Diaphorina citri psyllid: psy6241


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-
MLKPMLKPKVLSQVLGQANTEGVQSTMLMSYEGTLLAYSGHKDNDGTVIAAITSNIWSAFEKNGRSAFKEDSLQMVLMECSVSFLSDILALEGPQESPLLSNGLFSKRLMSYEGTLLAYSGHKDNDGTVIAAITSNIWSAFEKNGRSAFKEDSLQMVLMECSNGKVAITQVANVLLCLYAKENVCFGMLRAKAEALATYLEAPLKQVVNTS
ccccccccHHHHHHHHHHcccccEEEEEEcccccEEEEEccccccHHHHHHHHHHHHHHHHHcccccccccccEEEEEEccccHHHHEEEEcccccccccccccCEEEEEcccccEEEECcccccccHHHHHHHHHHHHHHHHcccccccccccEEEEEEEcccEEEEEEEccEEEEEEEccccccccHHHHHHHHHHHHHHHHHHHcccc
*******PKVLSQVLGQANTEGVQSTMLMSYEGTLLAYSGHKDNDGTVIAAITSNIWSAFEKNGRSAFKEDSLQMVLMECSVSFLSDILALEGPQESPLLSNGLFSKRLMSYEGTLLAYSGHKDNDGTVIAAITSNIWSAFEKNGRSAFKEDSLQMVLMECSNGKVAITQVANVLLCLYAKENVCFGMLRAKAEALATYLEAPLK******
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLKPMLKPKVLSQVLGQANTEGVQSTMLMSYEGTLLAYSGHKDNDGTVIAAITSNIWSAFEKNGRSAFKEDSLQMVLMECSVSFLSDILALEGPQESPLLSNGLFSKRLMSYEGTLLAYSGHKDNDGTVIAAITSNIWSAFEKNGRSAFKEDSLQMVLMECSNGKVAITQVANVLLCLYAKENVCFGMLRAKAEALATYLEAPLKQVVNTS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Ragulator complex protein LAMTOR2 Regulator of the TOR pathway, a signaling cascade that promotes cell growth in response to growth factors, energy levels, and amino acids. As part of the Ragulator complex, recruits the Rag GTPases and the mTORC1 complex to lysosomes, a key step in activation of the TOR signaling cascade by amino acids. Adapter protein that enhances the efficiency of the MAP kinase cascade facilitating the activation of MAPK2.confidentQ3T132
Ragulator complex protein LAMTOR2 Regulator of the TOR pathway, a signaling cascade that promotes cell growth in response to growth factors, energy levels, and amino acids. As part of the Ragulator complex, may activate the TOR signaling cascade in response to amino acids. Adapter protein that may regulate the MAP kinase cascade.confidentB5FYY5
Ragulator complex protein LAMTOR2 homolog Regulator of the TOR pathway, a signaling cascade that promotes cell growth in response to growth factors, energy levels, and amino acids. As part of the Ragulator complex, may activate the TOR signaling cascade in response to amino acids.confidentQ9V8I2

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0071986 [CC]Ragulator complexprobableGO:0005770, GO:0043229, GO:0043227, GO:0043226, GO:0010008, GO:0005737, GO:0044446, GO:0031090, GO:0016020, GO:0031902, GO:0043234, GO:0032991, GO:0043231, GO:0045121, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044440, GO:0044424, GO:0044425, GO:0005768, GO:0044422
GO:0005085 [MF]guanyl-nucleotide exchange factor activityprobableGO:0030695, GO:0030234, GO:0060589, GO:0003674
GO:0032947 [MF]protein complex scaffoldprobableGO:0003674, GO:0005488, GO:0005515, GO:0005198
GO:0000186 [BP]activation of MAPKK activityprobableGO:0019220, GO:0009893, GO:0019222, GO:0033674, GO:0031325, GO:0048583, GO:0032147, GO:0023051, GO:0010646, GO:0010627, GO:0050789, GO:0043085, GO:0043408, GO:0051347, GO:0010604, GO:0009966, GO:0010562, GO:0043549, GO:0051246, GO:0051247, GO:0032270, GO:0044093, GO:0031399, GO:0048518, GO:0065007, GO:0065009, GO:0050790, GO:0045937, GO:0060255, GO:0031323, GO:0045859, GO:0080090, GO:0050794, GO:0051174, GO:0032268, GO:0008150, GO:0042325, GO:0042327, GO:0045860, GO:0031401, GO:0051338, GO:0001932, GO:0001934, GO:0048522
GO:0071230 [BP]cellular response to amino acid stimulusprobableGO:1901700, GO:0043200, GO:0051716, GO:0009719, GO:1901701, GO:1901698, GO:0071417, GO:1901699, GO:0008150, GO:0044699, GO:0071229, GO:0071495, GO:0071310, GO:0044763, GO:0001101, GO:0070887, GO:0050896, GO:0042221, GO:0009987, GO:0010243, GO:0010033

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1VET, chain B
Confidence level:very confident
Coverage over the Query: 102-203
View the alignment between query and template
View the model in PyMOL
Template: 1VET, chain B
Confidence level:very confident
Coverage over the Query: 1-81
View the alignment between query and template
View the model in PyMOL