Diaphorina citri psyllid: psy627


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------9
MQSGTHNANNWFIQFDTRERWENPLMGWCSTGDPLSNLALNFSSKEDAIQYCQKNGWKFFVEEPKWKTPKVKSYAFNFSWNKRTRTSTK
ccccccccccEEEEEccccccccccccccccccccccCEEEEccHHHHHHHHHHccccEEEEccccccccccccccccccccccccccc
*******ANNWFIQFDTRERWENPLMGWCSTGDPLSNLALNFSSKEDAIQYCQKNGWKFFVEEPKWKTPKVKSYAFNFSWN********
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MQSGTHNANNWFIQFDTRERWENPLMGWCSTGDPLSNLALNFSSKEDAIQYCQKNGWKFFVEEPKWKTPKVKSYAFNFSWNKRTRTSTK

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.confidentQ02375
NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.confidentQ0MQH1
NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.confidentO43181

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0048146 [BP]positive regulation of fibroblast proliferationprobableGO:0008284, GO:0042127, GO:0048145, GO:0050794, GO:0065007, GO:0048518, GO:0008150, GO:0050789, GO:0048522
GO:0022900 [BP]electron transport chainprobableGO:0044710, GO:0009987, GO:0044237, GO:0008150, GO:0008152, GO:0006091, GO:0055114
GO:0051591 [BP]response to cAMPprobableGO:1901700, GO:0009719, GO:0050896, GO:1901698, GO:0010243, GO:0010033, GO:0008150, GO:0042221, GO:0014074, GO:0046683, GO:0014070
GO:0019933 [BP]cAMP-mediated signalingprobableGO:0044700, GO:0051716, GO:0008150, GO:0050896, GO:0009987, GO:0050794, GO:0023052, GO:0019935, GO:0065007, GO:0044763, GO:0007165, GO:0019932, GO:0007154, GO:0035556, GO:0050789, GO:0044699
GO:0005743 [CC]mitochondrial inner membraneprobableGO:0019866, GO:0031975, GO:0043229, GO:0043227, GO:0043226, GO:0005737, GO:0044446, GO:0031090, GO:0016020, GO:0005740, GO:0005739, GO:0031967, GO:0031966, GO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044429, GO:0044424, GO:0044422
GO:0045333 [BP]cellular respirationprobableGO:0044710, GO:0015980, GO:0009987, GO:0044237, GO:0008150, GO:0008152, GO:0006091, GO:0055114
GO:0050136 [MF]NADH dehydrogenase (quinone) activityprobableGO:0003824, GO:0016655, GO:0003674, GO:0016651, GO:0003954, GO:0016491
GO:0072593 [BP]reactive oxygen species metabolic processprobableGO:0009987, GO:0008150, GO:0008152, GO:0044237
GO:0007420 [BP]brain developmentprobableGO:0032502, GO:0032501, GO:0044707, GO:0007399, GO:0048856, GO:0044767, GO:0048513, GO:0008150, GO:0048731, GO:0007275, GO:0044699, GO:0007417
GO:0032981 [BP]mitochondrial respiratory chain complex I assemblyprobableGO:0006996, GO:0033108, GO:0044699, GO:0022607, GO:0071822, GO:0070271, GO:0043933, GO:0097031, GO:0006461, GO:0010257, GO:0016043, GO:0065003, GO:0044085, GO:0044763, GO:0071840, GO:0034622, GO:0008150, GO:0009987, GO:0043623, GO:0007005
GO:0045271 [CC]respiratory chain complex IprobableGO:0043234, GO:0032991, GO:0030964, GO:0016020, GO:0005575, GO:0044425, GO:0070469
GO:0001932 [BP]regulation of protein phosphorylationprobableGO:0042325, GO:0032268, GO:0019220, GO:0080090, GO:0019222, GO:0060255, GO:0031323, GO:0051246, GO:0050794, GO:0051174, GO:0065007, GO:0031399, GO:0008150, GO:0050789

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2JYA, chain A
Confidence level:very confident
Coverage over the Query: 1-67
View the alignment between query and template
View the model in PyMOL