Diaphorina citri psyllid: psy62


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260--
KCFECNAHNPQWASVTYGIWICLECSGKHRGLGVHLSFVRSISMDKWKDIELEKMKVGGNKAAHDFLNAQPDWDDTMTIQQKYNTKAAALYRDKVSSSYMFNTFTTKGIFDFSQSGGSTVTSSYQGGGGGYQSGGGGGMVNSASFQSEKEAFFSRKQQENLSRPDHLPPSQGGRYAGFGNSVESPPPRSVSSQELFGGAVSSLTSGWSMFSSSATKLASKATENAIKYGGMATQKVTEIGTTVTEKVRDWDFMACLFNSSII
cccccccccccEEEccccEEEEEcccccccccccEEEEEEccccccccHHHHHHHHHccHHHHHHHHHHccccccccccccccccHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHccccHHHHHHHHcccc
KCFECNAHNPQWASVTYGIWICLECSGKHRGLGVHLSFVRSISMDKWKDIELEKMKVGGNKAAHDFLNAQPDWDDTMTIQQKYNTKAAALYRDKVSSSYMF**************************************************************************************************************************NAIKYGGMATQKVTEIGTTVTEKVRDWDFMACLFNSS**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
KCFECNAHNPQWASVTYGIWICLECSGKHRGLGVHLSFVRSISMDKWKDIELEKMKVGGNKAAHDFLNAQPDWDDTMTIQQKYNTKAAALYRDKVSSSYMFNTFTTKGIFDFSQSGGSTVTSSYQGGGGGYQSGGGGGMVNSASFQSEKEAFFSRKQQENLSRPDHLPPSQGGRYAGFGNSVESPPPRSVSSQELFGGAVSSLTSGWSMFSSSATKLASKATENAIKYGGMATQKVTEIGTTVTEKVRDWDFMACLFNSSII

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Uncharacterized protein C622.14 GTPase-activating protein for the ADP ribosylation factor family.confidentO94601
ADP-ribosylation factor GTPase-activating protein GCS1 GTPase-activating protein (GAP) for ARF1 and ARF2. Involved in intracellular vesicular transport. Required for transport from the trans-Golgi network. Implicated in the regulation of retrograde transport from the Golgi to the ER and in actin cytoskeletal organization. May be involved in the maintenance of mitochondrial morphology, possibly through organizing the actin cytoskeleton in Saccharomyces.confidentP35197

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0008060 [MF]ARF GTPase activator activityprobableGO:0030234, GO:0005096, GO:0030695, GO:0003674, GO:0008047, GO:0060589, GO:0005083
GO:0032312 [BP]regulation of ARF GTPase activityprobableGO:0009894, GO:0019220, GO:0080090, GO:0019222, GO:0048583, GO:0023051, GO:0010646, GO:0043087, GO:0050789, GO:0032318, GO:0031329, GO:0009966, GO:0031323, GO:0030811, GO:0065007, GO:0032012, GO:0051056, GO:0033121, GO:0033124, GO:0019219, GO:0046578, GO:0050790, GO:0050794, GO:0051174, GO:0008150, GO:0051171, GO:0009118, GO:0065009, GO:0051336, GO:1900542, GO:0006140
GO:0043231 [CC]intracellular membrane-bounded organelleprobableGO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0044444 [CC]cytoplasmic partprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424
GO:0008270 [MF]zinc ion bindingprobableGO:0043169, GO:0046914, GO:0043167, GO:0003674, GO:0005488, GO:0046872

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3DWD, chain A
Confidence level:very confident
Coverage over the Query: 1-100
View the alignment between query and template
View the model in PyMOL