Diaphorina citri psyllid: psy629

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160------

MDSYLYAPKDDYKHRAYWRDLYSVEEAEHLTGLISAAKEQGIDFYYALSPGLDITYSSGKEVATLKRKLEQVAQFGCRGFALLFDDIESEMSEADKEVFQSFAHAQVSVTNEVFEHLGQPKFMLCPTQYCSTRAVPNVKNSEYLNTLGSKLAKEIDIMWTGPKVPK

cccEEEcccccHHHHHHHcccccHHHHHHHHHHHHHHHHcccEEEEEEccccccccccHHHHHHHHHHHHHHHHccccEEEEEcccccccccHHHHHHHHHHHHHHHHHHHHHHHHcccccEEEcccccccccccccccccHHHHHHHHccccccEEEEccccccc

MDSYLYAPKDDYKHRAYWRDLYSVEEAEHLTGLISAAKEQGIDFYYALSPGLDITYSSGKEVATLKRKLEQVAQFGCRGFALLFDDIESEMSEADKEVFQSFAHAQVSVTNEVFEHLGQPKFMLCPTQYCSTRAVPNVKNSEYLNTLGSKLAKEIDIMWTGPKVPK

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MDSYLYAPKDDYKHRAYWRDLYSVEEAEHLTGLISAAKEQGIDFYYALSPGLDITYSSGKEVATLKRKLEQVAQFGCRGFALLFDDIESEMSEADKEVFQSFAHAQVSVTNEVFEHLGQPKFMLCPTQYCSTRAVPNVKNSEYLNTLGSKLAKEIDIMWTGPKVPK

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Bifunctional protein NCOAT	Possesses hyaluronidase activity (By similarity). Cleaves GlcNAc but not GalNAc from glycopeptides. Can use p-nitrophenyl-beta-GlcNAc as substrate but not p-nitrophenyl-beta-GalNAc or p-nitrophenyl-alpha-GlcNAc. Acetylates 'Lys-8' of histone H4 and 'Lys-14' of histone H3.	confident	Q8VIJ5
Bifunctional protein NCOAT	Cleaves GlcNAc but not GalNAc from glycopeptides. Can use p-nitrophenyl-beta-GlcNAc as substrate but not p-nitrophenyl-beta-GalNAc or p-nitrophenyl-alpha-GlcNAc. Possesses hyaluronidase activity (By similarity). Acetylates 'Lys-8' of histone H4.	confident	Q9EQQ9

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0044710 [BP]	single-organism metabolic process	probable	GO:0008150, GO:0008152
GO:0033036 [BP]	macromolecule localization	probable	GO:0008150, GO:0051179
GO:0005739 [CC]	mitochondrion	probable	GO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0060051 [BP]	negative regulation of protein glycosylation	probable	GO:0009892, GO:0080090, GO:0019222, GO:0031327, GO:2000112, GO:0031324, GO:0031323, GO:0060049, GO:0051248, GO:0010605, GO:0009890, GO:0010561, GO:0051246, GO:2000113, GO:0050789, GO:0065007, GO:0031399, GO:0048519, GO:0060255, GO:0009889, GO:0050794, GO:0031326, GO:0008150, GO:0010675, GO:0045912, GO:0032269, GO:0032268, GO:0010559, GO:0031400, GO:0010556, GO:0006109, GO:0010558, GO:0048523
GO:0044699 [BP]	single-organism process	probable	GO:0008150
GO:1901135 [BP]	carbohydrate derivative metabolic process	probable	GO:0071704, GO:0008150, GO:0008152
GO:0016231 [MF]	beta-N-acetylglucosaminidase activity	probable	GO:0016787, GO:0016798, GO:0015929, GO:0003824, GO:0004563, GO:0003674, GO:0004553
GO:0006464 [BP]	cellular protein modification process	probable	GO:0044267, GO:0044260, GO:0044238, GO:0019538, GO:0009987, GO:0044237, GO:0043170, GO:0071704, GO:0043412, GO:0036211, GO:0008150, GO:0008152
GO:0006796 [BP]	phosphate-containing compound metabolic process	probable	GO:0009987, GO:0008150, GO:0008152, GO:0044237, GO:0006793

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2XSA, chain A
Confidence level:very confident
Coverage over the Query: 1-166
View the alignment between query and template
View the model in PyMOL