Diaphorina citri psyllid: psy6309


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130----
MSYKSGILHYTPSRRVDGKLQCAYDDRYIPFRSPQVFIQLTYFVSGILHYTPSRRVDGKLQCAYDDRYIVQVATEYDGVIVSNDRYRDIMQENDKWKATIERRLLMFNFVKELLIFPQDPLGRDGPSLDEFLRF
ccccccCEEEECccccccccccccccccccccccHHHHHHHcHHcccEEEcccccccccEEEEcccHHHHHHHHHcccEEEEcccHHHHHHHcHHHHHHHHHccccccccccCECccccccccccccccccccc
***KSGILHYTPSRRVDGKLQCAYDDRYIPFRSPQVFIQLTYFVSGILHYTPSRRVDGKLQCAYDDRYIVQVATEYDGVIVSNDRYRDIMQENDKWKATIERRLLMFNFVKELLIFPQDPLGRDGPSLDEFLRF
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSYKSGILHYTPSRRVDGKLQCAYDDRYIPFRSPQVFIQLTYFVSGILHYTPSRRVDGKLQCAYDDRYIVQVATEYDGVIVSNDRYRDIMQENDKWKATIERRLLMFNFVKELLIFPQDPLGRDGPSLDEFLRF

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Probable ribonuclease ZC3H12D May regulate cell growth likely by suppressing RB1 phosphorylation. May function as RNase and regulate the levels of target RNA species (Potential). Serve as a tumor suppressor in certain leukemia cells. Overexpression inhibits the G1 to S phase progression through suppression of RB1 phosphorylation.confidentA2A288
Probable ribonuclease ZC3H12D May regulate cell growth likely by suppressing Rb1 phosphorylation. May function as RNase and regulate the levels of target RNA species (Potential). Putative tumor suppressor.confidentQ8BIY3

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:2000134 [BP]negative regulation of G1/S transition of mitotic cell cycleprobableGO:0007346, GO:2000045, GO:0051726, GO:0010564, GO:0050794, GO:0008150, GO:1901987, GO:0010948, GO:0065007, GO:1901991, GO:1901990, GO:0048519, GO:0048523, GO:0050789, GO:1901988
GO:0010508 [BP]positive regulation of autophagyprobableGO:0009896, GO:0009894, GO:0009893, GO:0031329, GO:0031331, GO:0031325, GO:0031323, GO:0050794, GO:0065007, GO:0048518, GO:0008150, GO:0019222, GO:0010506, GO:0050789, GO:0048522
GO:0032720 [BP]negative regulation of tumor necrosis factor productionprobableGO:0001817, GO:0051241, GO:0008150, GO:0032680, GO:0065007, GO:0051239, GO:0048519, GO:0050789, GO:0001818
GO:0010884 [BP]positive regulation of lipid storageprobableGO:0008150, GO:0065007, GO:0048518, GO:0010883, GO:0032879, GO:0050789
GO:2000379 [BP]positive regulation of reactive oxygen species metabolic processprobableGO:0009893, GO:0019222, GO:0031325, GO:0031323, GO:2000377, GO:0050794, GO:0065007, GO:0048518, GO:0008150, GO:0050789, GO:0048522
GO:0032088 [BP]negative regulation of NF-kappaB transcription factor activityprobableGO:0080090, GO:0019222, GO:0031326, GO:0031323, GO:0050789, GO:2000112, GO:0060255, GO:0065007, GO:0044092, GO:0065009, GO:0010468, GO:0019219, GO:0009889, GO:0050794, GO:0008150, GO:0051171, GO:2001141, GO:0043433, GO:0051090, GO:0051252, GO:0006355, GO:0010556
GO:0032715 [BP]negative regulation of interleukin-6 productionprobableGO:0051241, GO:0050789, GO:0008150, GO:0001817, GO:0065007, GO:0051239, GO:0048519, GO:0032675, GO:0001818
GO:0030308 [BP]negative regulation of cell growthprobableGO:0045926, GO:0040008, GO:0051128, GO:0008150, GO:0001558, GO:0065007, GO:0048519, GO:0050794, GO:0050789, GO:0048523
GO:0005737 [CC]cytoplasmprobableGO:0044424, GO:0005575, GO:0044464, GO:0005623, GO:0005622
GO:0005730 [CC]nucleolusprobableGO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0010629 [BP]negative regulation of gene expressionprobableGO:0009892, GO:0019222, GO:0060255, GO:0050789, GO:0008150, GO:0065007, GO:0048519, GO:0010605, GO:0010468
GO:0071222 [BP]cellular response to lipopolysaccharideprobableGO:0070887, GO:0032496, GO:0044699, GO:0051716, GO:0033993, GO:0009617, GO:0071310, GO:0071219, GO:0071216, GO:0009987, GO:0071396, GO:0008150, GO:0042221, GO:0051707, GO:0010033, GO:0051704, GO:1901700, GO:1901701, GO:0009607, GO:0050896, GO:0002237, GO:0044763
GO:0010628 [BP]positive regulation of gene expressionprobableGO:0009893, GO:0019222, GO:0060255, GO:0050789, GO:0065007, GO:0048518, GO:0008150, GO:0010468, GO:0010604
GO:0045019 [BP]negative regulation of nitric oxide biosynthetic processprobableGO:0009889, GO:0009892, GO:0019222, GO:0009890, GO:0031327, GO:0031326, GO:0031324, GO:0031323, GO:0050794, GO:0008150, GO:0045428, GO:0065007, GO:0051171, GO:0051172, GO:0048519, GO:0050789, GO:0048523
GO:0045600 [BP]positive regulation of fat cell differentiationprobableGO:0051094, GO:0050793, GO:0050794, GO:0045597, GO:0045595, GO:0065007, GO:0048518, GO:0008150, GO:0045598, GO:0050789, GO:0048522
GO:0005886 [CC]plasma membraneprobableGO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3V33, chain A
Confidence level:very confident
Coverage over the Query: 2-133
View the alignment between query and template
View the model in PyMOL