure
>3euj_A Chromosome partition protein MUKB, linker; MUKB, MUKE, chromosome condensation, condensin, SMC, N subunit, ABC-type ATPase, WHD, ATP-binding; HET: AGS; 3.10A {Haemophilus ducreyi} PDB: 3euk_A* Back     alignment and structure
>2cxx_A Probable GTP-binding protein ENGB; structural genomics, NPPSFA, national P protein structural and functional analyses; HET: GDP; 1.70A {Pyrococcus horikoshii} SCOP: c.37.1.8 Back     alignment and structure
>3pqc_A Probable GTP-binding protein ENGB; rossmann fold, GTPase, cell cycle, hydrolase; HET: GDP; 1.90A {Thermotoga maritima} PDB: 3pr1_A Back     alignment and structure
>1z06_A RAS-related protein RAB-33B; RAB GTPase, RAB33B GTPase, vesicular trafficking, protein transport; HET: GNP; 1.81A {Mus musculus} SCOP: c.37.1.8 PDB: 2g77_B* Back     alignment and structure
>1oyw_A RECQ helicase, ATP-dependent DNA helicase; winged helix, helix-turn-helix, ATP binding, Zn(2+) binding, hydrolase; 1.80A {Escherichia coli} SCOP: a.4.5.43 c.37.1.19 c.37.1.19 PDB: 1oyy_A* Back     alignment and structure
>3qf7_A RAD50; ABC-ATPase, ATPase, hydrolase; HET: ANP; 1.90A {Thermotoga maritima} PDB: 3qg5_A 3tho_A* Back     alignment and structure
>4hlc_A DTMP kinase, thymidylate kinase; TMK, MRSA, pipiridine, transfera transferase inhibitor complex; HET: T05; 1.55A {Staphylococcus aureus subsp} PDB: 2cck_A 4gfd_A* 4gsy_A* 4hdc_A* 4hej_A* 2ccj_A* 4hld_A* 2ccg_A* Back     alignment and structure
>2a5j_A RAS-related protein RAB-2B; GTPase, signal transduction, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.50A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z0a_A* Back     alignment and structure
>2gxq_A Heat resistant RNA dependent ATPase; RNA helicase, atomic resolution, AMP complex, ribosome biogenesis, thermophilic, hydrolase; HET: AMP; 1.20A {Thermus thermophilus HB27} PDB: 2gxs_A* 2gxu_A 3mwj_A 3mwk_A* 3mwl_A* 3nbf_A* 3nej_A Back     alignment and structure
>2rcn_A Probable GTPase ENGC; YJEQ, circularly permuted, GTP-binding, hydrolase, nucleotide-binding; HET: GDP; 2.25A {Salmonella typhimurium} PDB: 2ykr_W 4a2i_V Back     alignment and structure
>1zd9_A ADP-ribosylation factor-like 10B; transport protein, GDP-binding, membrane trafficking, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2al7_A* 2h18_A* Back     alignment and structure
>1x3s_A RAS-related protein RAB-18; GTPase, GNP, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GNP; 1.32A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3dz8_A RAS-related protein RAB-3B; GDP, GTPase, structural genomics consortium, SGC, cell GTP-binding, lipoprotein, membrane, methylation; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1e9r_A Conjugal transfer protein TRWB; coupling protein, bacterial conjugation, F1-ATPase-like quaternary structure, ring helicases; 2.4A {Escherichia coli} SCOP: c.37.1.11 PDB: 1e9s_A 1gki_A* 1gl7_A* 1gl6_A* Back     alignment and structure
>3cio_A ETK, tyrosine-protein kinase ETK; WZC, escherichia coli tyrosine kinase domain, signaling protein, transferase, inner membrane, membrane; 2.50A {Escherichia coli} Back     alignment and structure
>2fg5_A RAB-22B, RAS-related protein RAB-31; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.80A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3reg_A RHO-like small GTPase; cytoskeleton, nucleotide-binding, GTP-binding, signaling Pro lipoprotein, prenylation; HET: GSP; 1.80A {Entamoeba histolytica} PDB: 3ref_B* 4dvg_A* Back     alignment and structure
>3t5g_A GTP-binding protein RHEB; immunoglobulin-like beta sandwitch, PDE delta, RHEB; HET: GDP FAR; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 1xtq_A* 1xtr_A* 1xts_A* 2l0x_A* 3sea_A* Back     alignment and structure
>2iwr_A Centaurin gamma 1; ANK repeat, zinc-finger, GTP-binding, polymorphism, nucleotide-binding, alternative splicing, protein transport; HET: CAF; 1.5A {Homo sapiens} PDB: 2bmj_A Back     alignment and structure
>4gl2_A Interferon-induced helicase C domain-containing P; MDA5, dsRNA, anti-viral signaling, RIG-I, MAVS, oligomerizat helicase, ATPase; HET: ANP; 3.56A {Homo sapiens} Back     alignment and structure
>3b5x_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; 5.50A {Vibrio cholerae} Back     alignment and structure
>2b6h_A ADP-ribosylation factor 5; membrane trafficking, GDP, structural genomics, structural G consortium, SGC, protein transport; HET: GDP; 1.76A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z6x_A* 3aq4_A* Back     alignment and structure
>1qhl_A Protein (cell division protein MUKB); SMC, chromosome partitioning; 2.20A {Escherichia coli} SCOP: c.37.1.12 Back     alignment and structure
>2yv5_A YJEQ protein; hydrolase, GTPase, permutation, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GDP; 1.90A {Aquifex aeolicus} Back     alignment and structure
>2www_A Methylmalonic aciduria type A protein, mitochondrial; transport protein, nucleotide-binding; HET: GDP 2PE; 2.64A {Homo sapiens} Back     alignment and structure
>1fzq_A ADP-ribosylation factor-like protein 3; protein-GDP complex without magnesium, ARF family, RAS superfamily, G-domain, signaling protein; HET: MES GDP; 1.70A {Mus musculus} SCOP: c.37.1.8 PDB: 3bh7_A* 3bh6_A* Back     alignment and structure
>1zbd_A Rabphilin-3A; G protein, effector, RABCDR, synaptic exocytosis, RAB protein, RAB3A; HET: GTP; 2.60A {Rattus norvegicus} SCOP: c.37.1.8 Back     alignment and structure
>2bcg_Y Protein YP2, GTP-binding protein YPT1; RABGTPase, geranylgeranylation, vesicular transport, protein transport; HET: GDP GER; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ukv_Y* 3cue_F* 1yzn_A* 3sfv_A* 2wwx_A 2fol_A* 3nkv_A* 3jza_A* 2rhd_A* Back     alignment and structure
>2gf0_A GTP-binding protein DI-RAS1; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, transport protein; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3cph_A RAS-related protein SEC4; RAB GTPase, prenylation, vesicular transport, cytoplasm, cytoplasmic vesicle, exocytosis, GTP-binding; HET: GDP; 2.90A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>1ksh_A ARF-like protein 2; small GTPase, small GTP-binding protein, ARF family; HET: CME GDP; 1.80A {Mus musculus} SCOP: c.37.1.8 PDB: 1ksg_A* 1ksj_A* 3doe_A* 3dof_A* Back     alignment and structure
>3oes_A GTPase rhebl1; small GTPase, structural genomics, structural genomics conso SGC, hydrolase; HET: GNP; 2.30A {Homo sapiens} Back     alignment and structure
>1qde_A EIF4A, translation initiation factor 4A; DEAD box protein family, gene regulation; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 1qva_A Back     alignment and structure
>2fh5_B SR-beta, signal recognition particle receptor beta subunit; endomembrane targeting, GTPase, GAP, longin domain, SEDL, transport protein; HET: GTP; 2.45A {Mus musculus} SCOP: c.37.1.8 PDB: 2go5_2 Back     alignment and structure
>1u0l_A Probable GTPase ENGC; permutation, OB-fold, zinc-finger, structural genomics, BSGC structure funded by NIH, protein structure initiative, PSI; HET: GDP; 2.80A {Thermotoga maritima} SCOP: b.40.4.5 c.37.1.8 Back     alignment and structure
>1gwn_A RHO-related GTP-binding protein RHOE; GTPase, inactive GTPase, signal transduction; HET: GTP; 2.1A {Mus musculus} SCOP: c.37.1.8 Back     alignment and structure
>1moz_A ARL1, ADP-ribosylation factor-like protein 1; GTP-binding, protein binding; HET: GDP; 3.17A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 197
d1lv7a_ 256 c.37.1.20 (A:) AAA domain of cell division protein 1e-45
d1ixza_ 247 c.37.1.20 (A:) AAA domain of cell division protein 2e-45
d1e32a394 d.31.1.1 (A:107-200) Membrane fusion atpase p97 do 3e-39
d1e32a2 258 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p 1e-38
d1r7ra3 265 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p 1e-35
d1w44a_ 321 c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [Ta 4e-26
d1svma_ 362 c.37.1.20 (A:) Papillomavirus large T antigen heli 1e-19
d1d2na_ 246 c.37.1.20 (A:) Hexamerization domain of N-ethylmal 3e-16
d1gvnb_ 273 c.37.1.21 (B:) Plasmid maintenance system epsilon/ 7e-16
d1cz5a294 d.31.1.1 (A:92-185) C-terminal domain of VAT-N, VA 2e-15
d1ixsb2 239 c.37.1.20 (B:4-242) Holliday junction helicase Ruv 7e-13
d1ofha_ 309 c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId 8e-12
d1fnna2 276 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrob 9e-10
d1sxja2 253 c.37.1.20 (A:295-547) Replication factor C1 {Baker 2e-09
d1in4a2 238 c.37.1.20 (A:17-254) Holliday junction helicase Ru 3e-08
d1g41a_ 443 c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId 1e-07
d1w5sa2 287 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-t 5e-07
d1zp6a1176 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 { 6e-06
d1ny5a2 247 c.37.1.20 (A:138-384) Transcriptional activator si 4e-05
d1a5ta2 207 c.37.1.20 (A:1-207) delta prime subunit of DNA pol 2e-04
d1qhxa_178 c.37.1.3 (A:) Chloramphenicol phosphotransferase { 3e-04
d1g8pa_ 333 c.37.1.20 (A:) ATPase subunit of magnesium chelata 3e-04
d1um8a_ 364 c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 2 4e-04
d2gnoa2 198 c.37.1.20 (A:11-208) gamma subunit of DNA polymera 4e-04
d1y63a_174 c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishma 4e-04
d2fnaa2 283 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfo 4e-04
d1kaga_169 c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia 6e-04
d1njfa_ 239 c.37.1.20 (A:) delta prime subunit of DNA polymera 0.001
d1sxje2 252 c.37.1.20 (E:4-255) Replication factor C5 {Baker's 0.001
d1lw7a2 192 c.37.1.1 (A:220-411) Transcriptional regulator Nad 0.002
d1r6bx2 268 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, A 0.002
d1yj5a2172 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' p 0.003
d1rkba_173 c.37.1.1 (A:) Adenylate kinase {Human (Homo sapien 0.003
d1e6ca_170 c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chr 0.003
d1knqa_171 c.37.1.17 (A:) Gluconate kinase {Escherichia coli 0.003
d1m8pa3183 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal d 0.004
d2bdta1176 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {B 0.004
d1viaa_161 c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobact 0.004
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Length = 256 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: AAA domain of cell division protein FtsH
species: Escherichia coli [TaxId: 562]
 Score =  149 bits (378), Expect = 1e-45
 Identities = 50/114 (43%), Positives = 73/114 (64%), Gaps = 1/114 (0%)

Query: 83  VGYDDIGGCRKQLAQIKEMVELPLRHPSLFKAIGVKPPRGILLYGPPGTGKTLIARAVAN 142
             + D+ GC +   ++ E+VE  LR PS F+ +G K P+G+L+ GPPGTGKTL+A+A+A 
Sbjct: 9   TTFADVAGCDEAKEEVAELVEY-LREPSRFQKLGGKIPKGVLMVGPPGTGKTLLAKAIAG 67

Query: 143 ETGAFFFLINGPEIMSKLAGESESNLRKAFEEADKNSPSIIFIDELDAIAPKRE 196
           E    FF I+G + +    G   S +R  FE+A K +P IIFIDE+DA+  +R 
Sbjct: 68  EAKVPFFTISGSDFVEMFVGVGASRVRDMFEQAKKAAPCIIFIDEIDAVGRQRG 121


>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Length = 247 Back     information, alignment and structure
>d1e32a3 d.31.1.1 (A:107-200) Membrane fusion atpase p97 domain 2, P97-Nc {Mouse (Mus musculus) [TaxId: 10090]} Length = 94 Back     information, alignment and structure
>d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Length = 258 Back     information, alignment and structure
>d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Length = 265 Back     information, alignment and structure
>d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} Length = 321 Back     information, alignment and structure
>d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} Length = 362 Back     information, alignment and structure
>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Length = 246 Back     information, alignment and structure
>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Length = 273 Back     information, alignment and structure
>d1cz5a2 d.31.1.1 (A:92-185) C-terminal domain of VAT-N, VAT-Nc {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Length = 94 Back     information, alignment and structure
>d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} Length = 239 Back     information, alignment and structure
>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Length = 309 Back     information, alignment and structure
>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Length = 276 Back     information, alignment and structure
>d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 253 Back     information, alignment and structure
>d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} Length = 238 Back     information, alignment and structure
>d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Length = 443 Back     information, alignment and structure
>d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} Length = 287 Back     information, alignment and structure
>d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} Length = 176 Back     information, alignment and structure
>d1ny5a2 c.37.1.20 (A:138-384) Transcriptional activator sigm54 (NtrC1), C-terminal domain {Aquifex aeolicus [TaxId: 63363]} Length = 247 Back     information, alignment and structure
>d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Length = 207 Back     information, alignment and structure
>d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} Length = 178 Back     information, alignment and structure
>d1g8pa_ c.37.1.20 (A:) ATPase subunit of magnesium chelatase, BchI {Rhodobacter capsulatus [TaxId: 1061]} Length = 333 Back     information, alignment and structure
>d1um8a_ c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 210]} Length = 364 Back     information, alignment and structure
>d2gnoa2 c.37.1.20 (A:11-208) gamma subunit of DNA polymerase III, N-domain {Thermotoga maritima [TaxId: 2336]} Length = 198 Back     information, alignment and structure
>d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} Length = 174 Back     information, alignment and structure
>d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} Length = 283 Back     information, alignment and structure
>d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} Length = 169 Back     information, alignment and structure
>d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Length = 239 Back     information, alignment and structure
>d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 252 Back     information, alignment and structure
>d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} Length = 192 Back     information, alignment and structure
>d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Length = 268 Back     information, alignment and structure
>d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 172 Back     information, alignment and structure
>d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} Length = 173 Back     information, alignment and structure
>d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} Length = 170 Back     information, alignment and structure
>d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} Length = 171 Back     information, alignment and structure
>d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Length = 183 Back     information, alignment and structure
>d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} Length = 176 Back     information, alignment and structure
>d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} Length = 161 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query197
d1ixza_ 247 AAA domain of cell division protein FtsH {Thermus 99.94
d1lv7a_ 256 AAA domain of cell division protein FtsH {Escheric 99.93
d1e32a2 258 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 99.93
d1r7ra3 265 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 99.91
d1ofha_ 309 HslU {Haemophilus influenzae [TaxId: 727]} 99.77
d1d2na_ 246 Hexamerization domain of N-ethylmalemide-sensitive 99.77
d1w44a_ 321 NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} 99.71
d1ixsb2 239 Holliday junction helicase RuvB {Thermus thermophi 99.65
d1in4a2 238 Holliday junction helicase RuvB {Thermotoga mariti 99.65
d1iqpa2 231 Replication factor C {Archaeon Pyrococcus furiosus 99.53
d1sxja2 253 Replication factor C1 {Baker's yeast (Saccharomyce 99.5
d1l8qa2213 Chromosomal replication initiation factor DnaA {Aq 99.49
d1sxjc2 227 Replication factor C3 {Baker's yeast (Saccharomyce 99.45
d1sxjb2 224 Replication factor C4 {Baker's yeast (Saccharomyce 99.42
d1jbka_195 ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} 99.41
d1r6bx2 268 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 99.38
d1njfa_ 239 delta prime subunit of DNA polymerase III, N-domai 99.34
d1sxjd2 237 Replication factor C2 {Baker's yeast (Saccharomyce 99.32
d1r6bx3 315 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 99.3
d1um8a_ 364 ClpX {Helicobacter pylori [TaxId: 210]} 99.27
d1fnna2 276 CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T 99.23
d1qvra2 387 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 99.21
d1qvra3 315 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 99.21
d1sxje2 252 Replication factor C5 {Baker's yeast (Saccharomyce 99.2
d1gvnb_ 273 Plasmid maintenance system epsilon/zeta, toxin zet 99.1
d1g41a_ 443 HslU {Haemophilus influenzae [TaxId: 727]} 99.07
d1svma_ 362 Papillomavirus large T antigen helicase domain {Si 99.04
d1g8pa_ 333 ATPase subunit of magnesium chelatase, BchI {Rhodo 99.03
d1w5sa2 287 CDC6-like protein APE0152, N-terminal domain {Aero 99.03
d1ny5a2 247 Transcriptional activator sigm54 (NtrC1), C-termin 99.01
d1e32a394 Membrane fusion atpase p97 domain 2, P97-Nc {Mouse 98.99
d2fnaa2 283 Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ 98.77
d1a5ta2207 delta prime subunit of DNA polymerase III, N-domai 98.73
d1ye8a1 178 Hypothetical kinase-like protein Aq_1292 {Aquifex 98.64
d1kaga_169 Shikimate kinase (AroK) {Escherichia coli [TaxId: 98.53
d1lw7a2 192 Transcriptional regulator NadR, ribosylnicotinamid 98.5
d2gnoa2 198 gamma subunit of DNA polymerase III, N-domain {The 98.43
d1rkba_173 Adenylate kinase {Human (Homo sapiens), isoenzyme 98.43
d1p9ra_ 401 Extracellular secretion NTPase EpsE {Vibrio choler 98.37
d1zp6a1176 Hypothetical protein Atu3015 {Agrobacterium tumefa 98.34
d1qhxa_178 Chloramphenicol phosphotransferase {Streptomyces v 98.32
d1viaa_161 Shikimate kinase (AroK) {Campylobacter jejuni [Tax 98.3
d1e6ca_170 Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax 98.29
d2iyva1165 Shikimate kinase (AroK) {Mycobacterium tuberculosi 98.24
d1knqa_171 Gluconate kinase {Escherichia coli [TaxId: 562]} 98.22
d2i3ba1 189 Cancer-related NTPase, C1orf57 {Human (Homo sapien 98.22
d1y63a_174 Probable kinase LmjF30.1890 {Leishmania major [Tax 98.19
d2bdta1176 Hypothetical protein BH3686 {Bacillus halodurans [ 98.19
d1g6oa_323 Hexameric traffic ATPase, HP0525 {Helicobacter pyl 98.18
d1zaka1 189 Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} 98.11
d1yj5a2172 5' polynucleotide kinase-3' phosphatase, C-termina 98.09
d1qf9a_ 194 UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 98.07
d1tf7a2 242 Circadian clock protein KaiC {Synechococcus sp. st 98.07
d1ak2a1 190 Adenylate kinase {Cow (Bos taurus), mitochondrial 98.04
d1zina1 182 Adenylate kinase {Bacillus stearothermophilus [Tax 98.04
d2a5yb3 277 CED-4, NB-ARC domain {Caenorhabditis elegans [TaxI 98.04
d1bifa1 213 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata 98.02
d1m8pa3183 ATP sulfurylase C-terminal domain {Fungus (Penicil 98.02
d1ly1a_152 Polynucleotide kinase, kinase domain {Bacteriophag 98.01
d2cdna1 181 Adenylate kinase {Mycobacterium tuberculosis [TaxI 97.99
d1u94a1 263 RecA protein, ATPase-domain {Escherichia coli [Tax 97.99
d1a1va1136 HCV helicase domain {Human hepatitis C virus (HCV) 97.97
d1ukza_ 196 Uridylate kinase {Baker's yeast (Saccharomyces cer 97.95
d1xp8a1 268 RecA protein, ATPase-domain {Deinococcus radiodura 97.95
d1s3ga1 182 Adenylate kinase {Bacillus globisporus [TaxId: 145 97.94
d2qy9a2 211 GTPase domain of the signal recognition particle r 97.94
d1teva_ 194 UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606] 97.93
d1akya1 180 Adenylate kinase {Baker's yeast (Saccharomyces cer 97.93
d1mo6a1 269 RecA protein, ATPase-domain {Mycobacterium tubercu 97.93
d2ak3a1 189 Adenylate kinase {Cow (Bos taurus), mitochondrial 97.92
d1x6va3195 Adenosine-5'phosphosulfate kinase (APS kinase) {Hu 97.91
d3adka_ 194 Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} 97.9
d1ckea_ 225 CMP kinase {Escherichia coli [TaxId: 562]} 97.88
d1e4va1 179 Adenylate kinase {Escherichia coli [TaxId: 562]} 97.87
d1j8yf2211 GTPase domain of the signal sequence recognition p 97.86
d1q3ta_ 223 CMP kinase {Streptococcus pneumoniae [TaxId: 1313] 97.84
d1vmaa2 213 GTPase domain of the signal recognition particle r 97.79
d1tf7a1 242 Circadian clock protein KaiC {Synechococcus sp. st 97.75
d1np6a_170 Molybdopterin-guanine dinucleotide biosynthesis pr 97.73
d1khta_ 190 Adenylate kinase {Archaeon Methanococcus voltae [T 97.7
d1okkd2 207 GTPase domain of the signal recognition particle r 97.7
d1m7ga_ 208 Adenosine-5'phosphosulfate kinase (APS kinase) {Fu 97.67
d1ls1a2 207 GTPase domain of the signal sequence recognition p 97.64
d1yksa1140 YFV helicase domain {Yellow fever virus [TaxId: 11 97.6
d2fz4a1206 DNA repair protein RAD25 {Archaeoglobus fulgidus [ 97.59
d1rz3a_198 Hypothetical protein rbstp0775 {Bacillus stearothe 97.58
d1nksa_ 194 Adenylate kinase {Archaeon Sulfolobus acidocaldari 97.51
d1gkya_ 186 Guanylate kinase {Baker's yeast (Saccharomyces cer 97.5
d1lvga_ 190 Guanylate kinase {Mouse (Mus musculus) [TaxId: 100 97.48
d1w36d1 359 Exodeoxyribonuclease V alpha chain (RecD) {Escheri 97.41
d1szpa2 251 DNA repair protein Rad51, catalytic domain {Baker' 97.37
d1cr2a_ 277 Gene 4 protein (g4p, DNA primase), helicase domain 97.32
d1tuea_205 Replication protein E1 helicase domain {Human papi 97.28
d1n0wa_ 242 DNA repair protein Rad51, catalytic domain {Human 97.26
d1pzna2 254 DNA repair protein Rad51, catalytic domain {Archae 97.25
d1gm5a3264 RecG helicase domain {Thermotoga maritima [TaxId: 97.25
d1wb9a2 234 DNA repair protein MutS, the C-terminal domain {Es 97.25
d1znwa1 182 Guanylate kinase {Mycobacterium tuberculosis [TaxI 97.15
d1xjca_165 Molybdopterin-guanine dinucleotide biosynthesis pr 97.15
d1v5wa_ 258 Meiotic recombination protein DMC1/LIM15 homolog { 97.14
d1uj2a_ 213 Uridine-cytidine kinase 2 {Human (Homo sapiens) [T 97.1
d1htwa_158 Hypothetical protein HI0065 {Haemophilus influenza 97.08
d1cz5a294 C-terminal domain of VAT-N, VAT-Nc {Archaeon Therm 97.06
d1kgda_178 Guanylate kinase-like domain of Cask {Human (Homo 97.02
d1wp9a1200 putative ATP-dependent RNA helicase PF2015 {Pyroco 97.0
d2eyqa3233 Transcription-repair coupling factor, TRCF {Escher 96.97
d2p6ra3202 Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 96.94
d1kkma_176 HPr kinase HprK C-terminal domain {Lactobacillus c 96.92
d2b8ta1139 Thymidine kinase, TK1, N-terminal domain {Ureaplas 96.85
d1ewqa2 224 DNA repair protein MutS, the C-terminal domain {Th 96.83
d1yrba1 244 ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss 96.79
d1u0ja_267 Rep 40 protein helicase domain {Adeno-associated v 96.78
d1s96a_ 205 Guanylate kinase {Escherichia coli [TaxId: 562]} 96.77
d2i1qa2 258 DNA repair protein Rad51, catalytic domain {Archae 96.75
d1ko7a2169 HPr kinase HprK C-terminal domain {Staphylococcus 96.71
d1sq5a_ 308 Pantothenate kinase PanK {Escherichia coli [TaxId: 96.7
d2bmfa2 305 Dengue virus helicase {Dengue virus type 2 [TaxId: 96.7
d1knxa2177 HPr kinase HprK C-terminal domain {Mycoplasma pneu 96.68
d1odfa_ 286 Hypothetical protein Ygr205W {Baker's yeast (Sacch 96.68
d1r8sa_160 ADP-ribosylation factor {Human (Homo sapiens), ARF 96.67
d1l2ta_ 230 MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 96.66
d1uf9a_ 191 Dephospho-CoA kinase {Thermus thermophilus [TaxId: 96.65
d2awna2 232 Maltose transport protein MalK, N-terminal domain 96.63
d2vp4a1 197 Deoxyribonucleoside kinase {Fruit fly (Drosophila 96.62
d1sgwa_200 Putative ABC transporter PF0895 {Pyrococcus furios 96.58
d2p67a1 327 LAO/AO transport system kinase ArgK {Escherichia c 96.51
d1jjva_ 205 Dephospho-CoA kinase {Haemophilus influenzae [TaxI 96.49
d1v43a3 239 Hypothetical protein PH0022, N-terminal domain {Py 96.49
d1nlfa_ 274 Hexameric replicative helicase repA {Escherichia c 96.48
d1g2912 240 Maltose transport protein MalK, N-terminal domain 96.47
d3d31a2 229 Sulfate/molybdate ABC transporter, ATP-binding pro 96.45
d3b60a1 253 Multidrug resistance ABC transporter MsbA, C-termi 96.44
d1wf3a1178 GTPase Era, N-terminal domain {Thermus thermophilu 96.44
d3dhwc1 240 Methionine import ATP-binding protein MetN {Escher 96.43
d1nn5a_ 209 Thymidylate kinase {Human (Homo sapiens) [TaxId: 9 96.42
d1gsia_ 208 Thymidylate kinase {Mycobacterium tuberculosis [Ta 96.41
d2gj8a1161 Probable tRNA modification GTPase TrmE (MnmE), G d 96.41
d1jj7a_ 251 Peptide transporter Tap1, C-terminal ABC domain {H 96.36
d2pmka1 241 Haemolysin B ATP-binding protein {Escherichia coli 96.35
d1mv5a_ 242 Multidrug resistance ABC transporter LmrA, C-termi 96.34
d2qtvb1166 SAR1 {Baker's yeast (Saccharomyces cerevisiae) [Ta 96.34
d1oxxk2 242 Glucose transport protein GlcV, N-terminal domain 96.33
d2onka1 240 Molybdate/tungstate import ATP-binding protein Wtp 96.33
d1upta_169 ADP-ribosylation factor {Human (Homo sapiens), ARL 96.32
d1r0wa_ 281 Cystic fibrosis transmembrane conductance regulato 96.32
d2fh5b1 207 Signal recognition particle receptor beta-subunit 96.23
d1vhta_ 208 Dephospho-CoA kinase {Escherichia coli [TaxId: 562 96.23
d1f6ba_186 SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 96.22
d1uaaa1 306 DEXX box DNA helicase {Escherichia coli, RepD [Tax 96.21
d1a7ja_ 288 Phosphoribulokinase {Rhodobacter sphaeroides [TaxI 96.2
d1b0ua_ 258 ATP-binding subunit of the histidine permease {Sal 96.13
d1ksha_165 ADP-ribosylation factor {Mouse (Mus musculus), ARL 96.11
d2ocpa1 241 Deoxyguanosine kinase {Human (Homo sapiens) [TaxId 96.1
d2a5ja1173 Rab2b {Human (Homo sapiens) [TaxId: 9606]} 96.09
d1nrjb_ 209 Signal recognition particle receptor beta-subunit 96.05
d2qm8a1 323 Metallochaperone MeaB {Methylobacterium extorquens 96.05
d1z2aa1164 Rab23 {Mouse (Mus musculus) [TaxId: 10090]} 96.0
d1pjra1 318 DEXX box DNA helicase {Bacillus stearothermophilus 96.0
d1z0fa1166 Rab14 {Human (Homo sapiens) [TaxId: 9606]} 95.99
d1kaoa_167 Rap2a {Human (Homo sapiens) [TaxId: 9606]} 95.97
d1zd9a1164 ADP-ribosylation factor {Human (Homo sapiens), ARL 95.94
d4tmka_ 210 Thymidylate kinase {Escherichia coli [TaxId: 562]} 95.93
d1tmka_ 214 Thymidylate kinase {Baker's yeast (Saccharomyces c 95.92
d1zj6a1177 ADP-ribosylation factor {Human (Homo sapiens), ARL 95.92
d3raba_169 Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} 95.91
d1deka_ 241 Deoxynucleoside monophosphate kinase {Bacteriophag 95.89
d2hyda1 255 Putative multidrug export ATP-binding/permease pro 95.88
d2ew1a1171 Rab30 {Human (Homo sapiens) [TaxId: 9606]} 95.87
d1mkya1171 Probable GTPase Der, N-terminal and middle domains 95.87
d2atva1168 Ras-like estrogen-regulated growth inhibitor, RERG 95.86
d1ihua1 296 Arsenite-translocating ATPase ArsA {Escherichia co 95.86
d2f7sa1 186 Rab27b {Human (Homo sapiens) [TaxId: 9606]} 95.84
d1z08a1167 Rab21 {Human (Homo sapiens) [TaxId: 9606]} 95.84
d2erya1171 r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 95.81
d1r2qa_170 Rab5a {Human (Homo sapiens) [TaxId: 9606]} 95.79
d2f9la1175 Rab11b {Human (Homo sapiens) [TaxId: 9606]} 95.76
d1g16a_166 Rab-related protein Sec4 {Baker's yeast (Saccharom 95.75
d1e9ra_ 433 Bacterial conjugative coupling protein TrwB {Esche 95.75
d1ji0a_ 240 Branched chain aminoacid ABC transporter {Thermoto 95.74
g1f2t.1 292 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 95.71
d1z06a1165 Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} 95.71
d2erxa1171 di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 95.7
d1ky3a_175 Rab-related protein ypt7p {Baker's yeast (Saccharo 95.69
d1ctqa_166 cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9 95.68
d1vg8a_ 184 Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} 95.67
d1vpla_ 238 Putative ABC transporter TM0544 {Thermotoga mariti 95.64
d1xtqa1167 GTP-binding protein RheB {Human (Homo sapiens) [Ta 95.63
d1p5zb_ 241 Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 95.63
d2fn4a1173 r-Ras {Human (Homo sapiens) [TaxId: 9606]} 95.63
d1byia_ 224 Dethiobiotin synthetase {Escherichia coli [TaxId: 95.62
d1h65a_ 257 Chloroplast protein translocon GTPase Toc34 {Garde 95.56
d1z0ja1167 Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} 95.55
d1fzqa_176 ADP-ribosylation factor {Mouse (Mus musculus), ARL 95.51
d1yzqa1164 Rab6 {Human (Homo sapiens) [TaxId: 9606]} 95.51
d1c1ya_167 Rap1A {Human (Homo sapiens) [TaxId: 9606]} 95.5
d2cxxa1 184 GTP-binding protein engB {Pyrococcus horikoshii [T 95.49
d1kmqa_177 RhoA {Human (Homo sapiens) [TaxId: 9606]} 95.49
d1t5la1 413 Nucleotide excision repair enzyme UvrB {Bacillus c 95.47
d2bmea1174 Rab4a {Human (Homo sapiens) [TaxId: 9606]} 95.47
d2gjsa1168 Rad {Human (Homo sapiens) [TaxId: 9606]} 95.46
d1l7vc_ 231 ABC transporter involved in vitamin B12 uptake, Bt 95.46
d2g6ba1170 Rab26 {Human (Homo sapiens) [TaxId: 9606]} 95.46
d1wmsa_174 Rab9a {Human (Homo sapiens) [TaxId: 9606]} 95.45
d1x3sa1177 Rab18 {Human (Homo sapiens) [TaxId: 9606]} 95.45
d1g6ha_ 254 MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 95.44
d1u8za_168 Ras-related protein RalA {Cotton-top tamarin (Sagu 95.44
d1ek0a_170 Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [T 95.35
d1mh1a_ 183 Rac {Human (Homo sapiens) [TaxId: 9606]} 95.35
d1x1ra1169 Ras-related protein M-Ras (XRas) {Mouse (Mus muscu 95.34
d2g3ya1172 GTP-binding protein GEM {Human (Homo sapiens) [Tax 95.31
d1svia_195 Probable GTPase EngB {Bacillus subtilis [TaxId: 14 95.31
g1xew.1 329 Smc head domain {Pyrococcus furiosus [TaxId: 2261] 95.29
d1m7ba_179 RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} 95.24
d1rifa_282 DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665] 95.23
d1u0la2225 Probable GTPase EngC (YjeQ), C-terminal domain {Th 95.22
d1qhla_ 222 Cell division protein MukB {Escherichia coli [TaxI 95.2
g1ii8.1 369 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 95.2
d2atxa1185 RhoQ {Human (Homo sapiens) [TaxId: 9606]} 95.17
d2fu5c1173 Rab8a {Mouse (Mus musculus) [TaxId: 10090]} 95.16
d1e0sa_173 ADP-ribosylation factor {Human (Homo sapiens), ARF 95.15
d1xx6a1141 Thymidine kinase, TK1, N-terminal domain {Clostrid 95.15
d2bcgy1 194 GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisi 95.11
d1moza_182 ADP-ribosylation factor {Baker's yeast (Saccharomy 95.06
d2ngra_ 191 CDC42 {Human (Homo sapiens) [TaxId: 9606]} 94.97
d1egaa1179 GTPase Era, N-terminal domain {Escherichia coli [T 94.96
d1i2ma_170 Ran {Human (Homo sapiens) [TaxId: 9606]} 94.88
d1puia_188 Probable GTPase EngB {Escherichia coli [TaxId: 562 94.84
d1zcba2 200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 94.75
d1mkya2 186 Probable GTPase Der, N-terminal and middle domains 94.66
d1xzpa2160 TrmE GTPase domain {Thermotoga maritima [TaxId: 23 94.65
d1lnza2 185 Obg GTP-binding protein middle domain {Bacillus su 94.49
d1xbta1133 Thymidine kinase, TK1, N-terminal domain {Human (H 94.48
d1udxa2 180 Obg GTP-binding protein middle domain {Thermus the 94.42
d1w1wa_ 427 Smc head domain {Baker's yeast (Saccharomyces cere 94.4
d1ihua2 279 Arsenite-translocating ATPase ArsA {Escherichia co 94.34
d2bmja1175 Centaurin gamma 1, G domain {Human (Homo sapiens) 94.28
d1azta2 221 Transducin (alpha subunit) {Cow (Bos taurus) [TaxI 94.19
d1t9ha2231 Probable GTPase EngC (YjeQ), C-terminal domain {Ba 94.16
d1c4oa1 408 Nucleotide excision repair enzyme UvrB {Thermus th 94.1
d1e69a_ 308 Smc head domain {Thermotoga maritima [TaxId: 2336] 94.08
d1p6xa_ 333 Thymidine kinase {Equine herpesvirus type 4 [TaxId 93.99
d1xpua3 289 Transcription termination factor Rho, ATPase domai 93.99
d2bcjq2 200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 93.96
d1qdea_212 Initiation factor 4a {Baker's yeast (Saccharomyces 93.8
d1z63a1 230 Helicase of the SNF2/Rad54 hamily {Sulfolobus solf 93.7
d1goja_ 354 Kinesin {Neurospora crassa [TaxId: 5141]} 93.65
d1bg2a_ 323 Kinesin {Human (Homo sapiens) [TaxId: 9606]} 93.48
d1nija1 222 Hypothetical protein YjiA, N-terminal domain {Esch 93.45
d1t6na_207 Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo 93.43
d1g5ta_157 ATP:corrinoid adenosyltransferase CobA {Salmonella 93.37
d1tq4a_ 400 Interferon-inducible GTPase {Mouse (Mus musculus) 93.35
d1ry6a_ 330 Kinesin {Malaria parasite (Plasmodium falciparum) 93.35
d1gkub1237 Helicase-like "domain" of reverse gyrase {Archaeon 93.29
d1cp2a_ 269 Nitrogenase iron protein {Clostridium pasteurianum 93.27
d1wb1a4179 Elongation factor SelB, N-terminal domain {Methano 93.21
d1svsa1 195 Transducin (alpha subunit) {Rat (Rattus norvegicus 93.19
d1osna_ 331 Thymidine kinase {Varicella-zoster virus [TaxId: 1 93.17
d1f9va_ 342 Kinesin motor Ncd (non-claret disjunctional) {Bake 93.02
d2j0sa1222 Probable ATP-dependent RNA helicase DDX48 {Human ( 92.88
d2g9na1218 Initiation factor 4a {Human (Homo sapiens) [TaxId: 92.62
d1s2ma1206 Putative ATP-dependent RNA helicase DHH1 {Baker's 92.51
d1q0ua_209 Probable DEAD box RNA helicase YqfR {Bacillus stea 92.37
d1x88a1 345 Kinesin {Human (Homo sapiens), mitotic kinesin eg5 92.34
d1e2ka_ 329 Thymidine kinase {Herpes simplex virus type 1, dif 92.33
d1sdma_ 364 Kinesin heavy chain-like protein {Potato (Solanum 92.05
d1v8ka_ 362 Kinesin {Mouse (Mus musculus), kif2c [TaxId: 10090 92.02
d1g8fa3122 ATP sulfurylase C-terminal domain {Baker's yeast ( 91.99
d2bv3a2 276 Elongation factor G (EF-G), N-terminal (G) domain 91.9
d2afhe1 289 Nitrogenase iron protein {Azotobacter vinelandii [ 91.88
d1veca_206 DEAD box RNA helicase rck/p54 {Human (Homo sapiens 91.83
d2dy1a2 267 Elongation factor G (EF-G), N-terminal (G) domain 91.73
d1lkxa_ 684 Myosin S1, motor domain {Dictyostelium discoideum, 91.68
d1z3ix2 298 Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxI 91.53
d1j3ba1 318 Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxalo 91.52
d1d0xa2 712 Myosin S1, motor domain {Dictyostelium discoideum 91.52
d1hyqa_ 232 Cell division regulator MinD {Archaeon Archaeoglob 91.46
d2jdid3 276 Central domain of beta subunit of F1 ATP synthase 91.46
d2ncda_ 368 Kinesin motor Ncd (non-claret disjunctional) {Frui 91.41
d2olra1 313 Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxalo 91.31
d2mysa2 794 Myosin S1, motor domain {Chicken (Gallus gallus), 91.03
d1hv8a1208 Putative DEAD box RNA helicase {Archaeon Methanoco 91.01
d1br2a2 710 Myosin S1, motor domain {Chicken (Gallus gallus), 91.01
d1g3qa_ 237 Cell division regulator MinD {Archaeon Pyrococcus 90.86
d1oywa2206 RecQ helicase domain {Escherichia coli [TaxId: 562 90.76
d1kk8a2 789 Myosin S1, motor domain {Bay scallop (Aequipecten 90.62
d1ii2a1 323 Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxalo 90.53
d1w7ja2 730 Myosin S1, motor domain {Chicken (Gallus gallus), 90.38
g1qhh.1 623 DEXX box DNA helicase {Bacillus stearothermophilus 89.75
d2zfia1 349 Kinesin {Mouse (Mus musculus), kif1a [TaxId: 10090 89.15
d1c9ka_ 180 Adenosylcobinamide kinase/adenosylcobinamide phosp 89.01
d2c78a3 204 Elongation factor Tu (EF-Tu), N-terminal (G) domai 88.9
d2jdia3 285 Central domain of alpha subunit of F1 ATP synthase 88.5
d1g7sa4 227 Initiation factor IF2/eIF5b, N-terminal (G) domain 88.21
d1n0ua2 341 Elongation factor 2 (eEF-2), N-terminal (G) domain 87.45
d1fx0a3 276 Central domain of alpha subunit of F1 ATP synthase 85.71
d1w36b1 485 Exodeoxyribonuclease V beta chain (RecB), N-termin 85.03
d1wrba1 238 putative ATP-dependent RNA helicase VlgB {Flatworm 82.64
d1jnya3 224 Elongation factor eEF-1alpha, N-terminal (G) domai 82.45
d1zunb3 222 Sulfate adenylate transferase subunit cysN/C, EF-T 81.25
d1d2ea3 196 Elongation factor Tu (EF-Tu), N-terminal (G) domai 80.75
d2akab1 299 Dynamin G domain {Rat (Rattus norvegicus) [TaxId: 80.45
d2qn6a3 205 Initiation factor eIF2 gamma subunit, N-terminal ( 80.09
>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: AAA domain of cell division protein FtsH
species: Thermus thermophilus [TaxId: 274]
Probab=99.94  E-value=1.2e-26  Score=180.76  Aligned_cols=116  Identities=40%  Similarity=0.764  Sum_probs=107.1

Q ss_pred             cCCCCcccccCcHHHHHHHHHHHHhcccChhhHhhhCCCCCCceEEECCCCCcHHHHHHHHHHHhCCeEEEEechhhhhh
Q psy6208          80 SNAVGYDDIGGCRKQLAQIKEMVELPLRHPSLFKAIGVKPPRGILLYGPPGTGKTLIARAVANETGAFFFLINGPEIMSK  159 (197)
Q Consensus        80 ~~~~~~~~i~g~~~~~~~l~~~v~~~~~~~~~~~~~~~~~~~~ill~G~~GtGKT~la~ala~~~~~~~~~v~~~~~~~~  159 (197)
                      .|.++|+||+|+++++++|.+.+.. +..++.+..+|...++++||+||||||||++|+++|++++.+++.++++++.+.
T Consensus         3 ~p~~~~~di~G~~~~k~~l~~~i~~-l~~~~~~~~~g~~~~~giLl~GppGtGKT~la~aia~~~~~~~~~i~~~~l~~~   81 (247)
T d1ixza_           3 APKVTFKDVAGAEEAKEELKEIVEF-LKNPSRFHEMGARIPKGVLLVGPPGVGKTHLARAVAGEARVPFITASGSDFVEM   81 (247)
T ss_dssp             CCSCCGGGCCSCHHHHHHHHHHHHH-HHCHHHHHHTTCCCCSEEEEECCTTSSHHHHHHHHHHHTTCCEEEEEHHHHHHS
T ss_pred             CCCCcHHHHccHHHHHHHHHHHHHH-HHCHHHHHHcCCCCCceEEEecCCCCChhHHHHHHHHHcCCCEEEEEhHHhhhc
Confidence            4679999999999999999887765 888899999999999999999999999999999999999999999999999999


Q ss_pred             ccCccHHHHHHHHHHHhcCCCeEEEEcccCccCcccC
Q psy6208         160 LAGESESNLRKAFEEADKNSPSIIFIDELDAIAPKRE  196 (197)
Q Consensus       160 ~~~~~~~~~~~~~~~a~~~~~~vl~lDeid~l~~~r~  196 (197)
                      ++|+.+..++.+|+.+...+|+||||||+|.|+++|.
T Consensus        82 ~~g~~~~~l~~~f~~a~~~~p~Ii~iDeid~l~~~r~  118 (247)
T d1ixza_          82 FVGVGAARVRDLFETAKRHAPCIVFIDEIDAVGRKRG  118 (247)
T ss_dssp             CTTHHHHHHHHHHHHHTTSSSEEEEEETHHHHHC---
T ss_pred             cccHHHHHHHHHHHHHHHcCCEEEEEEChhhhCccCC
Confidence            9999999999999999999999999999999987763



>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} Back     information, alignment and structure
>d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1r6bx3 c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1um8a_ c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1qvra2 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1qvra3 c.37.1.20 (A:536-850) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} Back     information, alignment and structure
>d1g8pa_ c.37.1.20 (A:) ATPase subunit of magnesium chelatase, BchI {Rhodobacter capsulatus [TaxId: 1061]} Back     information, alignment and structure
>d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1ny5a2 c.37.1.20 (A:138-384) Transcriptional activator sigm54 (NtrC1), C-terminal domain {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1e32a3 d.31.1.1 (A:107-200) Membrane fusion atpase p97 domain 2, P97-Nc {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2gnoa2 c.37.1.20 (A:11-208) gamma subunit of DNA polymerase III, N-domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} Back     information, alignment and structure
>d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} Back     information, alignment and structure
>d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} Back     information, alignment and structure
>d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1u94a1 c.37.1.11 (A:6-268) RecA protein, ATPase-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1xp8a1 c.37.1.11 (A:15-282) RecA protein, ATPase-domain {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} Back     information, alignment and structure
>d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1mo6a1 c.37.1.11 (A:1-269) RecA protein, ATPase-domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} Back     information, alignment and structure
>d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} Back     information, alignment and structure
>d1q3ta_ c.37.1.1 (A:) CMP kinase {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1tf7a1 c.37.1.11 (A:14-255) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1m7ga_ c.37.1.4 (A:) Adenosine-5'phosphosulfate kinase (APS kinase) {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1yksa1 c.37.1.14 (A:185-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Back     information, alignment and structure
>d2fz4a1 c.37.1.19 (A:24-229) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Back     information, alignment and structure
>d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]} Back     information, alignment and structure
>d1tuea_ c.37.1.20 (A:) Replication protein E1 helicase domain {Human papillomavirus type 18 [TaxId: 333761]} Back     information, alignment and structure
>d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pzna2 c.37.1.11 (A:96-349) DNA repair protein Rad51, catalytic domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1gm5a3 c.37.1.19 (A:286-549) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1wb9a2 c.37.1.12 (A:567-800) DNA repair protein MutS, the C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1v5wa_ c.37.1.11 (A:) Meiotic recombination protein DMC1/LIM15 homolog {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1htwa_ c.37.1.18 (A:) Hypothetical protein HI0065 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1cz5a2 d.31.1.1 (A:92-185) C-terminal domain of VAT-N, VAT-Nc {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1kgda_ c.37.1.1 (A:) Guanylate kinase-like domain of Cask {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wp9a1 c.37.1.19 (A:1-200) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2eyqa3 c.37.1.19 (A:546-778) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1kkma_ c.91.1.2 (A:) HPr kinase HprK C-terminal domain {Lactobacillus casei [TaxId: 1582]} Back     information, alignment and structure
>d2b8ta1 c.37.1.24 (A:11-149) Thymidine kinase, TK1, N-terminal domain {Ureaplasma urealyticum [TaxId: 2130]} Back     information, alignment and structure
>d1ewqa2 c.37.1.12 (A:542-765) DNA repair protein MutS, the C-terminal domain {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1u0ja_ c.37.1.20 (A:) Rep 40 protein helicase domain {Adeno-associated virus 2, AAV2 [TaxId: 10804]} Back     information, alignment and structure
>d1s96a_ c.37.1.1 (A:) Guanylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2i1qa2 c.37.1.11 (A:65-322) DNA repair protein Rad51, catalytic domain {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1ko7a2 c.91.1.2 (A:130-298) HPr kinase HprK C-terminal domain {Staphylococcus xylosus [TaxId: 1288]} Back     information, alignment and structure
>d1sq5a_ c.37.1.6 (A:) Pantothenate kinase PanK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} Back     information, alignment and structure
>d1knxa2 c.91.1.2 (A:133-309) HPr kinase HprK C-terminal domain {Mycoplasma pneumoniae [TaxId: 2104]} Back     information, alignment and structure
>d1odfa_ c.37.1.6 (A:) Hypothetical protein Ygr205W {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} Back     information, alignment and structure
>d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1uf9a_ c.37.1.1 (A:) Dephospho-CoA kinase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2vp4a1 c.37.1.1 (A:12-208) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jjva_ c.37.1.1 (A:) Dephospho-CoA kinase {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1nlfa_ c.37.1.11 (A:) Hexameric replicative helicase repA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} Back     information, alignment and structure
>d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} Back     information, alignment and structure
>d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1wf3a1 c.37.1.8 (A:3-180) GTPase Era, N-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nn5a_ c.37.1.1 (A:) Thymidylate kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gsia_ c.37.1.1 (A:) Thymidylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2gj8a1 c.37.1.8 (A:216-376) Probable tRNA modification GTPase TrmE (MnmE), G domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d2qtvb1 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1upta_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]} Back     information, alignment and structure
>d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2fh5b1 c.37.1.8 (B:63-269) Signal recognition particle receptor beta-subunit {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1vhta_ c.37.1.1 (A:) Dephospho-CoA kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1f6ba_ c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1uaaa1 c.37.1.19 (A:2-307) DEXX box DNA helicase {Escherichia coli, RepD [TaxId: 562]} Back     information, alignment and structure
>d1a7ja_ c.37.1.6 (A:) Phosphoribulokinase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1ksha_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]} Back     information, alignment and structure
>d2ocpa1 c.37.1.1 (A:37-277) Deoxyguanosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2a5ja1 c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nrjb_ c.37.1.8 (B:) Signal recognition particle receptor beta-subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2qm8a1 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1z2aa1 c.37.1.8 (A:8-171) Rab23 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1pjra1 c.37.1.19 (A:1-318) DEXX box DNA helicase {Bacillus stearothermophilus, PcrA [TaxId: 1422]} Back     information, alignment and structure
>d1z0fa1 c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kaoa_ c.37.1.8 (A:) Rap2a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zd9a1 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human (Homo sapiens), ARL8A [TaxId: 9606]} Back     information, alignment and structure
>d4tmka_ c.37.1.1 (A:) Thymidylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1tmka_ c.37.1.1 (A:) Thymidylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1zj6a1 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human (Homo sapiens), ARL5A [TaxId: 9606]} Back     information, alignment and structure
>d3raba_ c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1deka_ c.37.1.1 (A:) Deoxynucleoside monophosphate kinase {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d2ew1a1 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mkya1 c.37.1.8 (A:2-172) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2atva1 c.37.1.8 (A:5-172) Ras-like estrogen-regulated growth inhibitor, RERG {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ihua1 c.37.1.10 (A:1-296) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2f7sa1 c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z08a1 c.37.1.8 (A:17-183) Rab21 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2erya1 c.37.1.8 (A:10-180) r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r2qa_ c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f9la1 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g16a_ c.37.1.8 (A:) Rab-related protein Sec4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1e9ra_ c.37.1.11 (A:) Bacterial conjugative coupling protein TrwB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} Back     information, alignment and structure
>d1z06a1 c.37.1.8 (A:32-196) Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2erxa1 c.37.1.8 (A:6-176) di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ky3a_ c.37.1.8 (A:) Rab-related protein ypt7p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ctqa_ c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vg8a_ c.37.1.8 (A:) Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1xtqa1 c.37.1.8 (A:3-169) GTP-binding protein RheB {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p5zb_ c.37.1.1 (B:) Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fn4a1 c.37.1.8 (A:24-196) r-Ras {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1byia_ c.37.1.10 (A:) Dethiobiotin synthetase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1h65a_ c.37.1.8 (A:) Chloroplast protein translocon GTPase Toc34 {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1z0ja1 c.37.1.8 (A:2-168) Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fzqa_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL3 [TaxId: 10090]} Back     information, alignment and structure
>d1yzqa1 c.37.1.8 (A:14-177) Rab6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1c1ya_ c.37.1.8 (A:) Rap1A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cxxa1 c.37.1.8 (A:2-185) GTP-binding protein engB {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1kmqa_ c.37.1.8 (A:) RhoA {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t5la1 c.37.1.19 (A:2-414) Nucleotide excision repair enzyme UvrB {Bacillus caldotenax [TaxId: 1395]} Back     information, alignment and structure
>d2bmea1 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gjsa1 c.37.1.8 (A:91-258) Rad {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2g6ba1 c.37.1.8 (A:58-227) Rab26 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wmsa_ c.37.1.8 (A:) Rab9a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x3sa1 c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1u8za_ c.37.1.8 (A:) Ras-related protein RalA {Cotton-top tamarin (Saguinus oedipus) [TaxId: 9490]} Back     information, alignment and structure
>d1ek0a_ c.37.1.8 (A:) Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1mh1a_ c.37.1.8 (A:) Rac {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x1ra1 c.37.1.8 (A:10-178) Ras-related protein M-Ras (XRas) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2g3ya1 c.37.1.8 (A:73-244) GTP-binding protein GEM {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1svia_ c.37.1.8 (A:) Probable GTPase EngB {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1m7ba_ c.37.1.8 (A:) RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1rifa_ c.37.1.23 (A:) DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1u0la2 c.37.1.8 (A:69-293) Probable GTPase EngC (YjeQ), C-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1qhla_ c.37.1.12 (A:) Cell division protein MukB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2atxa1 c.37.1.8 (A:9-193) RhoQ {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fu5c1 c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1e0sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF6 [TaxId: 9606]} Back     information, alignment and structure
>d1xx6a1 c.37.1.24 (A:2-142) Thymidine kinase, TK1, N-terminal domain {Clostridium acetobutylicum [TaxId: 1488]} Back     information, alignment and structure
>d2bcgy1 c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1moza_ c.37.1.8 (A:) ADP-ribosylation factor {Baker's yeast (Saccharomyces cerevisiae), ARL1 [TaxId: 4932]} Back     information, alignment and structure
>d2ngra_ c.37.1.8 (A:) CDC42 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1egaa1 c.37.1.8 (A:4-182) GTPase Era, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1i2ma_ c.37.1.8 (A:) Ran {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1puia_ c.37.1.8 (A:) Probable GTPase EngB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zcba2 c.37.1.8 (A:47-75,A:202-372) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1mkya2 c.37.1.8 (A:173-358) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1xzpa2 c.37.1.8 (A:212-371) TrmE GTPase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1lnza2 c.37.1.8 (A:158-342) Obg GTP-binding protein middle domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1xbta1 c.37.1.24 (A:18-150) Thymidine kinase, TK1, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1udxa2 c.37.1.8 (A:157-336) Obg GTP-binding protein middle domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1w1wa_ c.37.1.12 (A:) Smc head domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ihua2 c.37.1.10 (A:308-586) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bmja1 c.37.1.8 (A:66-240) Centaurin gamma 1, G domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1azta2 c.37.1.8 (A:35-65,A:202-391) Transducin (alpha subunit) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1t9ha2 c.37.1.8 (A:68-298) Probable GTPase EngC (YjeQ), C-terminal domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1c4oa1 c.37.1.19 (A:2-409) Nucleotide excision repair enzyme UvrB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1e69a_ c.37.1.12 (A:) Smc head domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1p6xa_ c.37.1.1 (A:) Thymidine kinase {Equine herpesvirus type 4 [TaxId: 10331]} Back     information, alignment and structure
>d1xpua3 c.37.1.11 (A:129-417) Transcription termination factor Rho, ATPase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bcjq2 c.37.1.8 (Q:38-66,Q:184-354) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1qdea_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1z63a1 c.37.1.19 (A:432-661) Helicase of the SNF2/Rad54 hamily {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1goja_ c.37.1.9 (A:) Kinesin {Neurospora crassa [TaxId: 5141]} Back     information, alignment and structure
>d1bg2a_ c.37.1.9 (A:) Kinesin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nija1 c.37.1.10 (A:2-223) Hypothetical protein YjiA, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1t6na_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g5ta_ c.37.1.11 (A:) ATP:corrinoid adenosyltransferase CobA {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1tq4a_ c.37.1.8 (A:) Interferon-inducible GTPase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ry6a_ c.37.1.9 (A:) Kinesin {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1gkub1 c.37.1.16 (B:1-250) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1cp2a_ c.37.1.10 (A:) Nitrogenase iron protein {Clostridium pasteurianum [TaxId: 1501]} Back     information, alignment and structure
>d1wb1a4 c.37.1.8 (A:1-179) Elongation factor SelB, N-terminal domain {Methanococcus maripaludis [TaxId: 39152]} Back     information, alignment and structure
>d1svsa1 c.37.1.8 (A:32-60,A:182-347) Transducin (alpha subunit) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1osna_ c.37.1.1 (A:) Thymidine kinase {Varicella-zoster virus [TaxId: 10335]} Back     information, alignment and structure
>d1f9va_ c.37.1.9 (A:) Kinesin motor Ncd (non-claret disjunctional) {Baker's yeast (Saccharomyces cerevisiae), Kar [TaxId: 4932]} Back     information, alignment and structure
>d2j0sa1 c.37.1.19 (A:22-243) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2g9na1 c.37.1.19 (A:21-238) Initiation factor 4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s2ma1 c.37.1.19 (A:46-251) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1q0ua_ c.37.1.19 (A:) Probable DEAD box RNA helicase YqfR {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1x88a1 c.37.1.9 (A:18-362) Kinesin {Human (Homo sapiens), mitotic kinesin eg5 [TaxId: 9606]} Back     information, alignment and structure
>d1e2ka_ c.37.1.1 (A:) Thymidine kinase {Herpes simplex virus type 1, different strains [TaxId: 10298]} Back     information, alignment and structure
>d1sdma_ c.37.1.9 (A:) Kinesin heavy chain-like protein {Potato (Solanum tuberosum) [TaxId: 4113]} Back     information, alignment and structure
>d1v8ka_ c.37.1.9 (A:) Kinesin {Mouse (Mus musculus), kif2c [TaxId: 10090]} Back     information, alignment and structure
>d1g8fa3 c.37.1.15 (A:390-511) ATP sulfurylase C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2bv3a2 c.37.1.8 (A:7-282) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2afhe1 c.37.1.10 (E:1-289) Nitrogenase iron protein {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1veca_ c.37.1.19 (A:) DEAD box RNA helicase rck/p54 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dy1a2 c.37.1.8 (A:8-274) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus, EF-G-2 [TaxId: 274]} Back     information, alignment and structure
>d1lkxa_ c.37.1.9 (A:) Myosin S1, motor domain {Dictyostelium discoideum, class-I myosin MyoE [TaxId: 44689]} Back     information, alignment and structure
>d1z3ix2 c.37.1.19 (X:92-389) Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxId: 7955]} Back     information, alignment and structure
>d1j3ba1 c.91.1.1 (A:212-529) Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxaloacetate carboxy-lyase) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1d0xa2 c.37.1.9 (A:2-33,A:80-759) Myosin S1, motor domain {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1hyqa_ c.37.1.10 (A:) Cell division regulator MinD {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2jdid3 c.37.1.11 (D:82-357) Central domain of beta subunit of F1 ATP synthase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2ncda_ c.37.1.9 (A:) Kinesin motor Ncd (non-claret disjunctional) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2olra1 c.91.1.1 (A:228-540) Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxaloacetate carboxy-lyase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2mysa2 c.37.1.9 (A:4-33,A:80-843) Myosin S1, motor domain {Chicken (Gallus gallus), pectoral muscle [TaxId: 9031]} Back     information, alignment and structure
>d1hv8a1 c.37.1.19 (A:3-210) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1br2a2 c.37.1.9 (A:80-789) Myosin S1, motor domain {Chicken (Gallus gallus), pectoral muscle [TaxId: 9031]} Back     information, alignment and structure
>d1g3qa_ c.37.1.10 (A:) Cell division regulator MinD {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1oywa2 c.37.1.19 (A:1-206) RecQ helicase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kk8a2 c.37.1.9 (A:1-28,A:77-837) Myosin S1, motor domain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} Back     information, alignment and structure
>d1ii2a1 c.91.1.1 (A:201-523) Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxaloacetate carboxy-lyase) {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1w7ja2 c.37.1.9 (A:63-792) Myosin S1, motor domain {Chicken (Gallus gallus), Va isoform [TaxId: 9031]} Back     information, alignment and structure
>d2zfia1 c.37.1.9 (A:4-352) Kinesin {Mouse (Mus musculus), kif1a [TaxId: 10090]} Back     information, alignment and structure
>d1c9ka_ c.37.1.11 (A:) Adenosylcobinamide kinase/adenosylcobinamide phosphate guanylyltransferase CobU {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2c78a3 c.37.1.8 (A:9-212) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2jdia3 c.37.1.11 (A:95-379) Central domain of alpha subunit of F1 ATP synthase {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1g7sa4 c.37.1.8 (A:1-227) Initiation factor IF2/eIF5b, N-terminal (G) domain {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1n0ua2 c.37.1.8 (A:3-343) Elongation factor 2 (eEF-2), N-terminal (G) domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1fx0a3 c.37.1.11 (A:97-372) Central domain of alpha subunit of F1 ATP synthase {Spinach (Spinacia oleracea), chloroplast [TaxId: 3562]} Back     information, alignment and structure
>d1w36b1 c.37.1.19 (B:1-485) Exodeoxyribonuclease V beta chain (RecB), N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wrba1 c.37.1.19 (A:164-401) putative ATP-dependent RNA helicase VlgB {Flatworm (Dugesia japonica) [TaxId: 6161]} Back     information, alignment and structure
>d1jnya3 c.37.1.8 (A:4-227) Elongation factor eEF-1alpha, N-terminal (G) domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1zunb3 c.37.1.8 (B:16-237) Sulfate adenylate transferase subunit cysN/C, EF-Tu domain G-like domain {Pseudomonas syringae pv. tomato [TaxId: 323]} Back     information, alignment and structure
>d1d2ea3 c.37.1.8 (A:55-250) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Cow (Bos taurus), mitochondrial [TaxId: 9913]} Back     information, alignment and structure
>d2akab1 c.37.1.8 (B:6-304) Dynamin G domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2qn6a3 c.37.1.8 (A:2-206) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure