Diaphorina citri psyllid: psy6269

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360------

SWEFGWILCDIWVSLDVCLCTASILSLCAISIDRYLAVTQPLTYSRKTRSKKLALYMILCVWVLALVITCPPILGWYDKDRHRDKRCGYNQNRGYVVFSGMGSFFIPLLVVLYVYARISCVIARRHNNLEALNHQHTLGRHELAKIKLRVRFNYCKVIIIKKTHLVLPSSSIMERDRRKSLASCSFSLQRSGLRLTDKCTRVSSLKRESKTAQTLSVVVGGFIACWLPFFIVYLANPFLPAGTISPLLSNSLTWLGKLSGSLRLFGNTLIIISVLTTRRLRTVTNCFVMSLAVADWLVGIFVMPFAVALHITVPRSDFRLAFWRLTLKHCNKSRRTRAQRAHMNMLDSSCRMRKQQNNVTYNMRHT

cccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccEEEEEcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEEEccccccccHHHHHccccccccccccccccccEEccccccccccccccEEEEEEEEEcccccccHHHHHHHHHHHHHHHHHHcccEEEEEEEEcccccccccEEEEccccccccccccHHHHHHHHccHHHHHHHcccccccccccc

SWEFGWILCDIWVSLDVCLCTASILSLCAISIDRYLAVTQPLTYSRKTRSKKLALYMILCVWVLALVITCPPILGWYDKDRHRDKRCGYNQNRGYVVFSGMGSFFIPLLVVLYVYARISCVIARRHNNL*******************************************************SFSLQRSGLRLT**C************AQTLSVVVGGFIACWLPFFIVYLANPFLPAGTISPLLSNSLTWLGKLSGSLRLFGNTLIIISVLTTRRLRTVTNCFVMSLAVADWLVGIFVMPFAVALHITVPRSDFRLAFWRLTLKHCNKSRRTRAQRAHMNMLDSS*****************

xxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0004993 [MF]	serotonin receptor activity	probable	GO:0004930, GO:0038023, GO:0060089, GO:0004888, GO:0003674, GO:0004872, GO:0004871, GO:0008227
GO:0007210 [BP]	serotonin receptor signaling pathway	probable	GO:0044700, GO:0051716, GO:0008150, GO:0050896, GO:0009987, GO:0050794, GO:0023052, GO:0065007, GO:0044763, GO:0007165, GO:0007166, GO:0007154, GO:0007186, GO:0050789, GO:0044699
GO:0051378 [MF]	serotonin binding	probable	GO:0043169, GO:0097159, GO:0043167, GO:0003674, GO:0005488, GO:0043176, GO:1901363
GO:0007187 [BP]	G-protein coupled receptor signaling pathway, coupled to cyclic nucleotide second messenger	probable	GO:0044700, GO:0051716, GO:0008150, GO:0050896, GO:0009987, GO:0050794, GO:0023052, GO:0065007, GO:0044763, GO:0007165, GO:0007166, GO:0007154, GO:0007186, GO:0050789, GO:0044699
GO:0007194 [BP]	negative regulation of adenylate cyclase activity	probable	GO:0010563, GO:0031280, GO:0080090, GO:0019222, GO:0031327, GO:0051350, GO:0031324, GO:0031323, GO:0009892, GO:1900371, GO:0045980, GO:0043086, GO:0019220, GO:0009890, GO:0030818, GO:0045761, GO:0030814, GO:0030815, GO:0050789, GO:0065007, GO:0044092, GO:0048519, GO:0065009, GO:0045934, GO:0045936, GO:0019219, GO:0050790, GO:0009889, GO:0050794, GO:0031326, GO:1900542, GO:0008150, GO:0051171, GO:0051172, GO:0030799, GO:0031279, GO:0051174, GO:1900543, GO:0030802, GO:0030809, GO:0030808, GO:1900372, GO:0030800, GO:0030803, GO:0051339, GO:0030817, GO:0006140, GO:0048523
GO:0008226 [MF]	tyramine receptor activity	probable	GO:0004930, GO:0038023, GO:0060089, GO:0004888, GO:0003674, GO:0004872, GO:0004871, GO:0008227
GO:0005887 [CC]	integral to plasma membrane	probable	GO:0031226, GO:0016021, GO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0071944, GO:0005886, GO:0044425, GO:0044459, GO:0031224
GO:0009636 [BP]	response to toxic substance	probable	GO:0042221, GO:0050896, GO:0008150
GO:0007268 [BP]	synaptic transmission	probable	GO:0044700, GO:0019226, GO:0032501, GO:0044707, GO:0035637, GO:0050877, GO:0009987, GO:0008150, GO:0044763, GO:0023052, GO:0007267, GO:0007154, GO:0044699, GO:0003008

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3PBL, chain A
Confidence level:very confident
Coverage over the Query: 1-265,306-327
View the alignment between query and template
View the model in PyMOL

Template: 3PBL, chain A
Confidence level:very confident
Coverage over the Query: 264-307
View the alignment between query and template
View the model in PyMOL