Diaphorina citri psyllid: psy630

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------
MSNSIRQLNKIFVGNLPWTVSHNELKKFFSEYGQIMNASVMFDKNTGLSKGFGFVTFQNKEAVDKVFSTDSHVLEGSRLSIQPSDSHNRMAENMEDRFNQACDYLPSLVKKLDSSTLLKFYALYKQATVGQCNIDKPSWYNMEAKSKYNAWNSLGQMAKSEAMSKYIALLKEVDAGWEDKEQEEINWDWKPNQKAMSKYIALLNEVDASWEDKEQEEINWDESQESGSKENEGQTKGWVNVSSMINDESQLDDNEKNIYEWAKEGKLDMLVKQLTKLKDFNINQLDENGLNCLHWACDRGHLKVVQHLIEKCGADVNVTDSDGDYGLDYAKAIEHTDLIEYLVNSGS
ccccccccccEEEEcccccccHHHHHHHHHccccEEEEEEEEcccccccccEEEEEEccHHHHHHHHccccCEEcccccccccccccccccHHHHHHHcccccccccccccccHHHHHHHHHccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHcccccccHHHHHHHccccccHHHHHHHHHHcccccccccHHHHHccccccccccccccccccccccccccccccccccccccHHHHHHHHHHccHHHHHHHHHHccccccccccccccHHHHHHHccccHHHHHHHHHHccccccccccccccHHHHHHHcccHHHHHHHHHccc
******QLNKIFVGNLPWTVSHNELKKFFSEYGQIMNASVMFDKNTGLSKGFGFVTFQNKEAVDKVFSTDSHVLEGSRLSIQPSD***********RFNQACDYLPSLVKKLDSSTLLKFYALYKQATVGQCNIDKPSWYNMEAKSKYNAWNSLGQMAKSEAMSKYIALLKEVDAGWEDKEQEEINWDWKPNQKAMSKYIALLNEVDAS***********************************************NIYEWAKEGKLDMLVKQLTKLKDFNINQLDENGLNCLHWACDRGHLKVVQHLIEKCGADVNVTDSDGDYGLDYAKAIEHTDLIEYLVNSG*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSNSIRQLNKIFVGNLPWTVSHNELKKFFSEYGQIMNASVMFDKNTGLSKGFGFVTFQNKEAVDKVFSTDSHVLEGSRLSIQPSDSHNRMAENMEDRFNQACDYLPSLVKKLDSSTLLKFYALYKQATVGQCNIDKPSWYNMEAKSKYNAWNSLGQMAKSEAMSKYIALLKEVDAGWEDKEQEEINWDWKPNQKAMSKYIALLNEVDASWEDKEQEEINWDESQESGSKENEGQTKGWVNVSSMINDESQLDDNEKNIYEWAKEGKLDMLVKQLTKLKDFNINQLDENGLNCLHWACDRGHLKVVQHLIEKCGADVNVTDSDGDYGLDYAKAIEHTDLIEYLVNSGS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Acyl-CoA-binding domain-containing protein 6 Binds long-chain acyl-coenzyme A molecules with a strong preference for unsaturated C18:1-CoA, lower affinity for unsaturated C20:4-CoA, and very weak affinity for saturated C16:0-CoA. Does not bind fatty acids.confidentQ5RJK8
Acyl-CoA-binding domain-containing protein 6 homolog Binds long-chain acyl-coenzyme A molecules with a strong preference for unsaturated C18:1-CoA. Does not bind fatty acids.confidentQ54GC8
Acyl-CoA-binding domain-containing protein 6 Binds long-chain acyl-coenzyme A molecules with a strong preference for unsaturated C18:1-CoA, lower affinity for unsaturated C20:4-CoA, and very weak affinity for saturated C16:0-CoA. Does not bind fatty acids.confidentA2VDR2

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0044428 [CC]nuclear partprobableGO:0005575, GO:0043231, GO:0005634, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0044424, GO:0043227, GO:0043226, GO:0044422
GO:0050896 [BP]response to stimulusprobableGO:0008150
GO:2000112 [BP]regulation of cellular macromolecule biosynthetic processprobableGO:0009889, GO:0019222, GO:0060255, GO:0031326, GO:0031323, GO:0050794, GO:0010556, GO:0065007, GO:0008150, GO:0050789
GO:0043232 [CC]intracellular non-membrane-bounded organelleprobableGO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0043228, GO:0044424, GO:0043226
GO:0010468 [BP]regulation of gene expressionprobableGO:0060255, GO:0008150, GO:0065007, GO:0050789, GO:0019222
GO:0005739 [CC]mitochondrionprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0003690 [MF]double-stranded DNA bindingprobableGO:0043566, GO:0097159, GO:0003674, GO:0005488, GO:0003676, GO:0003677, GO:1901363
GO:0003697 [MF]single-stranded DNA bindingprobableGO:0043566, GO:0097159, GO:0003674, GO:0005488, GO:0003676, GO:0003677, GO:1901363
GO:0080090 [BP]regulation of primary metabolic processprobableGO:0008150, GO:0065007, GO:0050789, GO:0019222
GO:0032991 [CC]macromolecular complexprobableGO:0005575
GO:0003729 [MF]mRNA bindingprobableGO:0097159, GO:0003674, GO:0005488, GO:0003676, GO:1901363, GO:0003723
GO:0005576 [CC]extracellular regionprobableGO:0005575

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1N11, chain A
Confidence level:very confident
Coverage over the Query: 247-347
View the alignment between query and template
View the model in PyMOL
Template: 1L3K, chain A
Confidence level:very confident
Coverage over the Query: 4-86,99-166
View the alignment between query and template
View the model in PyMOL
Template: 3FLV, chain A
Confidence level:very confident
Coverage over the Query: 92-179
View the alignment between query and template
View the model in PyMOL