Diaphorina citri psyllid: psy6232

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100
MCGLRNDDPCFFQNSIPDYLFFVSPSIYFLDDFILKQHAWVWLLWLLSQTWITLHIWTPKCERLATTEKLFVRPMYDALLIDQSMSLNRRCDDEKDVKTE
cccccccccccccccccccEEEEcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccHHHHHHHHHHHccccccccccccc
**GLR*DDPCFFQNSIPDYLFFVSPSIYFLDDFILKQHAWVWLLWLLSQTWITLHIWTPKCERLATTEKLFVRPMYDALLIDQSMSLNRRC*********
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MCGLRNDDPCFFQNSIPDYLFFVSPSIYFLDDFILKQHAWVWLLWLLSQTWITLHIWTPKCERLATTEKLFVRPMYDALLIDQSMSLNRRCDDEKDVKTE

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfer were detected in SWISS-PROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0009611 [BP]response to woundingprobableGO:0006950, GO:0008150, GO:0050896
GO:0008362 [BP]chitin-based embryonic cuticle biosynthetic processprobableGO:0032502, GO:0040003, GO:0042335, GO:0044707, GO:0048856, GO:0044767, GO:0032501, GO:0008150, GO:0007275, GO:0044699
GO:0007443 [BP]Malpighian tubule morphogenesisprobableGO:0032502, GO:0061326, GO:0048619, GO:0055123, GO:0009790, GO:0048565, GO:0009653, GO:0007275, GO:0044699, GO:0002009, GO:0048513, GO:0048729, GO:0060562, GO:0048598, GO:0061333, GO:0032501, GO:0035239, GO:0060429, GO:0009888, GO:0044767, GO:0061525, GO:0008150, GO:0001655, GO:0072002, GO:0072001, GO:0007442, GO:0044707, GO:0048856, GO:0035295, GO:0048731, GO:0048546
GO:0007430 [BP]terminal branching, open tracheal systemprobableGO:0032502, GO:0048754, GO:0001763, GO:0009653, GO:0007275, GO:0044699, GO:0002009, GO:0048729, GO:0060562, GO:0060541, GO:0032501, GO:0035239, GO:0060446, GO:0061138, GO:0060429, GO:0009888, GO:0044767, GO:0008150, GO:0035295, GO:0007424, GO:0044707, GO:0048856, GO:0048731
GO:0035158 [BP]regulation of tube diameter, open tracheal systemprobableGO:0035150, GO:0035151, GO:0035152, GO:0032501, GO:0044707, GO:0007424, GO:0060541, GO:0048856, GO:0090066, GO:0008150, GO:0065007, GO:0048731, GO:0035296, GO:0065008, GO:0032502, GO:0007275, GO:0044699
GO:0035159 [BP]regulation of tube length, open tracheal systemprobableGO:0035150, GO:0035151, GO:0035152, GO:0032501, GO:0044707, GO:0007424, GO:0060541, GO:0048856, GO:0090066, GO:0032502, GO:0065007, GO:0048731, GO:0008150, GO:0065008, GO:0007275, GO:0044699
GO:0006035 [BP]cuticle chitin biosynthetic processprobableGO:0046349, GO:0006807, GO:0007275, GO:0044699, GO:0040003, GO:0044710, GO:0042335, GO:0071704, GO:0006031, GO:0006030, GO:0006034, GO:0032502, GO:0032501, GO:1901576, GO:0044767, GO:0009058, GO:0009059, GO:0008150, GO:0008152, GO:0006023, GO:1901564, GO:1901566, GO:0044707, GO:1901137, GO:1901135, GO:0048856, GO:0043170, GO:0006040, GO:0006022, GO:1901073, GO:1901071
GO:0001838 [BP]embryonic epithelial tube formationprobableGO:0032502, GO:0016331, GO:0035148, GO:0009790, GO:0072175, GO:0009653, GO:0007275, GO:0044699, GO:0002009, GO:0048729, GO:0060562, GO:0048646, GO:0048598, GO:0032501, GO:0035239, GO:0060429, GO:0009888, GO:0044767, GO:0008150, GO:0035295, GO:0044707, GO:0048856
GO:0060439 [BP]trachea morphogenesisprobableGO:0060541, GO:0032502, GO:0009887, GO:0032501, GO:0044707, GO:0060438, GO:0048856, GO:0044767, GO:0048513, GO:0008150, GO:0048731, GO:0009653, GO:0007275, GO:0044699

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

No confident structure templates for the query are predicted