Diaphorina citri psyllid: psy6284

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270

MSAYERVKQWNTFARIWHIYDAKWQNPIESAKVISKHLQGQHKPIYHPLNDCGDHVIVMNSRHIALPGYEWKKRAYFHHTGYPGGVSWTLAWQLHEIDPTLDKACEELDKQDSDEDEESDVEEEDLDRIASAVYSKEQGNKLVKEGKWGEAIEKYNVAIQTYPHDAVFFANRALCFLKMKNYVSAEADCTASLKLDNTYVKAYQRRAAARRSLNHFEDARKDILKVLALEPNNKQAEIELAELNRKLNIPLSPIKVDFLHNPYHLTRDQR

ccHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHccccccccccccccccEEEEcccccccccccHHHHHHHHccccccccccHHHHHcccccccHHHHHHHccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccccccccHHHHHHHHHcHHHHHHHHHHHHHcccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHccccccccccccccccccccccc

****ERVKQWNTFARIWHIYDAKWQNPIESAKVISKHLQGQHKPIYHPLNDCGDHVIVMNSRHIALPGYEWKKRAYFHHTGYPGGVSWTLAWQLHEIDPTLD**************************************KLVKEGKWGEAIEKYNVAIQTYPHDAVFFANRALCFLKMKNYVSAEADCTASLKLDNTYVKAYQRRAAARRSLNHFEDARKDILKVLALEPNNKQAEIELAELNRKLNI***************L*****

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
39S ribosomal protein L13, mitochondrial		confident	Q9VJ38
39S ribosomal protein L13, mitochondrial		confident	Q9BYD1
39S ribosomal protein L13, mitochondrial		confident	Q3SYS1

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0005741 [CC]	mitochondrial outer membrane	probable	GO:0031975, GO:0043229, GO:0043227, GO:0043226, GO:0005737, GO:0005575, GO:0031090, GO:0016020, GO:0005740, GO:0005739, GO:0031968, GO:0031967, GO:0031966, GO:0043231, GO:0044464, GO:0019867, GO:0005623, GO:0005622, GO:0044446, GO:0044444, GO:0044429, GO:0044424, GO:0044422
GO:0005761 [CC]	mitochondrial ribosome	probable	GO:0031974, GO:0043229, GO:0043228, GO:0043227, GO:0043226, GO:0005737, GO:0044446, GO:0005739, GO:0030529, GO:0005759, GO:0000313, GO:0043231, GO:0032991, GO:0005840, GO:0043232, GO:0043233, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0070013, GO:0044444, GO:0044429, GO:0044424, GO:0044422
GO:0005829 [CC]	cytosol	probable	GO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0031301 [CC]	integral to organelle membrane	probable	GO:0005575, GO:0031090, GO:0016021, GO:0016020, GO:0044464, GO:0044422, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0031300, GO:0044424, GO:0044425, GO:0043227, GO:0043226, GO:0031224
GO:0005515 [MF]	protein binding	probable	GO:0003674, GO:0005488
GO:0005634 [CC]	nucleus	probable	GO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0061077 [BP]	chaperone-mediated protein folding	probable	GO:0044267, GO:0006457, GO:0044260, GO:0044238, GO:0019538, GO:0009987, GO:0044237, GO:0043170, GO:0071704, GO:0008150, GO:0008152

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3FP2, chain A
Confidence level:very confident
Coverage over the Query: 131-255
View the alignment between query and template
View the model in PyMOL

Template: 2FTC, chain H
Confidence level:very confident
Coverage over the Query: 1-107
View the alignment between query and template
View the model in PyMOL