Diaphorina citri psyllid: psy6304


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------
MFPGTMHIGYNRFRFLLECLADLDRQLKSHGGQLFIVQGSPISIFQKLKRELNFTKLCFEQDCEGVKPYQSFPTGSHPPRYQPCKTLLNFRDLSGLPPRPKEDIDFRHVTFGTMSESLQREVSLFQTVPKPEQFHKYPEMDFGDPLIRWLGGETEALIKLNERLSQEIESFKSGVYLSNQVSPDLTGPPTSQSAALKFGCLSVRRFYWALHDHFNTIHEGRPPSHFNITGQLIWREYFYTMSAHNPYYDQMEKNPICLNIPWLPESHPNKEKYLNAWKNGQTGYPFIDAVMRQLRRLLDCTYCVCPVNFGRRLDPDGIYIKRYVPELRQFPIQYIYEPWKAPLGVQEKANCIISKDYPERIVNHVQASLENKQYLKKEKANCIINKDYPERIVNHVQASLENKQNVK
cccccccccHHHHHHHHHHHHHHHHHHHHccccEEEEEccHHHHHHHHHHHHcccEEEEccccccccHHHHccccccccccccccEEEcccccccccccccccccccccccccccHHHHHccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccHcccccccHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccHHHHHHHHccccccHHHcHHHHHHHHHHHcccccccHHHHHcccccccHHHHHHHHHcccccccccccccccHHHHHHcccccccccccccccHHHHHHHHHHHHHHHHHHcccccccccHHHcccHHHHHHHHccc
MFPGTMHIGYNRFRFLLECLADLDRQLKSHGGQLFIVQGSPISIFQKLKRELNFTKLCFEQDCEGVKPYQSFPTGSHPPRYQPCKTLLNFRDLSGLPPRPKEDIDFRHVTFGTMSESLQREVSLFQTVPKPEQFHKYPEMDFGDPLIRWLGGETEALIKLNERLSQEIESFKSGVYLSNQVSPDLTGPPTSQSAALKFGCLSVRRFYWALHDHFNTIHEGRPPSHFNITGQLIWREYFYTMSAHNPYYDQMEKNPICLNIPWLPESHPNKEKYLNAWKNGQTGYPFIDAVMRQLRRLLDCTYCVCPVNFGRRLDPDGIYIKRYVPELRQFPIQYIYEPWKAPLGVQEKANCIISKDYPERIVNHVQASLENKQYLKKEKANCIINK*********************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MFPGTMHIGYNRFRFLLECLADLDRQLKSHGGQLFIVQGSPISIFQKLKRELNFTKLCFEQDCEGVKPYQSFPTGSHPPRYQPCKTLLNFRDLSGLPPRPKEDIDFRHVTFGTMSESLQREVSLFQTVPKPEQFHKYPEMDFGDPLIRWLGGETEALIKLNERLSQEIESFKSGVYLSNQVSPDLTGPPTSQSAALKFGCLSVRRFYWALHDHFNTIHEGRPPSHFNITGQLIWREYFYTMSAHNPYYDQMEKNPICLNIPWLPESHPNKEKYLNAWKNGQTGYPFIDAVMRQLRRLLDCTYCVCPVNFGRRLDPDGIYIKRYVPELRQFPIQYIYEPWKAPLGVQEKANCIISKDYPERIVNHVQASLENKQYLKKEKANCIINKDYPERIVNHVQASLENKQNVK

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
(6-4)DNA photolyase Involved in repair of UV radiation-induced DNA damage. Catalyzes the photoreactivation of pyrimidine [6-4] pyrimidone photoproduct (6-4 products).confidentQ0E2Y1
Cryptochrome-1 Blue light-dependent regulator of the circadian feedback loop. Inhibits CLOCK|NPAS2-ARNTL E box-mediated transcription. Acts, in conjunction with CRY2, in maintaining period length and circadian rhythmicity. Has no photolyase activity. Capable of translocating circadian clock core proteins such as PER proteins to the nucleus. May inhibit CLOCK|NPAS2-ARNTL transcriptional activity through stabilizing the unphosphorylated form of ARNTL.confidentQ16526
Cryptochrome-1 Blue light-dependent regulator that is the input of the circadian feedback loop. Has no photolyase activity for cyclobutane pyrimidine dimers or 6-4 photoproducts. Regulation of expression by light suggests a role in photoreception for locomotor activity rhythms. Light induces the degradation of cry, likely due to conformational change in the photoreceptor leading to targeting to the proteasome. Under circadian regulation, expression is influenced by the clock pacemaker genes period, timeless, Clock and cycle. Binding to tim irreversibly commits tim to proteasomal degradation. Functions, together with per, as a transcriptional repressor required for the oscillation of peripheral circadian clocks and for the correct specification of clock cells. Genes directly activated by the transcription factors Clock (Clk) and cycle (cyc) are repressed by cry. Necessary for light-dependent magnetosensitivity, an intact circadian system is not required for the magnetoreception mechanism to operate. Required for both the naive and trained responses to magnetic field, consistent with the notion that Cry is in the input pathway of magnetic sensing.confidentQ293P8

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005634 [CC]nucleusprobableGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0005737 [CC]cytoplasmprobableGO:0044424, GO:0005575, GO:0044464, GO:0005623, GO:0005622

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1OWL, chain A
Confidence level:very confident
Coverage over the Query: 5-382
View the alignment between query and template
View the model in PyMOL
Template: 3FY4, chain A
Confidence level:very confident
Coverage over the Query: 4-405
View the alignment between query and template
View the model in PyMOL