Psyllid ID: psy630


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------
MSNSIRQLNKIFVGNLPWTVSHNELKKFFSEYGQIMNASVMFDKNTGLSKGFGFVTFQNKEAVDKVFSTDSHVLEGSRLSIQPSDSHNRMAENMEDRFNQACDYLPSLVKKLDSSTLLKFYALYKQATVGQCNIDKPSWYNMEAKSKYNAWNSLGQMAKSEAMSKYIALLKEVDAGWEDKEQEEINWDWKPNQKAMSKYIALLNEVDASWEDKEQEEINWDESQESGSKENEGQTKGWVNVSSMINDESQLDDNEKNIYEWAKEGKLDMLVKQLTKLKDFNINQLDENGLNCLHWACDRGHLKVVQHLIEKCGADVNVTDSDGDYGLDYAKAIEHTDLIEYLVNSGS
ccccccccccEEEEcccccccHHHHHHHHHccccEEEEEEEEcccccccccEEEEEEccHHHHHHHHccccEEEcccccccccccccccccHHHHHHHcccccccccccccccHHHHHHHHHccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHccccccHHHHHHHHccccccHHHHHHHHHHcccccccccHHHHHHcccccccccccccccccccccccccccccccccccccHHHHHHHHHHccHHHHHHHHHHcccccccccccccHHHHHHHHccccHHHHHHHHHHcccccccccccccHHHHHHHHcccHHHHHHHHHccc
ccccccHHHEEEEEcccccccHHHHHHHHHHHccEEEEEEEEccccccEEEEEEEEEccHHHHHHHHcccccEEcccEEEEcccccccccccHHccccccEEEEEccccccccHHHHHHHHHHcccEEEEEEEEEcccccEEEEcccHHHHHHHHHHccccccccEEEEEccccHHHHcHHHHHHHHHccccccccccccccccccccHHHHcccccccccccccccccccccccccccEEEcccHHHHHHHHHHHcHHHHHHcccHHHHHHHHHHcccccccccccccccHHHHHHcccHHHHHHHHHHHccccEcccccccccHHHHHHHHHHHHHHHHHHHccc
MSNSIRQLNKIfvgnlpwtvSHNELKKFFSEYGQIMNASVmfdkntglskgfgfvtfqnkeavdkvfstdshvlegsrlsiqpsdshNRMAENMEDRFNQACDYLPslvkkldsstlLKFYALYKQAtvgqcnidkpswynmeaKSKYNAWNSLGQMAKSEAMSKYIALLKEVdagwedkeqeeinwdwkpnQKAMSKYIALLNEVdaswedkeqeeinwdesqesgskenegqtkgwVNVSSMindesqlddnEKNIYEWAKEGKLDMLVKQLTKLKdfninqldenglnclhwacdrgHLKVVQHLIEKCgadvnvtdsdgdyglDYAKAIEHTDLIEYLVNSGS
MSNSIRQLNKifvgnlpwtvSHNELKKFFSEYGQIMNASVMFDKNTGLSKGFGFVTFQNKEAVDKVFStdshvlegsrlsiqpsdsHNRMAENMEDRFNQACDYLPSLVKKLDSSTLLKFYALYKQATVGQCNIDKPSWYNMEAKSKYNAWNSLGQMAKSEAMSKYIALLKEVDAGWEDKEqeeinwdwkpnqKAMSKYIALLNEVDASWEDKEQEEInwdesqesgskenegqtkgwVNVSSMindesqlddNEKNIYEWAKEGKLDMLVKQLTKLKDFNINQLDENGLNCLHWACDRGHLKVVQHLIEKCGADVNVTDSDGDYGLDYAKAIEHTDLIEYLVNSGS
MSNSIRQLNKIFVGNLPWTVSHNELKKFFSEYGQIMNASVMFDKNTGLSKGFGFVTFQNKEAVDKVFSTDSHVLEGSRLSIQPSDSHNRMAENMEDRFNQACDYLPSLVKKLDSSTLLKFYALYKQATVGQCNIDKPSWYNMEAKSKYNAWNSLGQMAKSEAMSKYIALLKEVDAGWEDKEQEEINWDWKPNQKAMSKYIALLNEVDASWEDKEQEEINWDESQESGSKENEGQTKGWVNVSSMINDESQLDDNEKNIYEWAKEGKLDMLVKQLTKLKDFNINQLDENGLNCLHWACDRGHLKVVQHLIEKCGADVNVTDSDGDYGLDYAKAIEHTDLIEYLVNSGS
******QLNKIFVGNLPWTVSHNELKKFFSEYGQIMNASVMFDKNTGLSKGFGFVTFQNKEAVDKVFST****************************FNQACDYLPSLVKKLDSSTLLKFYALYKQATVGQCNIDKPSWYNMEAKSKYNAWNSLGQMAKSEAMSKYIALLKEVDAGWEDKEQEEINWDWKPNQKAMSKYIALLNEVDAS***********************************************NIYEWAKEGKLDMLVKQLTKLKDFNINQLDENGLNCLHWACDRGHLKVVQHLIEKCGADVNVTDSDGDYGLDYAKAIEHTDLIEYLV****
******Q****FVGNLPWTVSHNELKKFFSEYGQIMNASVMFDKNTGLSKGFGFVTFQNKEAVDKVFSTDSHVLEGSRLSIQPSD***********RFNQACDYLPSLVKKLDSSTLLKFYALYKQATVGQCNIDKPSWYNMEAKSKYNAW*************KYIALLKEVDA**********************************************************************************IYEWAKEGKLDMLVKQLTKLKDFNINQLDENGLNCLHWACDRGHLKVVQHLIEKCGADVNVTDSDGDYGLDYAKAIEHTDLIEYLVNSG*
MSNSIRQLNKIFVGNLPWTVSHNELKKFFSEYGQIMNASVMFDKNTGLSKGFGFVTFQNKEAVDKVFSTDSHVLEGSRLSIQPSDSHNRMAENMEDRFNQACDYLPSLVKKLDSSTLLKFYALYKQATVGQCNIDKPSWYNMEAKSKYNAWNSLGQMAKSEAMSKYIALLKEVDAGWEDKEQEEINWDWKPNQKAMSKYIALLNEVDASWE***********************TKGWVNVSSMINDESQLDDNEKNIYEWAKEGKLDMLVKQLTKLKDFNINQLDENGLNCLHWACDRGHLKVVQHLIEKCGADVNVTDSDGDYGLDYAKAIEHTDLIEYLVNSGS
*****RQLNKIFVGNLPWTVSHNELKKFFSEYGQIMNASVMFDKNTGLSKGFGFVTFQNKEAVDKVFSTDSHVLEGSRLSIQPSDS***M*E***DRFNQACDYLPSLVKKLDSSTLLKFYALYKQATVGQCNIDKPSWYNMEAKSKYNAWNSLGQMAKSEAMSKYIALLKEVDAGWEDKEQEEINWDWKPNQKAMSKYIALLNEVDASWEDKEQEEINWDESQESGSKENEGQTKGWVNVSSMINDESQLDDNEKNIYEWAKEGKLDMLVKQLTKLKDFNINQLDENGLNCLHWACDRGHLKVVQHLIEKCGADVNVTDSDGDYGLDYAKAIEHTDLIEYLVNSG*
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSNSIRQLNKIFVGNLPWTVSHNELKKFFSEYGQIMNASVMFDKNTGLSKGFGFVTFQNKEAVDKVFSTDSHVLEGSRLSIQPSDSHNRMAENMEDRFNQACDYLPSLVKKLDSSTLLKFYALYKQATVGQCNIDKPSWYNMEAKSKYNAWNSLGQMAKSEAMSKYIALLKEVDAGWEDKEQEEINWDWKPNQKAMSKYIALLNEVDASWEDKEQEEINWDESQESGSKENEGQTKGWVNVSSMINDESQLDDNEKNIYEWAKEGKLDMLVKQLTKLKDFNINQLDENGLNCLHWACDRGHLKVVQHLIEKCGADVNVTDSDGDYGLDYAKAIEHTDLIEYLVNSGS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query347 2.2.26 [Sep-21-2011]
Q5RJK8282 Acyl-CoA-binding domain-c yes N/A 0.602 0.741 0.321 6e-32
Q9BR61282 Acyl-CoA-binding domain-c yes N/A 0.599 0.737 0.318 3e-31
A2VDR2282 Acyl-CoA-binding domain-c yes N/A 0.608 0.748 0.315 4e-31
Q9D061282 Acyl-CoA-binding domain-c yes N/A 0.599 0.737 0.312 4e-29
Q4V8X4300 Acyl-CoA-binding domain-c yes N/A 0.625 0.723 0.280 3e-26
Q66JD7286 Acyl-CoA-binding domain-c yes N/A 0.616 0.748 0.266 9e-25
Q4V869286 Acyl-CoA-binding domain-c N/A N/A 0.616 0.748 0.277 3e-24
Q9SM23338 Acyl-CoA-binding domain-c yes N/A 0.533 0.547 0.312 2e-20
Q54GC8288 Acyl-CoA-binding domain-c yes N/A 0.697 0.840 0.301 5e-20
Q9STP8354 Acyl-CoA-binding domain-c no N/A 0.550 0.539 0.289 9e-20
>sp|Q5RJK8|ACBD6_RAT Acyl-CoA-binding domain-containing protein 6 OS=Rattus norvegicus GN=Acbd6 PE=2 SV=1 Back     alignment and function desciption
 Score =  138 bits (348), Expect = 6e-32,   Method: Compositional matrix adjust.
 Identities = 82/255 (32%), Positives = 134/255 (52%), Gaps = 46/255 (18%)

Query: 93  NMEDRFNQACDYLPSLVKKLDSSTLLKFYALYKQATVGQCNIDKPSWYNMEAKSKYNAWN 152
           ++ + F +A  ++  LV+      LL  YA YKQ  VG CNI KP++++ E K K+ AW 
Sbjct: 41  SLAELFEKAAAHVQGLVQVASREQLLYLYARYKQVKVGNCNIPKPNFFDFEGKQKWEAWK 100

Query: 153 SLGQMAKSEAMSKYIALLKEVDAGWEDKEQEEINWDWKPNQKAMSKYIALLNEVDASWED 212
           +LG  + S+AM +YIA +K++D GW                                   
Sbjct: 101 ALGDSSPSQAMQEYIAAVKKLDPGW----------------------------------- 125

Query: 213 KEQEEINWDESQESGSKENEGQTKGWVNVSSMINDESQLDDNEKNIYEWAKEGKLDMLVK 272
                 N   S++ G + + G   G   VSS+ ++E+ + + +KNI+++ +E  +D + K
Sbjct: 126 ------NPQVSEKKGKEGSSG--FGGPVVSSLYHEET-IREEDKNIFDYCRENNIDHITK 176

Query: 273 QLTKLKDFNINQLDENGLNCLHWACDRGHLKVVQHLIEKCGADVNVTDSDGDYGLDYAKA 332
            + K K  ++N  DE G   LHWACDRGH ++V+ L++ C A +N  D++G   L YA A
Sbjct: 177 AI-KSKTVDVNMTDEEGRALLHWACDRGHKELVKVLLQ-CEAGINCQDNEGQTALHYAAA 234

Query: 333 IEHTDLIEYLVNSGS 347
            E +D++E L+ SG+
Sbjct: 235 CEFSDIVELLLQSGA 249




Binds long-chain acyl-coenzyme A molecules with a strong preference for unsaturated C18:1-CoA, lower affinity for unsaturated C20:4-CoA, and very weak affinity for saturated C16:0-CoA. Does not bind fatty acids.
Rattus norvegicus (taxid: 10116)
>sp|Q9BR61|ACBD6_HUMAN Acyl-CoA-binding domain-containing protein 6 OS=Homo sapiens GN=ACBD6 PE=1 SV=1 Back     alignment and function description
>sp|A2VDR2|ACBD6_BOVIN Acyl-CoA-binding domain-containing protein 6 OS=Bos taurus GN=ACBD6 PE=2 SV=1 Back     alignment and function description
>sp|Q9D061|ACBD6_MOUSE Acyl-CoA-binding domain-containing protein 6 OS=Mus musculus GN=Acbd6 PE=1 SV=2 Back     alignment and function description
>sp|Q4V8X4|ACBD6_DANRE Acyl-CoA-binding domain-containing protein 6 OS=Danio rerio GN=acbd6 PE=2 SV=1 Back     alignment and function description
>sp|Q66JD7|ACBD6_XENTR Acyl-CoA-binding domain-containing protein 6 OS=Xenopus tropicalis GN=acbd6 PE=2 SV=1 Back     alignment and function description
>sp|Q4V869|ACBD6_XENLA Acyl-CoA-binding domain-containing protein 6 OS=Xenopus laevis GN=acbd6 PE=2 SV=1 Back     alignment and function description
>sp|Q9SM23|ACBP1_ARATH Acyl-CoA-binding domain-containing protein 1 OS=Arabidopsis thaliana GN=ACBP1 PE=1 SV=2 Back     alignment and function description
>sp|Q54GC8|ACBD6_DICDI Acyl-CoA-binding domain-containing protein 6 homolog OS=Dictyostelium discoideum GN=acbd6 PE=3 SV=1 Back     alignment and function description
>sp|Q9STP8|ACBP2_ARATH Acyl-CoA-binding domain-containing protein 2 OS=Arabidopsis thaliana GN=ACBP2 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query347
242009252 511 conserved hypothetical protein [Pediculu 0.798 0.542 0.360 4e-53
350406915240 PREDICTED: acyl-CoA-binding domain-conta 0.599 0.866 0.361 1e-36
340721725262 PREDICTED: acyl-CoA-binding domain-conta 0.680 0.900 0.344 3e-36
383857939 479 PREDICTED: uncharacterized protein LOC10 0.585 0.423 0.349 6e-36
380028990 483 PREDICTED: putative ankyrin repeat prote 0.582 0.418 0.362 6e-36
307174126233 Acyl-CoA-binding domain-containing prote 0.585 0.871 0.333 6e-35
307195671238 Acyl-CoA-binding domain-containing prote 0.587 0.857 0.349 1e-34
332031342240 Acyl-CoA-binding domain-containing prote 0.613 0.887 0.314 4e-33
322797576296 hypothetical protein SINV_80899 [Solenop 0.639 0.75 0.300 2e-32
260795083251 hypothetical protein BRAFLDRAFT_69053 [B 0.602 0.832 0.319 3e-32
>gi|242009252|ref|XP_002425404.1| conserved hypothetical protein [Pediculus humanus corporis] gi|212509213|gb|EEB12666.1| conserved hypothetical protein [Pediculus humanus corporis] Back     alignment and taxonomy information
 Score =  214 bits (546), Expect = 4e-53,   Method: Compositional matrix adjust.
 Identities = 125/347 (36%), Positives = 181/347 (52%), Gaps = 70/347 (20%)

Query: 1   MSNSIRQLNKIFVGNLPWTVSHNELKKFFSEYGQIMNASVMFDKNTGLSKGFGFVTFQNK 60
           MSN I+ L K+FV NLP+TV   E KK+F  +G+++ A V+FD  TG SKG+GF+ ++N+
Sbjct: 218 MSN-IKALKKLFVSNLPYTVGKREFKKYFETFGKVIYADVIFDWKTGFSKGYGFILYKNE 276

Query: 61  EAVDKVFSTDSHVLEGSRLSIQPSDSHNRMAENMEDRFNQACDYLPSLVKKLDSSTLLKF 120
            ++  V S+  H LEG RL                     A  ++ ++V  L    LL+F
Sbjct: 277 SSLKSVMSSQPHTLEGGRLV--------------------ASSHVKNIVGNLTKEQLLEF 316

Query: 121 YALYKQATVGQCNIDKPSWYNMEAKSKYNAWNSLGQMAKSEAMSKYIALLKEVDAGWEDK 180
           YA YKQA  G CN  KP WY    K K+ AW +L  M                       
Sbjct: 317 YAHYKQAIEGPCNKPKPYWYEFSEKQKWEAWTNLNDMD---------------------- 354

Query: 181 EQEEINWDWKPNQKAMSKYIALLNEVDASWEDKEQEEINWDESQESGSKENEGQTKGWVN 240
                      +  AM KYI LLN++D  W DK    +               +T+GWV+
Sbjct: 355 -----------SNLAMEKYIKLLNDIDPEWNDKPVSNV---------------KTQGWVH 388

Query: 241 VSSMINDESQLDDNEKNIYEWAKEGKLDMLVKQLTKLKDFNINQLDENGLNCLHWACDRG 300
            S M N++  +++++K +++W KEG LD  VK LT   +  IN+LDE+GL  LHWA DRG
Sbjct: 389 HSCMENNDEVIEESKKTVFDWVKEGNLDK-VKALTSNINLEINKLDESGLGLLHWASDRG 447

Query: 301 HLKVVQHLIEKCGADVNVTDSDGDYGLDYAKAIEHTDLIEYLVNSGS 347
           ++ VV++L+E+  ADVN+ D  G   L +A   E+ D+  YL+ SG+
Sbjct: 448 NINVVKYLVEELKADVNLRDGTGQTPLHFAVICEYDDVANYLIESGA 494




Source: Pediculus humanus corporis

Species: Pediculus humanus

Genus: Pediculus

Family: Pediculidae

Order: Phthiraptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|350406915|ref|XP_003487922.1| PREDICTED: acyl-CoA-binding domain-containing protein 6-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|340721725|ref|XP_003399266.1| PREDICTED: acyl-CoA-binding domain-containing protein 6-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|383857939|ref|XP_003704461.1| PREDICTED: uncharacterized protein LOC100882258 [Megachile rotundata] Back     alignment and taxonomy information
>gi|380028990|ref|XP_003698166.1| PREDICTED: putative ankyrin repeat protein FPV014-like [Apis florea] Back     alignment and taxonomy information
>gi|307174126|gb|EFN64784.1| Acyl-CoA-binding domain-containing protein 6 [Camponotus floridanus] Back     alignment and taxonomy information
>gi|307195671|gb|EFN77513.1| Acyl-CoA-binding domain-containing protein 6 [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|332031342|gb|EGI70855.1| Acyl-CoA-binding domain-containing protein 6 [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|322797576|gb|EFZ19620.1| hypothetical protein SINV_80899 [Solenopsis invicta] Back     alignment and taxonomy information
>gi|260795083|ref|XP_002592536.1| hypothetical protein BRAFLDRAFT_69053 [Branchiostoma floridae] gi|229277756|gb|EEN48547.1| hypothetical protein BRAFLDRAFT_69053 [Branchiostoma floridae] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query347
DICTYBASE|DDB_G0290237288 acbd6 "acyl-CoA-binding domain 0.700 0.843 0.314 2.4e-28
UNIPROTKB|F1PLQ8282 ACBD6 "Uncharacterized protein 0.628 0.773 0.303 5.5e-22
RGD|1305030282 Acbd6 "acyl-CoA binding domain 0.449 0.553 0.36 7e-22
UNIPROTKB|A2VDR2282 ACBD6 "Acyl-CoA-binding domain 0.449 0.553 0.348 1.9e-21
UNIPROTKB|E1C483268 ACBD6 "Uncharacterized protein 0.449 0.582 0.348 3e-21
UNIPROTKB|Q9BR61282 ACBD6 "Acyl-CoA-binding domain 0.449 0.553 0.342 3.9e-21
UNIPROTKB|F1S683282 ACBD6 "Uncharacterized protein 0.668 0.822 0.285 1e-20
MGI|MGI:1919732282 Acbd6 "acyl-Coenzyme A binding 0.449 0.553 0.354 2.7e-20
FB|FBgn006411790 CG33714 [Drosophila melanogast 0.227 0.877 0.506 4.4e-20
UNIPROTKB|G3N0L6221 ACBD6 "Acyl-CoA-binding domain 0.270 0.425 0.382 2.6e-19
DICTYBASE|DDB_G0290237 acbd6 "acyl-CoA-binding domain-containing protein 6" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
 Score = 316 (116.3 bits), Expect = 2.4e-28, P = 2.4e-28
 Identities = 83/264 (31%), Positives = 145/264 (54%)

Query:    94 MEDRFNQACDYLPSLVKKLDS---STLLKFYALYKQATVGQCNIDKPSWYNMEAKSKYNA 150
             +E++F  A DY+ +   KL +      L  Y  YKQAT+G CN   P +Y+   KSK+N+
Sbjct:     6 IENKFKLAVDYITNNSGKLSNIKNEEQLYLYCNYKQATIGDCNTKAPPFYDYIGKSKWNS 65

Query:   151 WNSLGQMAKSEAMSKYIALLKEVDAGWEDKEQEEINWDWKPNQKAMSKYIALLNEVDASW 210
             WNSL  + K  AM+ YI+L+  +  GW+   + E     +  Q           E++   
Sbjct:    66 WNSLKGVEKIVAMNSYISLVNALSPGWDSNIKVE-----RATQSVFLNDEEF-KELEKK- 118

Query:   211 EDKEQEEINWDESQESGSKENEGQTKGWVN--VS--SMINDES--QLDDNEK-NIYEWAK 263
             E +E+EE+   E +E+G +  + ++K W+   +S  S+++DE+  +L+ N K ++  W  
Sbjct:   119 EKEEKEELKKLE-EENGGEIEKPKSK-WMGPVLSKFSLVDDETLEKLEKNTKQDLGYWVS 176

Query:   264 EGKLDMLVKQLTKLKDFNINQLDENGLNCLHWACDRGHLKVVQHLIEKCGADVNVTDSDG 323
                ++ + K++   K+  IN++DE+G   L WACDRG+ ++ + LIE  G++VNV D +G
Sbjct:   177 VNDIERVKKEIENDKNI-INEVDEDGRTALIWACDRGYFEIAKLLIEN-GSNVNVQDGEG 234

Query:   324 DYGLDYAKAIEHTDLIEYLVNSGS 347
                L YA   +  ++ + L++  S
Sbjct:   235 MTPLHYAVVCDQFEICKLLLSQSS 258




GO:0000062 "fatty-acyl-CoA binding" evidence=IEA
GO:0008289 "lipid binding" evidence=IEA
GO:0005737 "cytoplasm" evidence=IEA
UNIPROTKB|F1PLQ8 ACBD6 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
RGD|1305030 Acbd6 "acyl-CoA binding domain containing 6" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|A2VDR2 ACBD6 "Acyl-CoA-binding domain-containing protein 6" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|E1C483 ACBD6 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|Q9BR61 ACBD6 "Acyl-CoA-binding domain-containing protein 6" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1S683 ACBD6 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
MGI|MGI:1919732 Acbd6 "acyl-Coenzyme A binding domain containing 6" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
FB|FBgn0064117 CG33714 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|G3N0L6 ACBD6 "Acyl-CoA-binding domain-containing protein 6" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q5RJK8ACBD6_RATNo assigned EC number0.32150.60230.7411yesN/A
Q54GC8ACBD6_DICDINo assigned EC number0.30180.69740.8402yesN/A
A2VDR2ACBD6_BOVINNo assigned EC number0.31510.60800.7482yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query347
cd1224273 cd12242, RRM_SLIRP, RNA recognition motif found in 2e-27
pfam0088787 pfam00887, ACBP, Acyl CoA binding protein 2e-25
cd1233075 cd12330, RRM2_Hrp1p, RNA recognition motif 2 in ye 7e-22
cd0043585 cd00435, ACBP, Acyl CoA binding protein (ACBP) bin 1e-21
smart0036073 smart00360, RRM, RNA recognition motif 1e-21
cd1232572 cd12325, RRM1_hnRNPA_hnRNPD_like, RNA recognition 1e-20
cd1238476 cd12384, RRM_RBM24_RBM38_like, RNA recognition mot 5e-19
cd1232780 cd12327, RRM2_DAZAP1, RNA recognition motif 2 in D 7e-19
cd1239978 cd12399, RRM_HP0827_like, RNA recognition motif in 7e-19
pfam0007670 pfam00076, RRM_1, RNA recognition motif 3e-18
cd1232374 cd12323, RRM2_MSI, RNA recognition motif 2 in RNA- 1e-17
cd1257482 cd12574, RRM1_DAZAP1, RNA recognition motif 1 in D 8e-17
cd1232873 cd12328, RRM2_hnRNPA_like, RNA recognition motif 2 2e-16
cd1241280 cd12412, RRM_DAZL_BOULE, RNA recognition motif in 2e-16
cd0059072 cd00590, RRM_SF, RNA recognition motif (RRM) super 2e-16
cd1239573 cd12395, RRM2_RBM34, RNA recognition motif 2 in RN 7e-16
cd1257675 cd12576, RRM1_MSI, RNA recognition motif 1 in RNA- 1e-15
cd1275775 cd12757, RRM1_hnRNPAB, RNA recognition motif 1 in 2e-15
COG428187 COG4281, ACB, Acyl-CoA-binding protein [Lipid meta 2e-15
cd1232679 cd12326, RRM1_hnRNPA0, RNA recognition motif 1 fou 3e-15
cd1232975 cd12329, RRM2_hnRNPD_like, RNA recognition motif 2 4e-15
cd1257574 cd12575, RRM1_hnRNPD_like, RNA recognition motif 1 7e-15
cd1238280 cd12382, RRM_RBMX_like, RNA recognition motif in h 7e-15
PTZ0045890 PTZ00458, PTZ00458, acyl CoA binding protein; Prov 1e-14
cd1257776 cd12577, RRM1_Hrp1p, RNA recognition motif 1 in ye 2e-14
cd1257878 cd12578, RRM1_hnRNPA_like, RNA recognition motif 1 2e-14
cd1232177 cd12321, RRM1_TDP43, RNA recognition motif 1 in TA 2e-14
cd1241582 cd12415, RRM3_RBM28_like, RNA recognition motif 3 3e-14
cd1239875 cd12398, RRM_CSTF2_RNA15_like, RNA recognition mot 3e-14
cd1276076 cd12760, RRM1_MSI2, RNA recognition motif 1 in RNA 7e-14
cd1231674 cd12316, RRM3_RBM19_RRM2_MRD1, RNA recognition mot 8e-14
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 8e-14
cd1241379 cd12413, RRM1_RBM28_like, RNA recognition motif 1 9e-14
cd1236273 cd12362, RRM3_CELF1-6, RNA recognition motif 3 in 1e-13
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 2e-13
cd1275674 cd12756, RRM1_hnRNPD, RNA recognition motif 1 in h 2e-13
cd1275876 cd12758, RRM1_hnRPDL, RNA recognition motif 1 in h 2e-13
cd1275977 cd12759, RRM1_MSI1, RNA recognition motif 1 in RNA 4e-13
cd1244776 cd12447, RRM1_gar2, RNA recognition motif 1 in yea 1e-12
cd1257980 cd12579, RRM2_hnRNPA0, RNA recognition motif 2 in 1e-12
cd1238080 cd12380, RRM3_I_PABPs, RNA recognition motif 3 fou 2e-12
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 3e-12
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 3e-12
cd1265279 cd12652, RRM2_Hu, RNA recognition motif 2 in the H 3e-12
cd1236177 cd12361, RRM1_2_CELF1-6_like, RNA recognition moti 3e-12
cd1267381 cd12673, RRM_BOULE, RNA recognition motif in prote 5e-12
cd1256679 cd12566, RRM2_MRD1, RNA recognition motif 2 in yea 8e-12
PLN03134144 PLN03134, PLN03134, glycine-rich RNA-binding prote 8e-12
COG0724306 COG0724, COG0724, RNA-binding proteins (RRM domain 9e-12
pfam1425969 pfam14259, RRM_6, RNA recognition motif (a 9e-12
cd1239172 cd12391, RRM1_SART3, RNA recognition motif 1 in sq 1e-11
cd1257274 cd12572, RRM2_MSI1, RNA recognition motif 2 in RNA 2e-11
cd1256779 cd12567, RRM3_RBM19, RNA recognition motif 3 in RN 2e-11
cd1276181 cd12761, RRM1_hnRNPA1, RNA recognition motif 1 in 2e-11
cd1245077 cd12450, RRM1_NUCLs, RNA recognition motif 1 found 2e-11
cd1263287 cd12632, RRM1_CELF3_4_5_6, RNA recognition motif 1 4e-11
cd1257379 cd12573, RRM2_MSI2, RNA recognition motif 2 in RNA 5e-11
cd1244873 cd12448, RRM2_gar2, RNA recognition motif 2 in yea 6e-11
cd1234580 cd12345, RRM2_SECp43_like, RNA recognition motif 2 7e-11
cd1276281 cd12762, RRM1_hnRNPA2B1, RNA recognition motif 1 i 9e-11
cd1265179 cd12651, RRM2_SXL, RNA recognition motif 2 in Dros 1e-10
cd1232271 cd12322, RRM2_TDP43, RNA recognition motif 2 in TA 1e-10
cd1244980 cd12449, RRM_CIRBP_RBM3, RNA recognition motif in 1e-10
cd12676107 cd12676, RRM3_Nop4p, RNA recognition motif 3 in ye 1e-10
cd1230673 cd12306, RRM_II_PABPs, RNA recognition motif in ty 1e-10
cd1222981 cd12229, RRM_G3BP, RNA recognition motif (RRM) in 1e-10
cd1232076 cd12320, RRM6_RBM19_RRM5_MRD1, RNA recognition mot 1e-10
cd1276381 cd12763, RRM1_hnRNPA3, RNA recognition motif 1 in 2e-10
cd1238179 cd12381, RRM4_I_PABPs, RNA recognition motif 4 in 2e-10
cd1258077 cd12580, RRM2_hnRNPA1, RNA recognition motif 2 in 2e-10
cd1238772 cd12387, RRM3_hnRNPM_like, RNA recognition motif 3 3e-10
cd1237679 cd12376, RRM2_Hu_like, RNA recognition motif 2 in 3e-10
cd1267175 cd12671, RRM_CSTF2_CSTF2T, RNA recognition motif i 4e-10
cd1277590 cd12775, RRM2_HuB, RNA recognition motif 2 in vert 4e-10
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 5e-10
cd1230774 cd12307, RRM_NIFK_like, RNA recognition motif in n 5e-10
TIGR01628562 TIGR01628, PABP-1234, polyadenylate binding protei 6e-10
cd1255277 cd12552, RRM_Nop15p, RNA recognition motif in yeas 7e-10
cd1236378 cd12363, RRM_TRA2, RNA recognition motif in transf 8e-10
cd1235375 cd12353, RRM2_TIA1_like, RNA recognition motif 2 i 8e-10
cd1235580 cd12355, RRM_RBM18, RNA recognition motif in eukar 9e-10
TIGR01628562 TIGR01628, PABP-1234, polyadenylate binding protei 1e-09
cd1267282 cd12672, RRM_DAZL, RNA recognition motif in verteb 1e-09
cd1258180 cd12581, RRM2_hnRNPA2B1, RNA recognition motif 2 i 1e-09
cd1228473 cd12284, RRM2_RBM23_RBM39, RNA recognition motif 2 1e-09
cd1238977 cd12389, RRM2_RAVER, RNA recognition motif 2 in ri 1e-09
cd1261975 cd12619, RRM2_PUB1, RNA recognition motif 2 in yea 1e-09
cd1240877 cd12408, RRM_eIF3G_like, RNA recognition motif in 1e-09
cd1240074 cd12400, RRM_Nop6, RNA recognition motif in Saccha 1e-09
cd1227272 cd12272, RRM2_PHIP1, RNA recognition motif 2 in Ar 1e-09
cd1229080 cd12290, RRM1_LARP7, RNA recognition motif 1 in La 2e-09
cd1229878 cd12298, RRM3_Prp24, RNA recognition motif 3 in fu 2e-09
cd1231173 cd12311, RRM_SRSF2_SRSF8, RNA recognition motif in 2e-09
cd1258280 cd12582, RRM2_hnRNPA3, RNA recognition motif 2 in 2e-09
cd1237778 cd12377, RRM3_Hu, RNA recognition motif 3 in the H 2e-09
cd1238383 cd12383, RRM_RBM42, RNA recognition motif in RNA-b 2e-09
cd1267479 cd12674, RRM1_Nop4p, RNA recognition motif 1 in ye 2e-09
cd1277481 cd12774, RRM2_HuD, RNA recognition motif 2 in vert 2e-09
cd1228373 cd12283, RRM1_RBM39_like, RNA recognition motif 1 3e-09
cd1263184 cd12631, RRM1_CELF1_2_Bruno, RNA recognition motif 4e-09
cd1239378 cd12393, RRM_ZCRB1, RNA recognition motif in Zinc 4e-09
cd1256476 cd12564, RRM1_RBM19, RNA recognition motif 1 in RN 4e-09
cd1240776 cd12407, RRM_FOX1_like, RNA recognition motif in v 4e-09
cd1277384 cd12773, RRM2_HuR, RNA recognition motif 2 in vert 6e-09
cd1277681 cd12776, RRM2_HuC, RNA recognition motif 2 in vert 6e-09
cd1237880 cd12378, RRM1_I_PABPs, RNA recognition motif 1 in 8e-09
TIGR01661352 TIGR01661, ELAV_HUD_SF, ELAV/HuD family splicing f 8e-09
cd1239773 cd12397, RRM2_Nop13p_fungi, RNA recognition motif 8e-09
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 1e-08
cd1241189 cd12411, RRM_ist3_like, RNA recognition motif in i 1e-08
pfam1385756 pfam13857, Ank_5, Ankyrin repeats (many copies) 1e-08
cd1223177 cd12231, RRM2_U2AF65, RNA recognition motif 2 foun 1e-08
cd1237577 cd12375, RRM1_Hu_like, RNA recognition motif 1 in 1e-08
cd1224978 cd12249, RRM1_hnRNPR_like, RNA recognition motif 1 1e-08
cd1233583 cd12335, RRM2_SF3B4, RNA recognition motif 2 in sp 1e-08
cd1246380 cd12463, RRM_G3BP1, RNA recognition motif found in 2e-08
cd1258480 cd12584, RRM2_hnRNPAB, RNA recognition motif 2 in 2e-08
cd1258575 cd12585, RRM2_hnRPDL, RNA recognition motif 2 in h 2e-08
cd1263380 cd12633, RRM1_FCA, RNA recognition motif 1 in plan 2e-08
cd1237977 cd12379, RRM2_I_PABPs, RNA recognition motif 2 fou 2e-08
cd1227974 cd12279, RRM_TUT1, RNA recognition motif in speckl 3e-08
cd1246483 cd12464, RRM_G3BP2, RNA recognition motif in ras G 3e-08
cd1234366 cd12343, RRM1_2_CoAA_like, RNA recognition motif 1 4e-08
cd1231284 cd12312, RRM_SRSF10_SRSF12, RNA recognition motif 5e-08
cd1255177 cd12551, RRM_II_PABPN1L, RNA recognition motif in 5e-08
cd1233770 cd12337, RRM1_SRSF4_like, RNA recognition motif 1 5e-08
cd1260869 cd12608, RRM1_CoAA, RNA recognition motif 1 in ver 6e-08
cd1231882 cd12318, RRM5_RBM19_like, RNA recognition motif 5 7e-08
TIGR01659346 TIGR01659, sex-lethal, sex-lethal family splicing 7e-08
TIGR01622457 TIGR01622, SF-CC1, splicing factor, CC1-like famil 7e-08
cd1261780 cd12617, RRM2_TIAR, RNA recognition motif 2 in nuc 8e-08
cd1256576 cd12565, RRM1_MRD1, RNA recognition motif 1 in yea 8e-08
cd1223793 cd12237, RRM_snRNP35, RNA recognition motif found 9e-08
TIGR01622457 TIGR01622, SF-CC1, splicing factor, CC1-like famil 1e-07
cd1235473 cd12354, RRM3_TIA1_like, RNA recognition motif 2 i 1e-07
cd1233872 cd12338, RRM1_SRSF1_like, RNA recognition motif 1 1e-07
cd1255076 cd12550, RRM_II_PABPN1, RNA recognition motif in t 1e-07
cd1248379 cd12483, RRM1_hnRNPQ, RNA recognition motif 1 in v 2e-07
pfam0002333 pfam00023, Ank, Ankyrin repeat 2e-07
cd1239281 cd12392, RRM2_SART3, RNA recognition motif 2 in sq 2e-07
cd1264079 cd12640, RRM3_Bruno_like, RNA recognition motif 3 2e-07
cd1237177 cd12371, RRM2_PUF60, RNA recognition motif 2 in (U 2e-07
cd1241476 cd12414, RRM2_RBM28_like, RNA recognition motif 2 3e-07
cd1261880 cd12618, RRM2_TIA1, RNA recognition motif 2 in nuc 4e-07
cd1263681 cd12636, RRM2_Bruno_like, RNA recognition motif 2 4e-07
cd1239092 cd12390, RRM3_RAVER, RNA recognition motif 3 in ri 4e-07
cd1239491 cd12394, RRM1_RBM34, RNA recognition motif 1 in RN 4e-07
cd1227172 cd12271, RRM1_PHIP1, RNA recognition motif 1 in Ar 4e-07
cd1223691 cd12236, RRM_snRNP70, RNA recognition motif in U1 5e-07
cd1236774 cd12367, RRM2_RBM45, RNA recognition motif 2 in RN 5e-07
cd1263979 cd12639, RRM3_CELF3_4_5_6, RNA recognition motif 2 6e-07
cd1265078 cd12650, RRM1_Hu, RNA recognition motif 1 in the H 7e-07
TIGR01628 562 TIGR01628, PABP-1234, polyadenylate binding protei 1e-06
cd1237373 cd12373, RRM_SRSF3_like, RNA recognition motif in 1e-06
cd1257179 cd12571, RRM6_RBM19, RNA recognition motif 6 in RN 1e-06
cd1264981 cd12649, RRM1_SXL, RNA recognition motif 1 in Dros 1e-06
cd1257076 cd12570, RRM5_MRD1, RNA recognition motif 5 in yea 1e-06
cd1259872 cd12598, RRM1_SRSF9, RNA recognition motif 1 in ve 1e-06
cd1248279 cd12482, RRM1_hnRNPR, RNA recognition motif 1 in v 1e-06
cd1264677 cd12646, RRM_SRSF7, RNA recognition motif in verte 2e-06
cd1236573 cd12365, RRM_RNPS1, RNA recognition motif in RNA-b 2e-06
cd1264279 cd12642, RRM_TRA2A, RNA recognition motif in trans 2e-06
cd1234168 cd12341, RRM_hnRNPC_like, RNA recognition motif in 2e-06
cd1268075 cd12680, RRM_THOC4, RNA recognition motif in THO c 2e-06
cd1222678 cd12226, RRM_NOL8, RNA recognition motif in nucleo 2e-06
cd1258375 cd12583, RRM2_hnRNPD, RNA recognition motif 2 in h 3e-06
cd1261380 cd12613, RRM2_NGR1_NAM8_like, RNA recognition moti 3e-06
cd1259972 cd12599, RRM1_SF2_plant_like, RNA recognition moti 3e-06
cd1245480 cd12454, RRM2_RIM4_like, RNA recognition motif 2 i 3e-06
cd1276981 cd12769, RRM1_HuR, RNA recognition motif 1 in vert 4e-06
cd1234773 cd12347, RRM_PPIE, RNA recognition motif in cyclop 4e-06
cd1241774 cd12417, RRM_SAFB_like, RNA recognition motif in t 5e-06
cd1234481 cd12344, RRM1_SECp43_like, RNA recognition motif 1 5e-06
cd1259570 cd12595, RRM1_SRSF5, RNA recognition motif 1 in ve 5e-06
cd1245179 cd12451, RRM2_NUCLs, RNA recognition motif 2 in nu 6e-06
cd1263892 cd12638, RRM3_CELF1_2, RNA recognition motif 3 in 6e-06
cd1227371 cd12273, RRM1_NEFsp, RNA recognition motif 1 in ve 7e-06
cd1233271 cd12332, RRM1_p54nrb_like, RNA recognition motif 1 7e-06
cd1261282 cd12612, RRM2_SECp43, RNA recognition motif 2 in t 8e-06
cd1238674 cd12386, RRM2_hnRNPM_like, RNA recognition motif 2 8e-06
cd1258771 cd12587, RRM1_PSF, RNA recognition motif 1 in vert 9e-06
cd1224371 cd12243, RRM1_MSSP, RNA recognition motif 1 in the 9e-06
TIGR01642509 TIGR01642, U2AF_lg, U2 snRNP auxilliary factor, la 1e-05
cd1247280 cd12472, RRM1_RBMS3, RNA recognition motif 1 found 1e-05
COG0666235 COG0666, Arp, FOG: Ankyrin repeat [General functio 1e-05
cd1260667 cd12606, RRM1_RBM4, RNA recognition motif 1 in ver 1e-05
cd1258871 cd12588, RRM1_p54nrb, RNA recognition motif 1 in v 1e-05
cd1259375 cd12593, RRM_RBM11, RNA recognition motif in verte 1e-05
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 2e-05
cd1234672 cd12346, RRM3_NGR1_NAM8_like, RNA recognition moti 2e-05
cd1241875 cd12418, RRM_Aly_REF_like, RNA recognition motif i 2e-05
cd1259670 cd12596, RRM1_SRSF6, RNA recognition motif 1 in ve 2e-05
cd1267079 cd12670, RRM2_Nop12p_like, RNA recognition motif 2 2e-05
cd1222577 cd12225, RRM1_2_CID8_like, RNA recognition motif 1 2e-05
cd1277183 cd12771, RRM1_HuB, RNA recognition motif 1 in vert 2e-05
PHA03100 422 PHA03100, PHA03100, ankyrin repeat protein; Provis 2e-05
cd1248678 cd12486, RRM1_ACF, RNA recognition motif 1 found i 3e-05
smart0024830 smart00248, ANK, ankyrin repeats 3e-05
cd1264189 cd12641, RRM_TRA2B, RNA recognition motif in Trans 3e-05
cd1267583 cd12675, RRM2_Nop4p, RNA recognition motif 2 in ye 3e-05
pfam1360630 pfam13606, Ank_3, Ankyrin repeat 3e-05
cd1237076 cd12370, RRM1_PUF60, RNA recognition motif 1 in (U 3e-05
cd1240277 cd12402, RRM_eIF4B, RNA recognition motif in eukar 3e-05
cd1259474 cd12594, RRM1_SRSF4, RNA recognition motif 1 in ve 4e-05
cd1256181 cd12561, RRM1_RBM5_like, RNA recognition motif 1 i 5e-05
cd1264581 cd12645, RRM_SRSF3, RNA recognition motif in verte 5e-05
cd1223583 cd12235, RRM_PPIL4, RNA recognition motif in pepti 5e-05
cd1266277 cd12662, RRM3_MYEF2, RNA recognition motif 3 in ve 5e-05
TIGR01661352 TIGR01661, ELAV_HUD_SF, ELAV/HuD family splicing f 7e-05
cd1237276 cd12372, RRM_CFIm68_CFIm59, RNA recognition motif 7e-05
cd1231577 cd12315, RRM1_RBM19_MRD1, RNA recognition motif 1 7e-05
cd1265486 cd12654, RRM3_HuB, RNA recognition motif 3 in vert 7e-05
TIGR01661352 TIGR01661, ELAV_HUD_SF, ELAV/HuD family splicing f 8e-05
cd1265976 cd12659, RRM2_hnRNPM, RNA recognition motif 2 in v 9e-05
cd1245288 cd12452, RRM_ARP_like, RNA recognition motif in ye 9e-05
cd1247086 cd12470, RRM1_MSSP1, RNA recognition motif 1 in ve 9e-05
cd1247385 cd12473, RRM2_MSSP1, RNA recognition motif 2 found 9e-05
cd1277284 cd12772, RRM1_HuC, RNA recognition motif 1 in vert 9e-05
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 1e-04
COG0666235 COG0666, Arp, FOG: Ankyrin repeat [General functio 1e-04
cd1259180 cd12591, RRM2_p54nrb, RNA recognition motif 2 in v 1e-04
TIGR01648 578 TIGR01648, hnRNP-R-Q, heterogeneous nuclear ribonu 1e-04
cd1266677 cd12666, RRM2_RAVER2, RNA recognition motif 2 in v 1e-04
cd1232488 cd12324, RRM_RBM8, RNA recognition motif in RNA-bi 1e-04
cd1241698 cd12416, RRM4_RBM28_like, RNA recognition motif 4 1e-04
pfam1389356 pfam13893, RRM_5, RNA recognition motif 1e-04
cd1253685 cd12536, RRM1_RBM39, RNA recognition motif 1 in ve 2e-04
cd1277083 cd12770, RRM1_HuD, RNA recognition motif 1 in vert 2e-04
cd1231984 cd12319, RRM4_MRD1, RNA recognition motif 4 in yea 2e-04
TIGR01645612 TIGR01645, half-pint, poly-U binding splicing fact 2e-04
cd1247588 cd12475, RRM2_RBMS3, RNA recognition motif 2 found 2e-04
cd1258671 cd12586, RRM1_PSP1, RNA recognition motif 1 in ver 2e-04
cd1265384 cd12653, RRM3_HuR, RNA recognition motif 3 in vert 2e-04
cd1233675 cd12336, RRM_RBM7_like, RNA recognition motif in R 2e-04
cd1259773 cd12597, RRM1_SRSF1, RNA recognition motif 1 in se 2e-04
cd1233380 cd12333, RRM2_p54nrb_like, RNA recognition motif 2 2e-04
cd1235789 cd12357, RRM_PPARGC1A_like, RNA recognition motif 2e-04
cd1247486 cd12474, RRM2_MSSP2, RNA recognition motif 2 found 3e-04
PTZ00322 664 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fruct 3e-04
cd1240176 cd12401, RRM_eIF4H, RNA recognition motif in eukar 3e-04
cd1253785 cd12537, RRM1_RBM23, RNA recognition motif 1 in ve 3e-04
cd1260968 cd12609, RRM2_CoAA, RNA recognition motif 2 in ver 4e-04
cd1224177 cd12241, RRM_SF3B14, RNA recognition motif found i 4e-04
cd1263481 cd12634, RRM2_CELF1_2, RNA recognition motif 2 in 4e-04
cd1224479 cd12244, RRM2_MSSP, RNA recognition motif 2 in the 4e-04
cd1225172 cd12251, RRM3_hnRNPR_like, RNA recognition motif 3 4e-04
cd1225473 cd12254, RRM_hnRNPH_ESRPs_RBM12_like, RNA recognit 5e-04
cd1233474 cd12334, RRM1_SF3B4, RNA recognition motif 1 in sp 5e-04
cd1230575 cd12305, RRM_NELFE, RNA recognition motif in negat 5e-04
cd1242174 cd12421, RRM1_PTBP1_hnRNPL_like, RNA recognition m 5e-04
cd1260371 cd12603, RRM_hnRNPC, RNA recognition motif in vert 5e-04
cd1265585 cd12655, RRM3_HuC, RNA recognition motif 3 in vert 5e-04
cd1275385 cd12753, RRM1_RBM10, RNA recognition motif 1 in ve 6e-04
cd1248578 cd12485, RRM1_RBM47, RNA recognition motif 1 found 6e-04
cd1265686 cd12656, RRM3_HuD, RNA recognition motif 3 in vert 6e-04
cd1263780 cd12637, RRM2_FCA, RNA recognition motif 2 in plan 7e-04
cd1260476 cd12604, RRM_RALY, RNA recognition motif in verteb 8e-04
cd1266076 cd12660, RRM2_MYEF2, RNA recognition motif 2 in ve 9e-04
cd1244684 cd12446, RRM_RBM25, RNA recognition motif in eukar 0.001
cd1222474 cd12224, RRM_RBM22, RNA recognition motif (RRM) fo 0.001
cd1224678 cd12246, RRM1_U1A_like, RNA recognition motif 1 in 0.002
cd1240375 cd12403, RRM1_NCL, RNA recognition motif 1 in vert 0.002
cd1236681 cd12366, RRM1_RBM45, RNA recognition motif 1 in RN 0.002
cd1266177 cd12661, RRM3_hnRNPM, RNA recognition motif 3 in v 0.002
cd1248478 cd12484, RRM1_RBM46, RNA recognition motif 1 found 0.002
cd12444112 cd12444, RRM1_CPEBs, RNA recognition motif 1 in cy 0.002
cd1255984 cd12559, RRM_SRSF10, RNA recognition motif in seri 0.002
cd1230979 cd12309, RRM2_Spen, RNA recognition motif 2 in the 0.002
cd1267976 cd12679, RRM_SAFB1_SAFB2, RNA recognition motif in 0.002
cd1247175 cd12471, RRM1_MSSP2, RNA recognition motif 1 in ve 0.003
cd1266577 cd12665, RRM2_RAVER1, RNA recognition motif 2 foun 0.003
cd1245980 cd12459, RRM1_CID8_like, RNA recognition motif 1 i 0.003
cd1226777 cd12267, RRM_YRA1_MLO3, RNA recognition motif in y 0.004
cd1252378 cd12523, RRM2_MRN1, RNA recognition motif 2 of RNA 0.004
cd1260767 cd12607, RRM2_RBM4, RNA recognition motif 2 in ver 0.004
cd1235679 cd12356, RRM_PPARGC1B, RNA recognition motif in pe 0.004
>gnl|CDD|240688 cd12242, RRM_SLIRP, RNA recognition motif found in SRA stem-loop-interacting RNA-binding protein (SLIRP) and similar proteins Back     alignment and domain information
 Score =  102 bits (256), Expect = 2e-27
 Identities = 36/73 (49%), Positives = 56/73 (76%)

Query: 10 KIFVGNLPWTVSHNELKKFFSEYGQIMNASVMFDKNTGLSKGFGFVTFQNKEAVDKVFST 69
          K+FVGNLPWTV   ELK++FS++G++ + +V FDK TGLSKG+GFV+F +++ ++     
Sbjct: 1  KLFVGNLPWTVGSKELKEYFSQFGKVKSCNVPFDKETGLSKGYGFVSFSSRDGLENALQK 60

Query: 70 DSHVLEGSRLSIQ 82
            H+LEG++L +Q
Sbjct: 61 QKHILEGNKLQVQ 73


This subfamily corresponds to the RRM of SLIRP, a widely expressed small steroid receptor RNA activator (SRA) binding protein, which binds to STR7, a functional substructure of SRA. SLIRP is localized predominantly to the mitochondria and plays a key role in modulating several nuclear receptor (NR) pathways. It functions as a co-repressor to repress SRA-mediated nuclear receptor coactivation. It modulates SHARP- and SKIP-mediated co-regulation of NR activity. SLIRP contains an RNA recognition motif (RRM), also termed RBD (RNA binding domain) or RNP (ribonucleoprotein domain), which is required for SLIRP's corepression activities. . Length = 73

>gnl|CDD|216174 pfam00887, ACBP, Acyl CoA binding protein Back     alignment and domain information
>gnl|CDD|240776 cd12330, RRM2_Hrp1p, RNA recognition motif 2 in yeast nuclear polyadenylated RNA-binding protein 4 (Hrp1p or Nab4p) and similar proteins Back     alignment and domain information
>gnl|CDD|238248 cd00435, ACBP, Acyl CoA binding protein (ACBP) binds thiol esters of long fatty acids and coenzyme A in a one-to-one binding mode with high specificity and affinity Back     alignment and domain information
>gnl|CDD|214636 smart00360, RRM, RNA recognition motif Back     alignment and domain information
>gnl|CDD|240771 cd12325, RRM1_hnRNPA_hnRNPD_like, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein hnRNP A and hnRNP D subfamilies and similar proteins Back     alignment and domain information
>gnl|CDD|240830 cd12384, RRM_RBM24_RBM38_like, RNA recognition motif in eukaryotic RNA-binding protein RBM24, RBM38 and similar proteins Back     alignment and domain information
>gnl|CDD|240773 cd12327, RRM2_DAZAP1, RNA recognition motif 2 in Deleted in azoospermia-associated protein 1 (DAZAP1) and similar proteins Back     alignment and domain information
>gnl|CDD|240845 cd12399, RRM_HP0827_like, RNA recognition motif in Helicobacter pylori HP0827 protein and similar proteins Back     alignment and domain information
>gnl|CDD|215696 pfam00076, RRM_1, RNA recognition motif Back     alignment and domain information
>gnl|CDD|240769 cd12323, RRM2_MSI, RNA recognition motif 2 in RNA-binding protein Musashi homologs Musashi-1, Musashi-2 and similar proteins Back     alignment and domain information
>gnl|CDD|241018 cd12574, RRM1_DAZAP1, RNA recognition motif 1 in Deleted in azoospermia-associated protein 1 (DAZAP1) and similar proteins Back     alignment and domain information
>gnl|CDD|240774 cd12328, RRM2_hnRNPA_like, RNA recognition motif 2 in heterogeneous nuclear ribonucleoprotein A subfamily Back     alignment and domain information
>gnl|CDD|240858 cd12412, RRM_DAZL_BOULE, RNA recognition motif in AZoospermia (DAZ) autosomal homologs, DAZL (DAZ-like) and BOULE Back     alignment and domain information
>gnl|CDD|240668 cd00590, RRM_SF, RNA recognition motif (RRM) superfamily Back     alignment and domain information
>gnl|CDD|240841 cd12395, RRM2_RBM34, RNA recognition motif 2 in RNA-binding protein 34 (RBM34) and similar proteins Back     alignment and domain information
>gnl|CDD|241020 cd12576, RRM1_MSI, RNA recognition motif 1 in RNA-binding protein Musashi homolog Musashi-1, Musashi-2 and similar proteins Back     alignment and domain information
>gnl|CDD|241201 cd12757, RRM1_hnRNPAB, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein A/B (hnRNP A/B) and similar proteins Back     alignment and domain information
>gnl|CDD|226731 COG4281, ACB, Acyl-CoA-binding protein [Lipid metabolism] Back     alignment and domain information
>gnl|CDD|240772 cd12326, RRM1_hnRNPA0, RNA recognition motif 1 found in heterogeneous nuclear ribonucleoprotein A0 (hnRNP A0) and similar proteins Back     alignment and domain information
>gnl|CDD|240775 cd12329, RRM2_hnRNPD_like, RNA recognition motif 2 in heterogeneous nuclear ribonucleoprotein hnRNP D0, hnRNP A/B, hnRNP DL and similar proteins Back     alignment and domain information
>gnl|CDD|241019 cd12575, RRM1_hnRNPD_like, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein hnRNP D0, hnRNP A/B, hnRNP DL and similar proteins Back     alignment and domain information
>gnl|CDD|240828 cd12382, RRM_RBMX_like, RNA recognition motif in heterogeneous nuclear ribonucleoprotein G (hnRNP G), Y chromosome RNA recognition motif 1 (hRBMY), testis-specific heterogeneous nuclear ribonucleoprotein G-T (hnRNP G-T) and similar proteins Back     alignment and domain information
>gnl|CDD|185637 PTZ00458, PTZ00458, acyl CoA binding protein; Provisional Back     alignment and domain information
>gnl|CDD|241021 cd12577, RRM1_Hrp1p, RNA recognition motif 1 in yeast nuclear polyadenylated RNA-binding protein 4 (Hrp1p or Nab4p) and similar proteins Back     alignment and domain information
>gnl|CDD|241022 cd12578, RRM1_hnRNPA_like, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein A subfamily Back     alignment and domain information
>gnl|CDD|240767 cd12321, RRM1_TDP43, RNA recognition motif 1 in TAR DNA-binding protein 43 (TDP-43) and similar proteins Back     alignment and domain information
>gnl|CDD|240861 cd12415, RRM3_RBM28_like, RNA recognition motif 3 in RNA-binding protein 28 (RBM28) and similar proteins Back     alignment and domain information
>gnl|CDD|240844 cd12398, RRM_CSTF2_RNA15_like, RNA recognition motif in cleavage stimulation factor subunit 2 (CSTF2), yeast ortholog mRNA 3'-end-processing protein RNA15 and similar proteins Back     alignment and domain information
>gnl|CDD|241204 cd12760, RRM1_MSI2, RNA recognition motif 1 in RNA-binding protein Musashi homolog 2 (Musashi-2 ) and similar proteins Back     alignment and domain information
>gnl|CDD|240762 cd12316, RRM3_RBM19_RRM2_MRD1, RNA recognition motif 3 in RNA-binding protein 19 (RBM19) and RNA recognition motif 2 found in multiple RNA-binding domain-containing protein 1 (MRD1) Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|240859 cd12413, RRM1_RBM28_like, RNA recognition motif 1 in RNA-binding protein 28 (RBM28) and similar proteins Back     alignment and domain information
>gnl|CDD|240808 cd12362, RRM3_CELF1-6, RNA recognition motif 3 in CELF/Bruno-like family of RNA binding proteins CELF1, CELF2, CELF3, CELF4, CELF5, CELF6 and similar proteins Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|241200 cd12756, RRM1_hnRNPD, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein D0 (hnRNP D0) and similar proteins Back     alignment and domain information
>gnl|CDD|241202 cd12758, RRM1_hnRPDL, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein D-like (hnRNP D-like or hnRNP DL) and similar proteins Back     alignment and domain information
>gnl|CDD|241203 cd12759, RRM1_MSI1, RNA recognition motif 1 in RNA-binding protein Musashi homolog 1 (Musashi-1) and similar proteins Back     alignment and domain information
>gnl|CDD|240893 cd12447, RRM1_gar2, RNA recognition motif 1 in yeast protein gar2 and similar proteins Back     alignment and domain information
>gnl|CDD|241023 cd12579, RRM2_hnRNPA0, RNA recognition motif 2 in heterogeneous nuclear ribonucleoprotein A0 (hnRNP A0) and similar proteins Back     alignment and domain information
>gnl|CDD|240826 cd12380, RRM3_I_PABPs, RNA recognition motif 3 found in type I polyadenylate-binding proteins Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|241096 cd12652, RRM2_Hu, RNA recognition motif 2 in the Hu proteins family Back     alignment and domain information
>gnl|CDD|240807 cd12361, RRM1_2_CELF1-6_like, RNA recognition motif 1 and 2 in CELF/Bruno-like family of RNA binding proteins and plant flowering time control protein FCA Back     alignment and domain information
>gnl|CDD|241117 cd12673, RRM_BOULE, RNA recognition motif in protein BOULE Back     alignment and domain information
>gnl|CDD|241010 cd12566, RRM2_MRD1, RNA recognition motif 2 in yeast multiple RNA-binding domain-containing protein 1 (MRD1) and similar proteins Back     alignment and domain information
>gnl|CDD|178680 PLN03134, PLN03134, glycine-rich RNA-binding protein 4; Provisional Back     alignment and domain information
>gnl|CDD|223796 COG0724, COG0724, RNA-binding proteins (RRM domain) [General function prediction only] Back     alignment and domain information
>gnl|CDD|222631 pfam14259, RRM_6, RNA recognition motif (a Back     alignment and domain information
>gnl|CDD|240837 cd12391, RRM1_SART3, RNA recognition motif 1 in squamous cell carcinoma antigen recognized by T-cells 3 (SART3) and similar proteins Back     alignment and domain information
>gnl|CDD|241016 cd12572, RRM2_MSI1, RNA recognition motif 2 in RNA-binding protein Musashi homolog 1 (Musashi-1) and similar proteins Back     alignment and domain information
>gnl|CDD|241011 cd12567, RRM3_RBM19, RNA recognition motif 3 in RNA-binding protein 19 (RBM19) and similar proteins Back     alignment and domain information
>gnl|CDD|241205 cd12761, RRM1_hnRNPA1, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein A1 (hnRNP A1) and similar proteins Back     alignment and domain information
>gnl|CDD|240896 cd12450, RRM1_NUCLs, RNA recognition motif 1 found in nucleolin-like proteins mainly from plants Back     alignment and domain information
>gnl|CDD|241076 cd12632, RRM1_CELF3_4_5_6, RNA recognition motif 1 in CUGBP Elav-like family member CELF-3, CELF-4, CELF-5, CELF-6 and similar proteins Back     alignment and domain information
>gnl|CDD|241017 cd12573, RRM2_MSI2, RNA recognition motif 2 in RNA-binding protein Musashi homolog 2 (Musashi-2) and similar proteins Back     alignment and domain information
>gnl|CDD|240894 cd12448, RRM2_gar2, RNA recognition motif 2 in yeast protein gar2 and similar proteins Back     alignment and domain information
>gnl|CDD|240791 cd12345, RRM2_SECp43_like, RNA recognition motif 2 in tRNA selenocysteine-associated protein 1 (SECp43) and similar proteins Back     alignment and domain information
>gnl|CDD|241206 cd12762, RRM1_hnRNPA2B1, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein A2/B1 (hnRNP A2/B1) and similar proteins Back     alignment and domain information
>gnl|CDD|241095 cd12651, RRM2_SXL, RNA recognition motif 2 in Drosophila sex-lethal (SXL) and similar proteins Back     alignment and domain information
>gnl|CDD|240768 cd12322, RRM2_TDP43, RNA recognition motif 2 in TAR DNA-binding protein 43 (TDP-43) and similar proteins Back     alignment and domain information
>gnl|CDD|240895 cd12449, RRM_CIRBP_RBM3, RNA recognition motif in cold inducible RNA binding protein (CIRBP), RNA binding motif protein 3 (RBM3) and similar proteins Back     alignment and domain information
>gnl|CDD|241120 cd12676, RRM3_Nop4p, RNA recognition motif 3 in yeast nucleolar protein 4 (Nop4p) and similar proteins Back     alignment and domain information
>gnl|CDD|240752 cd12306, RRM_II_PABPs, RNA recognition motif in type II polyadenylate-binding proteins Back     alignment and domain information
>gnl|CDD|240675 cd12229, RRM_G3BP, RNA recognition motif (RRM) in ras GTPase-activating protein-binding protein G3BP1, G3BP2 and similar proteins Back     alignment and domain information
>gnl|CDD|240766 cd12320, RRM6_RBM19_RRM5_MRD1, RNA recognition motif 6 in RNA-binding protein 19 (RBM19 or RBD-1) and RNA recognition motif 5 in multiple RNA-binding domain-containing protein 1 (MRD1) Back     alignment and domain information
>gnl|CDD|241207 cd12763, RRM1_hnRNPA3, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein A3 (hnRNP A3) and similar proteins Back     alignment and domain information
>gnl|CDD|240827 cd12381, RRM4_I_PABPs, RNA recognition motif 4 in type I polyadenylate-binding proteins Back     alignment and domain information
>gnl|CDD|241024 cd12580, RRM2_hnRNPA1, RNA recognition motif 2 in heterogeneous nuclear ribonucleoprotein A1 (hnRNP A1) and similar proteins Back     alignment and domain information
>gnl|CDD|240833 cd12387, RRM3_hnRNPM_like, RNA recognition motif 3 in heterogeneous nuclear ribonucleoprotein M (hnRNP M) and similar proteins Back     alignment and domain information
>gnl|CDD|240822 cd12376, RRM2_Hu_like, RNA recognition motif 2 in the Hu proteins family, Drosophila sex-lethal (SXL), and similar proteins Back     alignment and domain information
>gnl|CDD|241115 cd12671, RRM_CSTF2_CSTF2T, RNA recognition motif in cleavage stimulation factor subunit 2 (CSTF2), cleavage stimulation factor subunit 2 tau variant (CSTF2T) and similar proteins Back     alignment and domain information
>gnl|CDD|241219 cd12775, RRM2_HuB, RNA recognition motif 2 in vertebrate Hu-antigen B (HuB) Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|240753 cd12307, RRM_NIFK_like, RNA recognition motif in nucleolar protein interacting with the FHA domain of pKI-67 (NIFK) and similar proteins Back     alignment and domain information
>gnl|CDD|130689 TIGR01628, PABP-1234, polyadenylate binding protein, human types 1, 2, 3, 4 family Back     alignment and domain information
>gnl|CDD|240996 cd12552, RRM_Nop15p, RNA recognition motif in yeast ribosome biogenesis protein 15 (Nop15p) and similar proteins Back     alignment and domain information
>gnl|CDD|240809 cd12363, RRM_TRA2, RNA recognition motif in transformer-2 protein homolog TRA2-alpha, TRA2-beta and similar proteins Back     alignment and domain information
>gnl|CDD|240799 cd12353, RRM2_TIA1_like, RNA recognition motif 2 in granule-associated RNA binding proteins p40-TIA-1 and TIAR Back     alignment and domain information
>gnl|CDD|240801 cd12355, RRM_RBM18, RNA recognition motif in eukaryotic RNA-binding protein 18 and similar proteins Back     alignment and domain information
>gnl|CDD|130689 TIGR01628, PABP-1234, polyadenylate binding protein, human types 1, 2, 3, 4 family Back     alignment and domain information
>gnl|CDD|241116 cd12672, RRM_DAZL, RNA recognition motif in vertebrate deleted in azoospermia-like (DAZL) proteins Back     alignment and domain information
>gnl|CDD|241025 cd12581, RRM2_hnRNPA2B1, RNA recognition motif 2 in heterogeneous nuclear ribonucleoprotein A2/B1 (hnRNP A2/B1) and similar proteins Back     alignment and domain information
>gnl|CDD|240730 cd12284, RRM2_RBM23_RBM39, RNA recognition motif 2 in vertebrate RNA-binding protein RBM23, RBM39 and similar proteins Back     alignment and domain information
>gnl|CDD|240835 cd12389, RRM2_RAVER, RNA recognition motif 2 in ribonucleoprotein PTB-binding raver-1, raver-2 and similar proteins Back     alignment and domain information
>gnl|CDD|241063 cd12619, RRM2_PUB1, RNA recognition motif 2 in yeast nuclear and cytoplasmic polyadenylated RNA-binding protein PUB1 and similar proteins Back     alignment and domain information
>gnl|CDD|240854 cd12408, RRM_eIF3G_like, RNA recognition motif in eukaryotic translation initiation factor 3 subunit G (eIF-3G) and similar proteins Back     alignment and domain information
>gnl|CDD|240846 cd12400, RRM_Nop6, RNA recognition motif in Saccharomyces cerevisiae nucleolar protein 6 (Nop6) and similar proteins Back     alignment and domain information
>gnl|CDD|240718 cd12272, RRM2_PHIP1, RNA recognition motif 2 in Arabidopsis thaliana phragmoplastin interacting protein 1 (PHIP1) and similar proteins Back     alignment and domain information
>gnl|CDD|240736 cd12290, RRM1_LARP7, RNA recognition motif 1 in La-related protein 7 (LARP7) and similar proteins Back     alignment and domain information
>gnl|CDD|240744 cd12298, RRM3_Prp24, RNA recognition motif 3 in fungal pre-messenger RNA splicing protein 24 (Prp24) and similar proteins Back     alignment and domain information
>gnl|CDD|240757 cd12311, RRM_SRSF2_SRSF8, RNA recognition motif in serine/arginine-rich splicing factor SRSF2, SRSF8 and similar proteins Back     alignment and domain information
>gnl|CDD|241026 cd12582, RRM2_hnRNPA3, RNA recognition motif 2 in heterogeneous nuclear ribonucleoprotein A3 (hnRNP A3) and similar proteins Back     alignment and domain information
>gnl|CDD|240823 cd12377, RRM3_Hu, RNA recognition motif 3 in the Hu proteins family Back     alignment and domain information
>gnl|CDD|240829 cd12383, RRM_RBM42, RNA recognition motif in RNA-binding protein 42 (RBM42) and similar proteins Back     alignment and domain information
>gnl|CDD|241118 cd12674, RRM1_Nop4p, RNA recognition motif 1 in yeast nucleolar protein 4 (Nop4p) and similar proteins Back     alignment and domain information
>gnl|CDD|241218 cd12774, RRM2_HuD, RNA recognition motif 2 in vertebrate Hu-antigen D (HuD) Back     alignment and domain information
>gnl|CDD|240729 cd12283, RRM1_RBM39_like, RNA recognition motif 1 in vertebrate RNA-binding protein 39 (RBM39) and similar proteins Back     alignment and domain information
>gnl|CDD|241075 cd12631, RRM1_CELF1_2_Bruno, RNA recognition motif 1 in CUGBP Elav-like family member CELF-1, CELF-2, Drosophila melanogaster Bruno protein and similar proteins Back     alignment and domain information
>gnl|CDD|240839 cd12393, RRM_ZCRB1, RNA recognition motif in Zinc finger CCHC-type and RNA-binding motif-containing protein 1 (ZCRB1) and similar proteins Back     alignment and domain information
>gnl|CDD|241008 cd12564, RRM1_RBM19, RNA recognition motif 1 in RNA-binding protein 19 (RBM19) and similar proteins Back     alignment and domain information
>gnl|CDD|240853 cd12407, RRM_FOX1_like, RNA recognition motif in vertebrate RNA binding protein fox-1 homologs and similar proteins Back     alignment and domain information
>gnl|CDD|241217 cd12773, RRM2_HuR, RNA recognition motif 2 in vertebrate Hu-antigen R (HuR) Back     alignment and domain information
>gnl|CDD|241220 cd12776, RRM2_HuC, RNA recognition motif 2 in vertebrate Hu-antigen C (HuC) Back     alignment and domain information
>gnl|CDD|240824 cd12378, RRM1_I_PABPs, RNA recognition motif 1 in type I polyadenylate-binding proteins Back     alignment and domain information
>gnl|CDD|233516 TIGR01661, ELAV_HUD_SF, ELAV/HuD family splicing factor Back     alignment and domain information
>gnl|CDD|240843 cd12397, RRM2_Nop13p_fungi, RNA recognition motif 2 in yeast nucleolar protein 13 (Nop13p) and similar proteins Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|240857 cd12411, RRM_ist3_like, RNA recognition motif in ist3 family Back     alignment and domain information
>gnl|CDD|206028 pfam13857, Ank_5, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|240677 cd12231, RRM2_U2AF65, RNA recognition motif 2 found in U2 large nuclear ribonucleoprotein auxiliary factor U2AF 65 kDa subunit (U2AF65) and similar proteins Back     alignment and domain information
>gnl|CDD|240821 cd12375, RRM1_Hu_like, RNA recognition motif 1 in the Hu proteins family, Drosophila sex-lethal (SXL), and similar proteins Back     alignment and domain information
>gnl|CDD|240695 cd12249, RRM1_hnRNPR_like, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein R (hnRNP R) and similar proteins Back     alignment and domain information
>gnl|CDD|240781 cd12335, RRM2_SF3B4, RNA recognition motif 2 in splicing factor 3B subunit 4 (SF3B4) and similar proteins Back     alignment and domain information
>gnl|CDD|240909 cd12463, RRM_G3BP1, RNA recognition motif found in ras GTPase-activating protein-binding protein 1 (G3BP1) and similar proteins Back     alignment and domain information
>gnl|CDD|241028 cd12584, RRM2_hnRNPAB, RNA recognition motif 2 in heterogeneous nuclear ribonucleoprotein A/B (hnRNP A/B) and similar proteins Back     alignment and domain information
>gnl|CDD|241029 cd12585, RRM2_hnRPDL, RNA recognition motif 2 in heterogeneous nuclear ribonucleoprotein D-like (hnRNP DL) and similar proteins Back     alignment and domain information
>gnl|CDD|241077 cd12633, RRM1_FCA, RNA recognition motif 1 in plant flowering time control protein FCA and similar proteins Back     alignment and domain information
>gnl|CDD|240825 cd12379, RRM2_I_PABPs, RNA recognition motif 2 found in type I polyadenylate-binding proteins Back     alignment and domain information
>gnl|CDD|240725 cd12279, RRM_TUT1, RNA recognition motif in speckle targeted PIP5K1A-regulated poly(A) polymerase (Star-PAP) and similar proteins Back     alignment and domain information
>gnl|CDD|240910 cd12464, RRM_G3BP2, RNA recognition motif in ras GTPase-activating protein-binding protein 2 (G3BP2) and similar proteins Back     alignment and domain information
>gnl|CDD|240789 cd12343, RRM1_2_CoAA_like, RNA recognition motif 1 and 2 in RRM-containing coactivator activator/modulator (CoAA) and similar proteins Back     alignment and domain information
>gnl|CDD|240758 cd12312, RRM_SRSF10_SRSF12, RNA recognition motif in serine/arginine-rich splicing factor SRSF10, SRSF12 and similar proteins Back     alignment and domain information
>gnl|CDD|240995 cd12551, RRM_II_PABPN1L, RNA recognition motif in vertebrate type II embryonic polyadenylate-binding protein 2 (ePABP-2) Back     alignment and domain information
>gnl|CDD|240783 cd12337, RRM1_SRSF4_like, RNA recognition motif 1 in serine/arginine-rich splicing factor 4 (SRSF4) and similar proteins Back     alignment and domain information
>gnl|CDD|241052 cd12608, RRM1_CoAA, RNA recognition motif 1 in vertebrate RRM-containing coactivator activator/modulator (CoAA) Back     alignment and domain information
>gnl|CDD|240764 cd12318, RRM5_RBM19_like, RNA recognition motif 5 in RNA-binding protein 19 (RBM19 or RBD-1) and similar proteins Back     alignment and domain information
>gnl|CDD|233515 TIGR01659, sex-lethal, sex-lethal family splicing factor Back     alignment and domain information
>gnl|CDD|233496 TIGR01622, SF-CC1, splicing factor, CC1-like family Back     alignment and domain information
>gnl|CDD|241061 cd12617, RRM2_TIAR, RNA recognition motif 2 in nucleolysin TIAR and similar proteins Back     alignment and domain information
>gnl|CDD|241009 cd12565, RRM1_MRD1, RNA recognition motif 1 in yeast multiple RNA-binding domain-containing protein 1 (MRD1) and similar proteins Back     alignment and domain information
>gnl|CDD|240683 cd12237, RRM_snRNP35, RNA recognition motif found in U11/U12 small nuclear ribonucleoprotein 35 kDa protein (U11/U12-35K) and similar proteins Back     alignment and domain information
>gnl|CDD|233496 TIGR01622, SF-CC1, splicing factor, CC1-like family Back     alignment and domain information
>gnl|CDD|240800 cd12354, RRM3_TIA1_like, RNA recognition motif 2 in granule-associated RNA binding proteins (p40-TIA-1 and TIAR), and yeast nuclear and cytoplasmic polyadenylated RNA-binding protein PUB1 Back     alignment and domain information
>gnl|CDD|240784 cd12338, RRM1_SRSF1_like, RNA recognition motif 1 in serine/arginine-rich splicing factor 1 (SRSF1) and similar proteins Back     alignment and domain information
>gnl|CDD|240994 cd12550, RRM_II_PABPN1, RNA recognition motif in type II polyadenylate-binding protein 2 (PABP-2) and similar proteins Back     alignment and domain information
>gnl|CDD|240927 cd12483, RRM1_hnRNPQ, RNA recognition motif 1 in vertebrate heterogeneous nuclear ribonucleoprotein Q (hnRNP Q) Back     alignment and domain information
>gnl|CDD|200936 pfam00023, Ank, Ankyrin repeat Back     alignment and domain information
>gnl|CDD|240838 cd12392, RRM2_SART3, RNA recognition motif 2 in squamous cell carcinoma antigen recognized by T-cells 3 (SART3) and similar proteins Back     alignment and domain information
>gnl|CDD|241084 cd12640, RRM3_Bruno_like, RNA recognition motif 3 in Drosophila melanogaster Bruno protein and similar proteins Back     alignment and domain information
>gnl|CDD|240817 cd12371, RRM2_PUF60, RNA recognition motif 2 in (U)-binding-splicing factor PUF60 and similar proteins Back     alignment and domain information
>gnl|CDD|240860 cd12414, RRM2_RBM28_like, RNA recognition motif 2 in RNA-binding protein 28 (RBM28) and similar proteins Back     alignment and domain information
>gnl|CDD|241062 cd12618, RRM2_TIA1, RNA recognition motif 2 in nucleolysin TIA-1 isoform p40 (p40-TIA-1) and similar proteins Back     alignment and domain information
>gnl|CDD|241080 cd12636, RRM2_Bruno_like, RNA recognition motif 2 in Drosophila melanogaster Bruno protein and similar proteins Back     alignment and domain information
>gnl|CDD|240836 cd12390, RRM3_RAVER, RNA recognition motif 3 in ribonucleoprotein PTB-binding raver-1, raver-2 and similar proteins Back     alignment and domain information
>gnl|CDD|240840 cd12394, RRM1_RBM34, RNA recognition motif 1 in RNA-binding protein 34 (RBM34) and similar proteins Back     alignment and domain information
>gnl|CDD|240717 cd12271, RRM1_PHIP1, RNA recognition motif 1 in Arabidopsis thaliana phragmoplastin interacting protein 1 (PHIP1) and similar proteins Back     alignment and domain information
>gnl|CDD|240682 cd12236, RRM_snRNP70, RNA recognition motif in U1 small nuclear ribonucleoprotein 70 kDa (U1-70K) and similar proteins Back     alignment and domain information
>gnl|CDD|240813 cd12367, RRM2_RBM45, RNA recognition motif 2 in RNA-binding protein 45 (RBM45) and similar proteins Back     alignment and domain information
>gnl|CDD|241083 cd12639, RRM3_CELF3_4_5_6, RNA recognition motif 2 in CUGBP Elav-like family member CELF-3, CELF-4, CELF-5, CELF-6 and similar proteins Back     alignment and domain information
>gnl|CDD|241094 cd12650, RRM1_Hu, RNA recognition motif 1 in the Hu proteins family Back     alignment and domain information
>gnl|CDD|130689 TIGR01628, PABP-1234, polyadenylate binding protein, human types 1, 2, 3, 4 family Back     alignment and domain information
>gnl|CDD|240819 cd12373, RRM_SRSF3_like, RNA recognition motif in serine/arginine-rich splicing factor 3 (SRSF3) and similar proteins Back     alignment and domain information
>gnl|CDD|241015 cd12571, RRM6_RBM19, RNA recognition motif 6 in RNA-binding protein 19 (RBM19) and similar proteins Back     alignment and domain information
>gnl|CDD|241093 cd12649, RRM1_SXL, RNA recognition motif 1 in Drosophila sex-lethal (SXL) and similar proteins Back     alignment and domain information
>gnl|CDD|241014 cd12570, RRM5_MRD1, RNA recognition motif 5 in yeast multiple RNA-binding domain-containing protein 1 (MRD1) and similar proteins Back     alignment and domain information
>gnl|CDD|241042 cd12598, RRM1_SRSF9, RNA recognition motif 1 in vertebrate serine/arginine-rich splicing factor 9 (SRSF9) Back     alignment and domain information
>gnl|CDD|240926 cd12482, RRM1_hnRNPR, RNA recognition motif 1 in vertebrate heterogeneous nuclear ribonucleoprotein R (hnRNP R) Back     alignment and domain information
>gnl|CDD|241090 cd12646, RRM_SRSF7, RNA recognition motif in vertebrate serine/arginine-rich splicing factor 7 (SRSF7) Back     alignment and domain information
>gnl|CDD|240811 cd12365, RRM_RNPS1, RNA recognition motif in RNA-binding protein with serine-rich domain 1 (RNPS1) and similar proteins Back     alignment and domain information
>gnl|CDD|241086 cd12642, RRM_TRA2A, RNA recognition motif in transformer-2 protein homolog alpha (TRA-2 alpha) and similar proteins Back     alignment and domain information
>gnl|CDD|240787 cd12341, RRM_hnRNPC_like, RNA recognition motif in heterogeneous nuclear ribonucleoprotein C (hnRNP C)-related proteins Back     alignment and domain information
>gnl|CDD|241124 cd12680, RRM_THOC4, RNA recognition motif in THO complex subunit 4 (THOC4) and similar proteins Back     alignment and domain information
>gnl|CDD|240672 cd12226, RRM_NOL8, RNA recognition motif in nucleolar protein 8 (NOL8) and similar proteins Back     alignment and domain information
>gnl|CDD|241027 cd12583, RRM2_hnRNPD, RNA recognition motif 2 in heterogeneous nuclear ribonucleoprotein D0 (hnRNP D0) and similar proteins Back     alignment and domain information
>gnl|CDD|241057 cd12613, RRM2_NGR1_NAM8_like, RNA recognition motif 2 in yeast negative growth regulatory protein NGR1, yeast protein NAM8 and similar proteins Back     alignment and domain information
>gnl|CDD|241043 cd12599, RRM1_SF2_plant_like, RNA recognition motif 1 in plant pre-mRNA-splicing factor SF2 and similar proteins Back     alignment and domain information
>gnl|CDD|240900 cd12454, RRM2_RIM4_like, RNA recognition motif 2 in yeast meiotic activator RIM4 and similar proteins Back     alignment and domain information
>gnl|CDD|241213 cd12769, RRM1_HuR, RNA recognition motif 1 in vertebrate Hu-antigen R (HuR) Back     alignment and domain information
>gnl|CDD|240793 cd12347, RRM_PPIE, RNA recognition motif in cyclophilin-33 (Cyp33) and similar proteins Back     alignment and domain information
>gnl|CDD|240863 cd12417, RRM_SAFB_like, RNA recognition motif in the scaffold attachment factor (SAFB) family Back     alignment and domain information
>gnl|CDD|240790 cd12344, RRM1_SECp43_like, RNA recognition motif 1 in tRNA selenocysteine-associated protein 1 (SECp43) and similar proteins Back     alignment and domain information
>gnl|CDD|241039 cd12595, RRM1_SRSF5, RNA recognition motif 1 in vertebrate serine/arginine-rich splicing factor 5 (SRSF5) Back     alignment and domain information
>gnl|CDD|240897 cd12451, RRM2_NUCLs, RNA recognition motif 2 in nucleolin-like proteins mainly from plants Back     alignment and domain information
>gnl|CDD|241082 cd12638, RRM3_CELF1_2, RNA recognition motif 3 in CUGBP Elav-like family member CELF-1, CELF-2 and similar proteins Back     alignment and domain information
>gnl|CDD|240719 cd12273, RRM1_NEFsp, RNA recognition motif 1 in vertebrate putative RNA exonuclease NEF-sp Back     alignment and domain information
>gnl|CDD|240778 cd12332, RRM1_p54nrb_like, RNA recognition motif 1 in the p54nrb/PSF/PSP1 family Back     alignment and domain information
>gnl|CDD|241056 cd12612, RRM2_SECp43, RNA recognition motif 2 in tRNA selenocysteine-associated protein 1 (SECp43) Back     alignment and domain information
>gnl|CDD|240832 cd12386, RRM2_hnRNPM_like, RNA recognition motif 2 in heterogeneous nuclear ribonucleoprotein M (hnRNP M) and similar proteins Back     alignment and domain information
>gnl|CDD|241031 cd12587, RRM1_PSF, RNA recognition motif 1 in vertebrate polypyrimidine tract-binding protein (PTB)-associated-splicing factor (PSF) Back     alignment and domain information
>gnl|CDD|240689 cd12243, RRM1_MSSP, RNA recognition motif 1 in the c-myc gene single-strand binding proteins (MSSP) family Back     alignment and domain information
>gnl|CDD|233503 TIGR01642, U2AF_lg, U2 snRNP auxilliary factor, large subunit, splicing factor Back     alignment and domain information
>gnl|CDD|240916 cd12472, RRM1_RBMS3, RNA recognition motif 1 found in vertebrate RNA-binding motif, single-stranded-interacting protein 3 (RBMS3) Back     alignment and domain information
>gnl|CDD|223738 COG0666, Arp, FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|241050 cd12606, RRM1_RBM4, RNA recognition motif 1 in vertebrate RNA-binding protein 4 (RBM4) Back     alignment and domain information
>gnl|CDD|241032 cd12588, RRM1_p54nrb, RNA recognition motif 1 in vertebrate 54 kDa nuclear RNA- and DNA-binding protein (p54nrb) Back     alignment and domain information
>gnl|CDD|241037 cd12593, RRM_RBM11, RNA recognition motif in vertebrate RNA-binding protein 11 (RBM11) Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|240792 cd12346, RRM3_NGR1_NAM8_like, RNA recognition motif 3 in yeast negative growth regulatory protein NGR1 (RBP1), yeast protein NAM8 and similar proteins Back     alignment and domain information
>gnl|CDD|240864 cd12418, RRM_Aly_REF_like, RNA recognition motif in the Aly/REF family Back     alignment and domain information
>gnl|CDD|241040 cd12596, RRM1_SRSF6, RNA recognition motif 1 in vertebrate serine/arginine-rich splicing factor 6 (SRSF6) Back     alignment and domain information
>gnl|CDD|241114 cd12670, RRM2_Nop12p_like, RNA recognition motif 2 in yeast nucleolar protein 12 (Nop12p) and similar proteins Back     alignment and domain information
>gnl|CDD|240671 cd12225, RRM1_2_CID8_like, RNA recognition motif 1 and 2 (RRM1, RRM2) in Arabidopsis thaliana CTC-interacting domain protein CID8, CID9, CID10, CID11, CID12, CID 13 and similar proteins Back     alignment and domain information
>gnl|CDD|241215 cd12771, RRM1_HuB, RNA recognition motif 1 in vertebrate Hu-antigen B (HuB) Back     alignment and domain information
>gnl|CDD|222984 PHA03100, PHA03100, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|240930 cd12486, RRM1_ACF, RNA recognition motif 1 found in vertebrate APOBEC-1 complementation factor (ACF) Back     alignment and domain information
>gnl|CDD|197603 smart00248, ANK, ankyrin repeats Back     alignment and domain information
>gnl|CDD|241085 cd12641, RRM_TRA2B, RNA recognition motif in Transformer-2 protein homolog beta (TRA-2 beta) and similar proteins Back     alignment and domain information
>gnl|CDD|241119 cd12675, RRM2_Nop4p, RNA recognition motif 2 in yeast nucleolar protein 4 (Nop4p) and similar proteins Back     alignment and domain information
>gnl|CDD|205784 pfam13606, Ank_3, Ankyrin repeat Back     alignment and domain information
>gnl|CDD|240816 cd12370, RRM1_PUF60, RNA recognition motif 1 in (U)-binding-splicing factor PUF60 and similar proteins Back     alignment and domain information
>gnl|CDD|240848 cd12402, RRM_eIF4B, RNA recognition motif in eukaryotic translation initiation factor 4B (eIF-4B) and similar proteins Back     alignment and domain information
>gnl|CDD|241038 cd12594, RRM1_SRSF4, RNA recognition motif 1 in vertebrate serine/arginine-rich splicing factor 4 (SRSF4) Back     alignment and domain information
>gnl|CDD|241005 cd12561, RRM1_RBM5_like, RNA recognition motif 1 in RNA-binding protein 5 (RBM5) and similar proteins Back     alignment and domain information
>gnl|CDD|241089 cd12645, RRM_SRSF3, RNA recognition motif in vertebrate serine/arginine-rich splicing factor 3 (SRSF3) Back     alignment and domain information
>gnl|CDD|240681 cd12235, RRM_PPIL4, RNA recognition motif in peptidyl-prolyl cis-trans isomerase-like 4 (PPIase) and similar proteins Back     alignment and domain information
>gnl|CDD|241106 cd12662, RRM3_MYEF2, RNA recognition motif 3 in vertebrate myelin expression factor 2 (MEF-2) Back     alignment and domain information
>gnl|CDD|233516 TIGR01661, ELAV_HUD_SF, ELAV/HuD family splicing factor Back     alignment and domain information
>gnl|CDD|240818 cd12372, RRM_CFIm68_CFIm59, RNA recognition motif of pre-mRNA cleavage factor Im 68 kDa subunit (CFIm68 or CPSF6), pre-mRNA cleavage factor Im 59 kDa subunit (CFIm59 or CPSF7), and similar proteins Back     alignment and domain information
>gnl|CDD|240761 cd12315, RRM1_RBM19_MRD1, RNA recognition motif 1 in RNA-binding protein 19 (RBM19), yeast multiple RNA-binding domain-containing protein 1 (MRD1) and similar proteins Back     alignment and domain information
>gnl|CDD|241098 cd12654, RRM3_HuB, RNA recognition motif 3 in vertebrate Hu-antigen B (HuB) Back     alignment and domain information
>gnl|CDD|233516 TIGR01661, ELAV_HUD_SF, ELAV/HuD family splicing factor Back     alignment and domain information
>gnl|CDD|241103 cd12659, RRM2_hnRNPM, RNA recognition motif 2 in vertebrate heterogeneous nuclear ribonucleoprotein M (hnRNP M) Back     alignment and domain information
>gnl|CDD|240898 cd12452, RRM_ARP_like, RNA recognition motif in yeast asparagine-rich protein (ARP) and similar proteins Back     alignment and domain information
>gnl|CDD|240914 cd12470, RRM1_MSSP1, RNA recognition motif 1 in vertebrate single-stranded DNA-binding protein MSSP-1 Back     alignment and domain information
>gnl|CDD|240917 cd12473, RRM2_MSSP1, RNA recognition motif 2 found in vertebrate single-stranded DNA-binding protein MSSP-1 Back     alignment and domain information
>gnl|CDD|241216 cd12772, RRM1_HuC, RNA recognition motif 1 in vertebrate Hu-antigen C (HuC) Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|223738 COG0666, Arp, FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|241035 cd12591, RRM2_p54nrb, RNA recognition motif 2 in vertebrate 54 kDa nuclear RNA- and DNA-binding protein (p54nrb) Back     alignment and domain information
>gnl|CDD|233507 TIGR01648, hnRNP-R-Q, heterogeneous nuclear ribonucleoprotein R, Q family Back     alignment and domain information
>gnl|CDD|241110 cd12666, RRM2_RAVER2, RNA recognition motif 2 in vertebrate ribonucleoprotein PTB-binding 2 (raver-2) Back     alignment and domain information
>gnl|CDD|240770 cd12324, RRM_RBM8, RNA recognition motif in RNA-binding protein RBM8A, RBM8B nd similar proteins Back     alignment and domain information
>gnl|CDD|240862 cd12416, RRM4_RBM28_like, RNA recognition motif 4 in RNA-binding protein 28 (RBM28) and similar proteins Back     alignment and domain information
>gnl|CDD|206064 pfam13893, RRM_5, RNA recognition motif Back     alignment and domain information
>gnl|CDD|240980 cd12536, RRM1_RBM39, RNA recognition motif 1 in vertebrate RNA-binding protein 39 (RBM39) Back     alignment and domain information
>gnl|CDD|241214 cd12770, RRM1_HuD, RNA recognition motif 1 in vertebrate Hu-antigen D (HuD) Back     alignment and domain information
>gnl|CDD|240765 cd12319, RRM4_MRD1, RNA recognition motif 4 in yeast multiple RNA-binding domain-containing protein 1 (MRD1) and similar proteins Back     alignment and domain information
>gnl|CDD|130706 TIGR01645, half-pint, poly-U binding splicing factor, half-pint family Back     alignment and domain information
>gnl|CDD|240919 cd12475, RRM2_RBMS3, RNA recognition motif 2 found in vertebrate RNA-binding motif, single-stranded-interacting protein 3 (RBMS3) Back     alignment and domain information
>gnl|CDD|241030 cd12586, RRM1_PSP1, RNA recognition motif 1 in vertebrate paraspeckle protein 1 (PSP1) Back     alignment and domain information
>gnl|CDD|241097 cd12653, RRM3_HuR, RNA recognition motif 3 in vertebrate Hu-antigen R (HuR) Back     alignment and domain information
>gnl|CDD|240782 cd12336, RRM_RBM7_like, RNA recognition motif in RNA-binding protein 7 (RBM7) and similar proteins Back     alignment and domain information
>gnl|CDD|241041 cd12597, RRM1_SRSF1, RNA recognition motif 1 in serine/arginine-rich splicing factor 1 (SRSF1) and similar proteins Back     alignment and domain information
>gnl|CDD|240779 cd12333, RRM2_p54nrb_like, RNA recognition motif 2 in the p54nrb/PSF/PSP1 family Back     alignment and domain information
>gnl|CDD|240803 cd12357, RRM_PPARGC1A_like, RNA recognition motif in the peroxisome proliferator-activated receptor gamma coactivator 1A (PGC-1alpha) family of regulated coactivators Back     alignment and domain information
>gnl|CDD|240918 cd12474, RRM2_MSSP2, RNA recognition motif 2 found in vertebrate single-stranded DNA-binding protein MSSP-2 Back     alignment and domain information
>gnl|CDD|140343 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>gnl|CDD|240847 cd12401, RRM_eIF4H, RNA recognition motif in eukaryotic translation initiation factor 4H (eIF-4H) and similar proteins Back     alignment and domain information
>gnl|CDD|240981 cd12537, RRM1_RBM23, RNA recognition motif 1 in vertebrate probable RNA-binding protein 23 (RBM23) Back     alignment and domain information
>gnl|CDD|241053 cd12609, RRM2_CoAA, RNA recognition motif 2 in vertebrate RRM-containing coactivator activator/modulator (CoAA) Back     alignment and domain information
>gnl|CDD|240687 cd12241, RRM_SF3B14, RNA recognition motif found in pre-mRNA branch site protein p14 (SF3B14) and similar proteins Back     alignment and domain information
>gnl|CDD|241078 cd12634, RRM2_CELF1_2, RNA recognition motif 2 in CUGBP Elav-like family member CELF-1, CELF-2 and similar proteins Back     alignment and domain information
>gnl|CDD|240690 cd12244, RRM2_MSSP, RNA recognition motif 2 in the c-myc gene single-strand binding proteins (MSSP) family Back     alignment and domain information
>gnl|CDD|240697 cd12251, RRM3_hnRNPR_like, RNA recognition motif 3 in heterogeneous nuclear ribonucleoprotein R (hnRNP R) and similar proteins Back     alignment and domain information
>gnl|CDD|240700 cd12254, RRM_hnRNPH_ESRPs_RBM12_like, RNA recognition motif found in heterogeneous nuclear ribonucleoprotein (hnRNP) H protein family, epithelial splicing regulatory proteins (ESRPs), Drosophila RNA-binding protein Fusilli, RNA-binding protein 12 (RBM12) and similar proteins Back     alignment and domain information
>gnl|CDD|240780 cd12334, RRM1_SF3B4, RNA recognition motif 1 in splicing factor 3B subunit 4 (SF3B4) and similar proteins Back     alignment and domain information
>gnl|CDD|240751 cd12305, RRM_NELFE, RNA recognition motif in negative elongation factor E (NELF-E) and similar proteins Back     alignment and domain information
>gnl|CDD|240867 cd12421, RRM1_PTBP1_hnRNPL_like, RNA recognition motif in polypyrimidine tract-binding protein 1 (PTB or hnRNP I), heterogeneous nuclear ribonucleoprotein L (hnRNP-L), and similar proteins Back     alignment and domain information
>gnl|CDD|241047 cd12603, RRM_hnRNPC, RNA recognition motif in vertebrate heterogeneous nuclear ribonucleoprotein C1/C2 (hnRNP C1/C2) Back     alignment and domain information
>gnl|CDD|241099 cd12655, RRM3_HuC, RNA recognition motif 3 in vertebrate Hu-antigen C (HuC) Back     alignment and domain information
>gnl|CDD|241197 cd12753, RRM1_RBM10, RNA recognition motif 1 in vertebrate RNA-binding protein 10 (RBM10) Back     alignment and domain information
>gnl|CDD|240929 cd12485, RRM1_RBM47, RNA recognition motif 1 found in vertebrate RNA-binding protein 47 (RBM47) Back     alignment and domain information
>gnl|CDD|241100 cd12656, RRM3_HuD, RNA recognition motif 3 in vertebrate Hu-antigen D (HuD) Back     alignment and domain information
>gnl|CDD|241081 cd12637, RRM2_FCA, RNA recognition motif 2 in plant flowering time control protein FCA and similar proteins Back     alignment and domain information
>gnl|CDD|241048 cd12604, RRM_RALY, RNA recognition motif in vertebrate RNA-binding protein Raly Back     alignment and domain information
>gnl|CDD|241104 cd12660, RRM2_MYEF2, RNA recognition motif 2 in vertebrate myelin expression factor 2 (MEF-2) Back     alignment and domain information
>gnl|CDD|240892 cd12446, RRM_RBM25, RNA recognition motif in eukaryotic RNA-binding protein 25 and similar proteins Back     alignment and domain information
>gnl|CDD|240670 cd12224, RRM_RBM22, RNA recognition motif (RRM) found in Pre-mRNA-splicing factor RBM22 and similar proteins Back     alignment and domain information
>gnl|CDD|240692 cd12246, RRM1_U1A_like, RNA recognition motif 1 in the U1A/U2B"/SNF protein family Back     alignment and domain information
>gnl|CDD|240849 cd12403, RRM1_NCL, RNA recognition motif 1 in vertebrate nucleolin Back     alignment and domain information
>gnl|CDD|240812 cd12366, RRM1_RBM45, RNA recognition motif 1 in RNA-binding protein 45 (RBM45) and similar proteins Back     alignment and domain information
>gnl|CDD|241105 cd12661, RRM3_hnRNPM, RNA recognition motif 3 in vertebrate heterogeneous nuclear ribonucleoprotein M (hnRNP M) Back     alignment and domain information
>gnl|CDD|240928 cd12484, RRM1_RBM46, RNA recognition motif 1 found in vertebrate RNA-binding protein 46 (RBM46) Back     alignment and domain information
>gnl|CDD|240890 cd12444, RRM1_CPEBs, RNA recognition motif 1 in cytoplasmic polyadenylation element-binding protein CPEB-1, CPEB-2, CPEB-3, CPEB-4 and similar protiens Back     alignment and domain information
>gnl|CDD|241003 cd12559, RRM_SRSF10, RNA recognition motif in serine/arginine-rich splicing factor 10 (SRSF10) and similar proteins Back     alignment and domain information
>gnl|CDD|240755 cd12309, RRM2_Spen, RNA recognition motif 2 in the Spen (split end) protein family Back     alignment and domain information
>gnl|CDD|241123 cd12679, RRM_SAFB1_SAFB2, RNA recognition motif in scaffold attachment factor B1 (SAFB1), scaffold attachment factor B2 (SAFB2), and similar proteins Back     alignment and domain information
>gnl|CDD|240915 cd12471, RRM1_MSSP2, RNA recognition motif 1 in vertebrate single-stranded DNA-binding protein MSSP-2 Back     alignment and domain information
>gnl|CDD|241109 cd12665, RRM2_RAVER1, RNA recognition motif 2 found in vertebrate ribonucleoprotein PTB-binding 1 (raver-1) Back     alignment and domain information
>gnl|CDD|240905 cd12459, RRM1_CID8_like, RNA recognition motif 1 in Arabidopsis thaliana CTC-interacting domain protein CID8, CID9, CID10, CID11, CID12, CID 13 and similar proteins Back     alignment and domain information
>gnl|CDD|240713 cd12267, RRM_YRA1_MLO3, RNA recognition motif in yeast RNA annealing protein YRA1 (Yra1p), yeast mRNA export protein mlo3 and similar proteins Back     alignment and domain information
>gnl|CDD|240967 cd12523, RRM2_MRN1, RNA recognition motif 2 of RNA-binding protein MRN1 and similar proteins Back     alignment and domain information
>gnl|CDD|241051 cd12607, RRM2_RBM4, RNA recognition motif 2 in vertebrate RNA-binding protein 4 (RBM4) Back     alignment and domain information
>gnl|CDD|240802 cd12356, RRM_PPARGC1B, RNA recognition motif in peroxisome proliferator-activated receptor gamma coactivator 1-beta (PGC-1-beta) and similar proteins Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 347
TIGR01659346 sex-lethal sex-lethal family splicing factor. This 99.89
TIGR01645 612 half-pint poly-U binding splicing factor, half-pin 99.86
PTZ0045890 acyl CoA binding protein; Provisional 99.86
TIGR01661352 ELAV_HUD_SF ELAV/HuD family splicing factor. These 99.85
KOG4412|consensus226 99.84
KOG4412|consensus226 99.83
TIGR01622457 SF-CC1 splicing factor, CC1-like family. A homolog 99.83
cd0043585 ACBP Acyl CoA binding protein (ACBP) binds thiol e 99.82
TIGR01628 562 PABP-1234 polyadenylate binding protein, human typ 99.81
KOG0131|consensus203 99.8
KOG0145|consensus360 99.79
KOG0817|consensus142 99.79
KOG0148|consensus321 99.78
KOG0144|consensus 510 99.77
KOG0117|consensus506 99.76
PF0088787 ACBP: Acyl CoA binding protein; InterPro: IPR00058 99.76
TIGR01661352 ELAV_HUD_SF ELAV/HuD family splicing factor. These 99.75
TIGR01648 578 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein 99.73
TIGR01628562 PABP-1234 polyadenylate binding protein, human typ 99.73
COG428187 ACB Acyl-CoA-binding protein [Lipid metabolism] 99.73
PHA02743166 Viral ankyrin protein; Provisional 99.72
PLN03134144 glycine-rich RNA-binding protein 4; Provisional 99.71
PF1279689 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR02 99.71
KOG0149|consensus247 99.7
KOG0509|consensus 600 99.69
KOG0508|consensus 615 99.68
KOG0512|consensus228 99.68
PHA02736154 Viral ankyrin protein; Provisional 99.68
TIGR01649 481 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor 99.68
PHA02791 284 ankyrin-like protein; Provisional 99.67
TIGR01642509 U2AF_lg U2 snRNP auxilliary factor, large subunit, 99.67
TIGR01642509 U2AF_lg U2 snRNP auxilliary factor, large subunit, 99.67
PHA02741169 hypothetical protein; Provisional 99.67
KOG0195|consensus 448 99.66
PHA02741169 hypothetical protein; Provisional 99.65
KOG0124|consensus544 99.65
KOG0512|consensus228 99.65
PHA02791284 ankyrin-like protein; Provisional 99.64
KOG0127|consensus 678 99.64
KOG4214|consensus117 99.64
TIGR01649481 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor 99.63
KOG0127|consensus 678 99.63
PHA02875 413 ankyrin repeat protein; Provisional 99.63
PHA02795 437 ankyrin-like protein; Provisional 99.62
PHA02878 477 ankyrin repeat protein; Provisional 99.62
PHA02874 434 ankyrin repeat protein; Provisional 99.61
PHA02859209 ankyrin repeat protein; Provisional 99.61
PHA02884 300 ankyrin repeat protein; Provisional 99.61
PHA02859209 ankyrin repeat protein; Provisional 99.61
KOG0117|consensus506 99.61
PF0007670 RRM_1: RNA recognition motif. (a.k.a. RRM, RBD, or 99.6
KOG0509|consensus 600 99.6
PLN03192 823 Voltage-dependent potassium channel; Provisional 99.6
PHA02743166 Viral ankyrin protein; Provisional 99.59
TIGR01648 578 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein 99.59
KOG4205|consensus311 99.59
KOG0502|consensus296 99.59
KOG0105|consensus241 99.58
PF1363754 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 99.58
PHA02875 413 ankyrin repeat protein; Provisional 99.58
PHA03095 471 ankyrin-like protein; Provisional 99.57
PHA02798 489 ankyrin-like protein; Provisional 99.57
TIGR01622457 SF-CC1 splicing factor, CC1-like family. A homolog 99.56
KOG0515|consensus 752 99.56
PF1385756 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 99.56
KOG0123|consensus369 99.56
PHA03095 471 ankyrin-like protein; Provisional 99.56
KOG0110|consensus725 99.56
PLN03120260 nucleic acid binding protein; Provisional 99.55
KOG0145|consensus360 99.55
KOG0121|consensus153 99.55
PHA02946 446 ankyin-like protein; Provisional 99.55
KOG0125|consensus376 99.55
KOG0109|consensus346 99.54
PHA03100 480 ankyrin repeat protein; Provisional 99.54
PF1425970 RRM_6: RNA recognition motif (a.k.a. RRM, RBD, or 99.54
PHA02946 446 ankyin-like protein; Provisional 99.54
PHA03100 480 ankyrin repeat protein; Provisional 99.53
KOG0123|consensus369 99.53
PHA02878 477 ankyrin repeat protein; Provisional 99.52
KOG0122|consensus270 99.52
PHA02884 300 ankyrin repeat protein; Provisional 99.52
KOG0510|consensus 929 99.51
PHA02874 434 ankyrin repeat protein; Provisional 99.51
KOG4177|consensus 1143 99.51
PHA02716 764 CPXV016; CPX019; EVM010; Provisional 99.5
KOG0113|consensus335 99.49
PHA02736154 Viral ankyrin protein; Provisional 99.49
PHA02989 494 ankyrin repeat protein; Provisional 99.49
KOG0126|consensus219 99.48
TIGR01645612 half-pint poly-U binding splicing factor, half-pin 99.48
PHA02716 764 CPXV016; CPX019; EVM010; Provisional 99.48
PLN03213 759 repressor of silencing 3; Provisional 99.48
KOG0510|consensus 929 99.47
KOG0514|consensus452 99.47
PLN03121243 nucleic acid binding protein; Provisional 99.47
PHA02876 682 ankyrin repeat protein; Provisional 99.46
PLN03192 823 Voltage-dependent potassium channel; Provisional 99.46
TIGR01659346 sex-lethal sex-lethal family splicing factor. This 99.46
KOG0514|consensus452 99.45
KOG4207|consensus256 99.45
COG0724306 RNA-binding proteins (RRM domain) [General functio 99.45
KOG4177|consensus 1143 99.44
PHA02917 661 ankyrin-like protein; Provisional 99.43
PHA02876 682 ankyrin repeat protein; Provisional 99.42
KOG0505|consensus 527 99.42
KOG0508|consensus 615 99.42
PHA02917 661 ankyrin-like protein; Provisional 99.41
PTZ00322 664 6-phosphofructo-2-kinase/fructose-2,6-biphosphatas 99.41
PHA02798 489 ankyrin-like protein; Provisional 99.41
PHA02989 494 ankyrin repeat protein; Provisional 99.41
PHA02795 437 ankyrin-like protein; Provisional 99.41
KOG0107|consensus195 99.4
KOG0147|consensus549 99.38
PHA02730 672 ankyrin-like protein; Provisional 99.38
PHA02730 672 ankyrin-like protein; Provisional 99.38
smart0036272 RRM_2 RNA recognition motif. 99.38
KOG4206|consensus221 99.37
KOG0505|consensus 527 99.36
cd00204126 ANK ankyrin repeats; ankyrin repeats mediate prote 99.36
KOG0111|consensus298 99.35
KOG0114|consensus124 99.35
smart0036071 RRM RNA recognition motif. 99.34
KOG1710|consensus 396 99.33
KOG0507|consensus 854 99.32
KOG0148|consensus321 99.28
PHA02792 631 ankyrin-like protein; Provisional 99.28
KOG0195|consensus 448 99.28
COG0666235 Arp FOG: Ankyrin repeat [General function predicti 99.27
KOG1710|consensus 396 99.27
KOG0108|consensus435 99.27
cd0059074 RRM RRM (RNA recognition motif), also known as RBD 99.26
PF1363754 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 99.26
KOG0130|consensus170 99.25
PF1279689 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR02 99.24
KOG4211|consensus 510 99.24
KOG0144|consensus510 99.23
COG0666235 Arp FOG: Ankyrin repeat [General function predicti 99.23
PHA02792 631 ankyrin-like protein; Provisional 99.22
TIGR00870 743 trp transient-receptor-potential calcium channel p 99.2
KOG0502|consensus296 99.2
KOG0515|consensus752 99.18
KOG4212|consensus 608 99.17
cd00204126 ANK ankyrin repeats; ankyrin repeats mediate prote 99.16
KOG4214|consensus117 99.16
TIGR00870 743 trp transient-receptor-potential calcium channel p 99.14
smart0036170 RRM_1 RNA recognition motif. 99.09
KOG0506|consensus622 99.07
KOG4205|consensus311 99.05
KOG3676|consensus 782 99.04
KOG1457|consensus284 99.02
KOG0131|consensus203 99.01
KOG0147|consensus549 98.99
KOG0705|consensus749 98.99
KOG0507|consensus 854 98.98
KOG0153|consensus377 98.98
KOG0146|consensus371 98.97
PF1389356 RRM_5: RNA recognition motif. (a.k.a. RRM, RBD, or 98.96
KOG0818|consensus 669 98.95
PF1360630 Ank_3: Ankyrin repeat 98.93
PF0002333 Ank: Ankyrin repeat Hereditary spherocytosis; Inte 98.9
KOG4208|consensus214 98.9
PF1385756 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 98.86
KOG3676|consensus 782 98.86
KOG0106|consensus216 98.85
KOG0124|consensus544 98.85
KOG0415|consensus479 98.84
KOG0783|consensus 1267 98.83
KOG0146|consensus371 98.83
KOG0109|consensus346 98.82
PTZ00322 664 6-phosphofructo-2-kinase/fructose-2,6-biphosphatas 98.8
KOG4661|consensus 940 98.76
KOG0116|consensus419 98.76
PF1360630 Ank_3: Ankyrin repeat 98.75
KOG0110|consensus725 98.72
KOG4454|consensus267 98.71
KOG0522|consensus 560 98.71
KOG4369|consensus 2131 98.68
KOG4212|consensus608 98.67
KOG1548|consensus382 98.66
KOG0783|consensus 1267 98.61
KOG4209|consensus231 98.59
PF0002333 Ank: Ankyrin repeat Hereditary spherocytosis; Inte 98.56
KOG0226|consensus290 98.56
KOG0132|consensus 894 98.55
KOG0129|consensus520 98.53
KOG0533|consensus243 98.52
KOG4369|consensus 2131 98.36
KOG2384|consensus 223 98.36
KOG0511|consensus 516 98.34
PF0405997 RRM_2: RNA recognition motif 2; InterPro: IPR00720 98.34
KOG0782|consensus1004 98.32
KOG0782|consensus1004 98.31
KOG0520|consensus 975 98.3
KOG0151|consensus 877 98.28
KOG0120|consensus500 98.25
KOG4660|consensus 549 98.22
KOG1190|consensus492 98.22
KOG0521|consensus785 98.18
KOG0128|consensus881 98.14
KOG1365|consensus508 98.14
KOG3609|consensus 822 98.1
KOG0520|consensus 975 97.92
KOG4210|consensus285 97.9
KOG1190|consensus492 97.88
KOG0129|consensus520 97.87
KOG4211|consensus510 97.87
KOG1995|consensus351 97.87
KOG0521|consensus785 97.73
KOG4210|consensus285 97.72
KOG0511|consensus 516 97.66
PF1160890 Limkain-b1: Limkain b1; InterPro: IPR024582 This e 97.59
KOG0112|consensus 975 97.59
KOG0705|consensus749 97.58
COG5175480 MOT2 Transcriptional repressor [Transcription] 97.54
KOG0120|consensus500 97.49
KOG1365|consensus 508 97.49
PF08777105 RRM_3: RNA binding motif; InterPro: IPR014886 This 97.45
KOG0506|consensus622 97.44
PF1460553 Nup35_RRM_2: Nup53/35/40-type RNA recognition moti 97.4
KOG2193|consensus 584 97.35
KOG1457|consensus284 97.3
KOG3878|consensus 469 97.29
PF05172100 Nup35_RRM: Nup53/35/40-type RNA recognition motif; 97.25
KOG4849|consensus498 97.22
KOG0818|consensus 669 97.2
smart0024830 ANK ankyrin repeats. Ankyrin repeats are about 33 97.17
KOG4676|consensus479 97.12
PLN03134144 glycine-rich RNA-binding protein 4; Provisional 97.06
KOG0522|consensus 560 97.05
smart0024830 ANK ankyrin repeats. Ankyrin repeats are about 33 97.04
KOG3152|consensus278 97.02
KOG4206|consensus221 96.9
KOG0106|consensus216 96.87
KOG0149|consensus247 96.81
KOG2505|consensus 591 96.73
PF0007670 RRM_1: RNA recognition motif. (a.k.a. RRM, RBD, or 96.72
KOG4307|consensus944 96.68
KOG0121|consensus153 96.25
PF08952146 DUF1866: Domain of unknown function (DUF1866) ; In 96.19
KOG2384|consensus 223 96.17
KOG0126|consensus219 96.11
KOG1456|consensus494 96.11
KOG0122|consensus270 96.11
KOG0105|consensus241 96.1
KOG0128|consensus881 96.1
KOG1855|consensus484 96.04
KOG2314|consensus 698 96.01
PF0867587 RNA_bind: RNA binding domain; InterPro: IPR014789 95.89
KOG0114|consensus124 95.87
KOG1456|consensus 494 95.58
KOG0115|consensus275 95.42
KOG0112|consensus 975 95.4
KOG1548|consensus382 95.39
KOG3609|consensus 822 95.16
PLN03213 759 repressor of silencing 3; Provisional 95.11
PLN03120260 nucleic acid binding protein; Provisional 95.1
KOG2068|consensus327 95.09
KOG0125|consensus376 95.01
KOG4307|consensus 944 94.93
KOG1996|consensus378 94.8
smart0036272 RRM_2 RNA recognition motif. 94.69
KOG0113|consensus335 94.29
KOG0107|consensus195 94.27
PF03467176 Smg4_UPF3: Smg-4/UPF3 family; InterPro: IPR005120 94.19
PF06128284 Shigella_OspC: Shigella flexneri OspC protein; Int 94.16
KOG0226|consensus290 94.14
PLN03121243 nucleic acid binding protein; Provisional 94.12
PF1030962 DUF2414: Protein of unknown function (DUF2414); In 94.04
PF1425970 RRM_6: RNA recognition motif (a.k.a. RRM, RBD, or 93.86
cd0059074 RRM RRM (RNA recognition motif), also known as RBD 93.06
COG0724306 RNA-binding proteins (RRM domain) [General functio 92.92
smart0036071 RRM RNA recognition motif. 92.92
KOG2135|consensus526 92.65
KOG0130|consensus170 92.6
PF15023166 DUF4523: Protein of unknown function (DUF4523) 92.0
KOG4285|consensus350 91.89
KOG2202|consensus260 91.6
KOG4207|consensus256 89.98
PF1192976 DUF3447: Domain of unknown function (DUF3447); Int 89.94
PF07576110 BRAP2: BRCA1-associated protein 2; InterPro: IPR01 89.78
KOG0108|consensus 435 88.48
PF0729288 NID: Nmi/IFP 35 domain (NID); InterPro: IPR009909 88.25
KOG0533|consensus243 88.2
KOG0151|consensus 877 87.75
KOG2416|consensus718 87.21
KOG2505|consensus591 85.83
PF03158192 DUF249: Multigene family 530 protein; InterPro: IP 82.4
KOG0116|consensus419 82.12
KOG2591|consensus 684 80.55
>TIGR01659 sex-lethal sex-lethal family splicing factor Back     alignment and domain information
Probab=99.89  E-value=3.7e-23  Score=187.66  Aligned_cols=148  Identities=20%  Similarity=0.287  Sum_probs=124.1

Q ss_pred             ccCCCeEEEeCCCCCCCHHHHHHHHhccCCeeEEEEeeeCCCCCceeEEEEEEcCHHHHHHHHh-cCCCccCCccccccC
Q psy630            5 IRQLNKIFVGNLPWTVSHNELKKFFSEYGQIMNASVMFDKNTGLSKGFGFVTFQNKEAVDKVFS-TDSHVLEGSRLSIQP   83 (347)
Q Consensus         5 ~~~~~~l~V~nLp~~~t~~~l~~~f~~~G~i~~~~i~~~~~t~~~~g~afV~f~~~~~a~~a~~-~~~~~~~g~~l~v~~   83 (347)
                      ....++|||+|||+++|+++|+++|++||.|.+|+|++|+.|++++|||||+|.+.++|.+|++ +++..+.+++|+|.+
T Consensus       104 ~~~~~~LfVgnLp~~~te~~L~~lF~~~G~V~~v~i~~d~~tg~srGyaFVeF~~~e~A~~Ai~~LnG~~l~gr~i~V~~  183 (346)
T TIGR01659       104 NNSGTNLIVNYLPQDMTDRELYALFRTIGPINTCRIMRDYKTGYSFGYAFVDFGSEADSQRAIKNLNGITVRNKRLKVSY  183 (346)
T ss_pred             CCCCcEEEEeCCCCCCCHHHHHHHHHhcCCEEEEEEEecCCCCccCcEEEEEEccHHHHHHHHHHcCCCccCCceeeeec
Confidence            3456899999999999999999999999999999999999999999999999999999999997 499999999999998


Q ss_pred             CCcccccchhhhhhcccccccccCCcccccchhhHHHHhhccccceecccCCCCCccchhHHHHHHHHHHcCCCCHHHHH
Q psy630           84 SDSHNRMAENMEDRFNQACDYLPSLVKKLDSSTLLKFYALYKQATVGQCNIDKPSWYNMEAKSKYNAWNSLGQMAKSEAM  163 (347)
Q Consensus        84 ~~~~~~~~~~~~~~f~~~~~~v~~l~~~~~~e~l~~~f~~fg~v~~g~~~~~~p~~~~~~~~~K~~aw~~~~~~~~~eA~  163 (347)
                      +.+...       .....++||+|||..+++++|+++|+.||.|....+..++.     .++.|..||.+  ..+.++|.
T Consensus       184 a~p~~~-------~~~~~~lfV~nLp~~vtee~L~~~F~~fG~V~~v~i~~d~~-----tg~~kG~aFV~--F~~~e~A~  249 (346)
T TIGR01659       184 ARPGGE-------SIKDTNLYVTNLPRTITDDQLDTIFGKYGQIVQKNILRDKL-----TGTPRGVAFVR--FNKREEAQ  249 (346)
T ss_pred             cccccc-------ccccceeEEeCCCCcccHHHHHHHHHhcCCEEEEEEeecCC-----CCccceEEEEE--ECCHHHHH
Confidence            865432       12346799999999999999999999999998777765542     34455555554  45577777


Q ss_pred             HHH
Q psy630          164 SKY  166 (347)
Q Consensus       164 ~~y  166 (347)
                      ++.
T Consensus       250 ~Ai  252 (346)
T TIGR01659       250 EAI  252 (346)
T ss_pred             HHH
Confidence            663



This model describes the sex-lethal family of splicing factors found in Dipteran insects. The sex-lethal phenotype, however, may be limited to the Melanogasters and closely related species. In Drosophila the protein acts as an inhibitor of splicing. This subfamily is most closely related to the ELAV/HUD subfamily of splicing factors (TIGR01661).

>TIGR01645 half-pint poly-U binding splicing factor, half-pint family Back     alignment and domain information
>PTZ00458 acyl CoA binding protein; Provisional Back     alignment and domain information
>TIGR01661 ELAV_HUD_SF ELAV/HuD family splicing factor Back     alignment and domain information
>KOG4412|consensus Back     alignment and domain information
>KOG4412|consensus Back     alignment and domain information
>TIGR01622 SF-CC1 splicing factor, CC1-like family Back     alignment and domain information
>cd00435 ACBP Acyl CoA binding protein (ACBP) binds thiol esters of long fatty acids and coenzyme A in a one-to-one binding mode with high specificity and affinity Back     alignment and domain information
>TIGR01628 PABP-1234 polyadenylate binding protein, human types 1, 2, 3, 4 family Back     alignment and domain information
>KOG0131|consensus Back     alignment and domain information
>KOG0145|consensus Back     alignment and domain information
>KOG0817|consensus Back     alignment and domain information
>KOG0148|consensus Back     alignment and domain information
>KOG0144|consensus Back     alignment and domain information
>KOG0117|consensus Back     alignment and domain information
>PF00887 ACBP: Acyl CoA binding protein; InterPro: IPR000582 Acyl-CoA-binding protein (ACBP) is a small (10 Kd) protein that binds medium- and long-chain acyl-CoA esters with very high affinity and may function as an intracellular carrier of acyl-CoA esters [] Back     alignment and domain information
>TIGR01661 ELAV_HUD_SF ELAV/HuD family splicing factor Back     alignment and domain information
>TIGR01648 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein R, Q family Back     alignment and domain information
>TIGR01628 PABP-1234 polyadenylate binding protein, human types 1, 2, 3, 4 family Back     alignment and domain information
>COG4281 ACB Acyl-CoA-binding protein [Lipid metabolism] Back     alignment and domain information
>PHA02743 Viral ankyrin protein; Provisional Back     alignment and domain information
>PLN03134 glycine-rich RNA-binding protein 4; Provisional Back     alignment and domain information
>PF12796 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>KOG0149|consensus Back     alignment and domain information
>KOG0509|consensus Back     alignment and domain information
>KOG0508|consensus Back     alignment and domain information
>KOG0512|consensus Back     alignment and domain information
>PHA02736 Viral ankyrin protein; Provisional Back     alignment and domain information
>TIGR01649 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor family Back     alignment and domain information
>PHA02791 ankyrin-like protein; Provisional Back     alignment and domain information
>TIGR01642 U2AF_lg U2 snRNP auxilliary factor, large subunit, splicing factor Back     alignment and domain information
>TIGR01642 U2AF_lg U2 snRNP auxilliary factor, large subunit, splicing factor Back     alignment and domain information
>PHA02741 hypothetical protein; Provisional Back     alignment and domain information
>KOG0195|consensus Back     alignment and domain information
>PHA02741 hypothetical protein; Provisional Back     alignment and domain information
>KOG0124|consensus Back     alignment and domain information
>KOG0512|consensus Back     alignment and domain information
>PHA02791 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG0127|consensus Back     alignment and domain information
>KOG4214|consensus Back     alignment and domain information
>TIGR01649 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor family Back     alignment and domain information
>KOG0127|consensus Back     alignment and domain information
>PHA02875 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02795 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02878 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02874 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02859 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02884 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02859 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG0117|consensus Back     alignment and domain information
>PF00076 RRM_1: RNA recognition motif Back     alignment and domain information
>KOG0509|consensus Back     alignment and domain information
>PLN03192 Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>PHA02743 Viral ankyrin protein; Provisional Back     alignment and domain information
>TIGR01648 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein R, Q family Back     alignment and domain information
>KOG4205|consensus Back     alignment and domain information
>KOG0502|consensus Back     alignment and domain information
>KOG0105|consensus Back     alignment and domain information
>PF13637 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 3B7B_A 3F6Q_A 2KBX_A 3IXE_A 2DWZ_C 2DVW_A 3AJI_A 1S70_B 2HE0_A Back     alignment and domain information
>PHA02875 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA03095 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02798 ankyrin-like protein; Provisional Back     alignment and domain information
>TIGR01622 SF-CC1 splicing factor, CC1-like family Back     alignment and domain information
>KOG0515|consensus Back     alignment and domain information
>PF13857 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 3EHR_B 3EHQ_A Back     alignment and domain information
>KOG0123|consensus Back     alignment and domain information
>PHA03095 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG0110|consensus Back     alignment and domain information
>PLN03120 nucleic acid binding protein; Provisional Back     alignment and domain information
>KOG0145|consensus Back     alignment and domain information
>KOG0121|consensus Back     alignment and domain information
>PHA02946 ankyin-like protein; Provisional Back     alignment and domain information
>KOG0125|consensus Back     alignment and domain information
>KOG0109|consensus Back     alignment and domain information
>PHA03100 ankyrin repeat protein; Provisional Back     alignment and domain information
>PF14259 RRM_6: RNA recognition motif (a Back     alignment and domain information
>PHA02946 ankyin-like protein; Provisional Back     alignment and domain information
>PHA03100 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG0123|consensus Back     alignment and domain information
>PHA02878 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG0122|consensus Back     alignment and domain information
>PHA02884 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG0510|consensus Back     alignment and domain information
>PHA02874 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG4177|consensus Back     alignment and domain information
>PHA02716 CPXV016; CPX019; EVM010; Provisional Back     alignment and domain information
>KOG0113|consensus Back     alignment and domain information
>PHA02736 Viral ankyrin protein; Provisional Back     alignment and domain information
>PHA02989 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG0126|consensus Back     alignment and domain information
>TIGR01645 half-pint poly-U binding splicing factor, half-pint family Back     alignment and domain information
>PHA02716 CPXV016; CPX019; EVM010; Provisional Back     alignment and domain information
>PLN03213 repressor of silencing 3; Provisional Back     alignment and domain information
>KOG0510|consensus Back     alignment and domain information
>KOG0514|consensus Back     alignment and domain information
>PLN03121 nucleic acid binding protein; Provisional Back     alignment and domain information
>PHA02876 ankyrin repeat protein; Provisional Back     alignment and domain information
>PLN03192 Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>TIGR01659 sex-lethal sex-lethal family splicing factor Back     alignment and domain information
>KOG0514|consensus Back     alignment and domain information
>KOG4207|consensus Back     alignment and domain information
>COG0724 RNA-binding proteins (RRM domain) [General function prediction only] Back     alignment and domain information
>KOG4177|consensus Back     alignment and domain information
>PHA02917 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02876 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG0505|consensus Back     alignment and domain information
>KOG0508|consensus Back     alignment and domain information
>PHA02917 ankyrin-like protein; Provisional Back     alignment and domain information
>PTZ00322 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>PHA02798 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02989 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02795 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG0107|consensus Back     alignment and domain information
>KOG0147|consensus Back     alignment and domain information
>PHA02730 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02730 ankyrin-like protein; Provisional Back     alignment and domain information
>smart00362 RRM_2 RNA recognition motif Back     alignment and domain information
>KOG4206|consensus Back     alignment and domain information
>KOG0505|consensus Back     alignment and domain information
>cd00204 ANK ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>KOG0111|consensus Back     alignment and domain information
>KOG0114|consensus Back     alignment and domain information
>smart00360 RRM RNA recognition motif Back     alignment and domain information
>KOG1710|consensus Back     alignment and domain information
>KOG0507|consensus Back     alignment and domain information
>KOG0148|consensus Back     alignment and domain information
>PHA02792 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG0195|consensus Back     alignment and domain information
>COG0666 Arp FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>KOG1710|consensus Back     alignment and domain information
>KOG0108|consensus Back     alignment and domain information
>cd00590 RRM RRM (RNA recognition motif), also known as RBD (RNA binding domain) or RNP (ribonucleoprotein domain), is a highly abundant domain in eukaryotes found in proteins involved in post-transcriptional gene expression processes including mRNA and rRNA processing, RNA export, and RNA stability Back     alignment and domain information
>PF13637 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 3B7B_A 3F6Q_A 2KBX_A 3IXE_A 2DWZ_C 2DVW_A 3AJI_A 1S70_B 2HE0_A Back     alignment and domain information
>KOG0130|consensus Back     alignment and domain information
>PF12796 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>KOG4211|consensus Back     alignment and domain information
>KOG0144|consensus Back     alignment and domain information
>COG0666 Arp FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>PHA02792 ankyrin-like protein; Provisional Back     alignment and domain information
>TIGR00870 trp transient-receptor-potential calcium channel protein Back     alignment and domain information
>KOG0502|consensus Back     alignment and domain information
>KOG0515|consensus Back     alignment and domain information
>KOG4212|consensus Back     alignment and domain information
>cd00204 ANK ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>KOG4214|consensus Back     alignment and domain information
>TIGR00870 trp transient-receptor-potential calcium channel protein Back     alignment and domain information
>smart00361 RRM_1 RNA recognition motif Back     alignment and domain information
>KOG0506|consensus Back     alignment and domain information
>KOG4205|consensus Back     alignment and domain information
>KOG3676|consensus Back     alignment and domain information
>KOG1457|consensus Back     alignment and domain information
>KOG0131|consensus Back     alignment and domain information
>KOG0147|consensus Back     alignment and domain information
>KOG0705|consensus Back     alignment and domain information
>KOG0507|consensus Back     alignment and domain information
>KOG0153|consensus Back     alignment and domain information
>KOG0146|consensus Back     alignment and domain information
>PF13893 RRM_5: RNA recognition motif Back     alignment and domain information
>KOG0818|consensus Back     alignment and domain information
>PF13606 Ank_3: Ankyrin repeat Back     alignment and domain information
>PF00023 Ank: Ankyrin repeat Hereditary spherocytosis; InterPro: IPR002110 The ankyrin repeat is one of the most common protein-protein interaction motifs in nature Back     alignment and domain information
>KOG4208|consensus Back     alignment and domain information
>PF13857 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 3EHR_B 3EHQ_A Back     alignment and domain information
>KOG3676|consensus Back     alignment and domain information
>KOG0106|consensus Back     alignment and domain information
>KOG0124|consensus Back     alignment and domain information
>KOG0415|consensus Back     alignment and domain information
>KOG0783|consensus Back     alignment and domain information
>KOG0146|consensus Back     alignment and domain information
>KOG0109|consensus Back     alignment and domain information
>PTZ00322 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>KOG4661|consensus Back     alignment and domain information
>KOG0116|consensus Back     alignment and domain information
>PF13606 Ank_3: Ankyrin repeat Back     alignment and domain information
>KOG0110|consensus Back     alignment and domain information
>KOG4454|consensus Back     alignment and domain information
>KOG0522|consensus Back     alignment and domain information
>KOG4369|consensus Back     alignment and domain information
>KOG4212|consensus Back     alignment and domain information
>KOG1548|consensus Back     alignment and domain information
>KOG0783|consensus Back     alignment and domain information
>KOG4209|consensus Back     alignment and domain information
>PF00023 Ank: Ankyrin repeat Hereditary spherocytosis; InterPro: IPR002110 The ankyrin repeat is one of the most common protein-protein interaction motifs in nature Back     alignment and domain information
>KOG0226|consensus Back     alignment and domain information
>KOG0132|consensus Back     alignment and domain information
>KOG0129|consensus Back     alignment and domain information
>KOG0533|consensus Back     alignment and domain information
>KOG4369|consensus Back     alignment and domain information
>KOG2384|consensus Back     alignment and domain information
>KOG0511|consensus Back     alignment and domain information
>PF04059 RRM_2: RNA recognition motif 2; InterPro: IPR007201 This RNA recognition motif 2 is found in Meiosis protein mei2 Back     alignment and domain information
>KOG0782|consensus Back     alignment and domain information
>KOG0782|consensus Back     alignment and domain information
>KOG0520|consensus Back     alignment and domain information
>KOG0151|consensus Back     alignment and domain information
>KOG0120|consensus Back     alignment and domain information
>KOG4660|consensus Back     alignment and domain information
>KOG1190|consensus Back     alignment and domain information
>KOG0521|consensus Back     alignment and domain information
>KOG0128|consensus Back     alignment and domain information
>KOG1365|consensus Back     alignment and domain information
>KOG3609|consensus Back     alignment and domain information
>KOG0520|consensus Back     alignment and domain information
>KOG4210|consensus Back     alignment and domain information
>KOG1190|consensus Back     alignment and domain information
>KOG0129|consensus Back     alignment and domain information
>KOG4211|consensus Back     alignment and domain information
>KOG1995|consensus Back     alignment and domain information
>KOG0521|consensus Back     alignment and domain information
>KOG4210|consensus Back     alignment and domain information
>KOG0511|consensus Back     alignment and domain information
>PF11608 Limkain-b1: Limkain b1; InterPro: IPR024582 This entry represents a conserved domain found in limkain b1, which is a novel human autoantigen, localised to a subset of ABCD3 and PXF marked peroxisomes Back     alignment and domain information
>KOG0112|consensus Back     alignment and domain information
>KOG0705|consensus Back     alignment and domain information
>COG5175 MOT2 Transcriptional repressor [Transcription] Back     alignment and domain information
>KOG0120|consensus Back     alignment and domain information
>KOG1365|consensus Back     alignment and domain information
>PF08777 RRM_3: RNA binding motif; InterPro: IPR014886 This domain is found in protein La which functions as an RNA chaperone during RNA polymerase III transcription, and can also stimulate translation initiation Back     alignment and domain information
>KOG0506|consensus Back     alignment and domain information
>PF14605 Nup35_RRM_2: Nup53/35/40-type RNA recognition motif Back     alignment and domain information
>KOG2193|consensus Back     alignment and domain information
>KOG1457|consensus Back     alignment and domain information
>KOG3878|consensus Back     alignment and domain information
>PF05172 Nup35_RRM: Nup53/35/40-type RNA recognition motif; InterPro: IPR007846 The MPPN (Mitotic PhosphoProtein N end) family is uncharacterised however it probably plays a role in the cell cycle because the family includes mitotic phosphoproteins O13026 from SWISSPROT [] Back     alignment and domain information
>KOG4849|consensus Back     alignment and domain information
>KOG0818|consensus Back     alignment and domain information
>smart00248 ANK ankyrin repeats Back     alignment and domain information
>KOG4676|consensus Back     alignment and domain information
>PLN03134 glycine-rich RNA-binding protein 4; Provisional Back     alignment and domain information
>KOG0522|consensus Back     alignment and domain information
>smart00248 ANK ankyrin repeats Back     alignment and domain information
>KOG3152|consensus Back     alignment and domain information
>KOG4206|consensus Back     alignment and domain information
>KOG0106|consensus Back     alignment and domain information
>KOG0149|consensus Back     alignment and domain information
>KOG2505|consensus Back     alignment and domain information
>PF00076 RRM_1: RNA recognition motif Back     alignment and domain information
>KOG4307|consensus Back     alignment and domain information
>KOG0121|consensus Back     alignment and domain information
>PF08952 DUF1866: Domain of unknown function (DUF1866) ; InterPro: IPR015047 This domain, found in synaptojanin, has no known function Back     alignment and domain information
>KOG2384|consensus Back     alignment and domain information
>KOG0126|consensus Back     alignment and domain information
>KOG1456|consensus Back     alignment and domain information
>KOG0122|consensus Back     alignment and domain information
>KOG0105|consensus Back     alignment and domain information
>KOG0128|consensus Back     alignment and domain information
>KOG1855|consensus Back     alignment and domain information
>KOG2314|consensus Back     alignment and domain information
>PF08675 RNA_bind: RNA binding domain; InterPro: IPR014789 This domain corresponds to the RNA binding domain of Poly(A)-specific ribonuclease (PARN) Back     alignment and domain information
>KOG0114|consensus Back     alignment and domain information
>KOG1456|consensus Back     alignment and domain information
>KOG0115|consensus Back     alignment and domain information
>KOG0112|consensus Back     alignment and domain information
>KOG1548|consensus Back     alignment and domain information
>KOG3609|consensus Back     alignment and domain information
>PLN03213 repressor of silencing 3; Provisional Back     alignment and domain information
>PLN03120 nucleic acid binding protein; Provisional Back     alignment and domain information
>KOG2068|consensus Back     alignment and domain information
>KOG0125|consensus Back     alignment and domain information
>KOG4307|consensus Back     alignment and domain information
>KOG1996|consensus Back     alignment and domain information
>smart00362 RRM_2 RNA recognition motif Back     alignment and domain information
>KOG0113|consensus Back     alignment and domain information
>KOG0107|consensus Back     alignment and domain information
>PF03467 Smg4_UPF3: Smg-4/UPF3 family; InterPro: IPR005120 Nonsense-mediated mRNA decay (NMD) is a surveillance mechanism by which eukaryotic cells detect and degrade transcripts containing premature termination codons Back     alignment and domain information
>PF06128 Shigella_OspC: Shigella flexneri OspC protein; InterPro: IPR010366 This family consists of the Shigella flexneri specific protein OspC Back     alignment and domain information
>KOG0226|consensus Back     alignment and domain information
>PLN03121 nucleic acid binding protein; Provisional Back     alignment and domain information
>PF10309 DUF2414: Protein of unknown function (DUF2414); InterPro: IPR019416 This entry contains proteins that have no known function Back     alignment and domain information
>PF14259 RRM_6: RNA recognition motif (a Back     alignment and domain information
>cd00590 RRM RRM (RNA recognition motif), also known as RBD (RNA binding domain) or RNP (ribonucleoprotein domain), is a highly abundant domain in eukaryotes found in proteins involved in post-transcriptional gene expression processes including mRNA and rRNA processing, RNA export, and RNA stability Back     alignment and domain information
>COG0724 RNA-binding proteins (RRM domain) [General function prediction only] Back     alignment and domain information
>smart00360 RRM RNA recognition motif Back     alignment and domain information
>KOG2135|consensus Back     alignment and domain information
>KOG0130|consensus Back     alignment and domain information
>PF15023 DUF4523: Protein of unknown function (DUF4523) Back     alignment and domain information
>KOG4285|consensus Back     alignment and domain information
>KOG2202|consensus Back     alignment and domain information
>KOG4207|consensus Back     alignment and domain information
>PF11929 DUF3447: Domain of unknown function (DUF3447); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>PF07576 BRAP2: BRCA1-associated protein 2; InterPro: IPR011422 These proteins include BRCA1-associated protein 2 (BRAP2), which binds nuclear localisation signals (NLSs) in vitro and in yeast two-hybrid screening [] Back     alignment and domain information
>KOG0108|consensus Back     alignment and domain information
>PF07292 NID: Nmi/IFP 35 domain (NID); InterPro: IPR009909 This entry represents a domain of approximately 90 residues that is tandemly repeated within interferon-induced 35 kDa protein (IFP 35) and the homologous N-myc-interactor (Nmi) Back     alignment and domain information
>KOG0533|consensus Back     alignment and domain information
>KOG0151|consensus Back     alignment and domain information
>KOG2416|consensus Back     alignment and domain information
>KOG2505|consensus Back     alignment and domain information
>PF03158 DUF249: Multigene family 530 protein; InterPro: IPR004858 This entry represents multigene family 530 proteins from African swine fever virus (ASFV) viruses Back     alignment and domain information
>KOG0116|consensus Back     alignment and domain information
>KOG2591|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query347
2cop_A109 Solution Structure Of Rsgi Ruh-040, An Acbp Domain 2e-15
2dh8_A105 Solution Structure Of The N-Terminal Rna Binding Do 2e-13
2cjk_A167 Structure Of The Rna Binding Domain Of Hrp1 In Comp 2e-11
3flv_A119 The Crystal Structure Of Human Acyl-Coenzymea Bindi 3e-11
2rs2_A109 1h, 13c, And 15n Chemical Shift Assignments For Mus 6e-11
2wh5_A106 Crystal Structure Of Human Acyl-Coa Binding Domain 7e-11
1hd0_A75 Heterogeneous Nuclear Ribonucleoprotein D0 (Hnrnp D 7e-11
3s7r_A87 Crystal Structure Of A Heterogeneous Nuclear Ribonu 8e-11
1uaw_A77 Solution Structure Of The N-Terminal Rna-Binding Do 3e-10
2cqd_A116 Solution Structure Of The Rna Recognition Motif In 6e-10
2dgs_A99 Solution Structure Of The Second Rna Binding Domain 1e-09
2up1_A183 Structure Of Up1-Telomeric Dna Complex Length = 183 2e-09
2cqu_A116 Solution Structure Of Rsgi Ruh-045, A Human Acyl-Co 2e-09
1pgz_A195 Crystal Structure Of Up1 Complexed With D(Ttagggtta 2e-09
2lyv_A197 Solution Structure Of The Two Rrm Domains Of Hnrnp 3e-09
1l3k_A196 Up1, The Two Rna-Recognition Motif Domain Of Hnrnp 3e-09
1ha1_A184 Hnrnp A1 (Rbd1,2) From Homo Sapiens Length = 184 4e-09
1up1_A182 Up1, The Two Rna-Recognition Motif Domain Of Hnrnp 4e-09
1fnx_H174 Solution Structure Of The Huc Rbd1-Rbd2 Complexed W 5e-09
4hqd_A169 Crystal Structure Of Engineered Protein. Northeast 8e-09
1p1t_A104 Nmr Structure Of The N-Terminal Rrm Domain Of Cleav 9e-09
1fxl_A167 Crystal Structure Of Hud And Au-Rich Element Of The 1e-08
1hbk_A89 Acyl-Coa Binding Protein From Plasmodium Falciparum 2e-08
2mss_A75 Musashi1 Rbd2, Nmr Length = 75 3e-08
1x4b_A116 Solution Structure Of Rrm Domain In Heterogeneous N 4e-08
2kn4_A158 The Structure Of The Rrm Domain Of Sc35 Length = 15 5e-08
2fdq_A86 Crystal Structure Of Acbp From Armadillo Harderian 5e-08
1hb6_A86 Structure Of Bovine Acyl-Coa Binding Protein In Ort 5e-08
2lbb_A96 Solution Structure Of Acyl Coa Binding Protein From 5e-08
1st7_A86 Solution Structure Of Acyl Coenzyme A Binding Prote 6e-08
4ed5_A177 Crystal Structure Of The Two N-Terminal Rrm Domains 6e-08
4egl_A177 Crystal Structure Of Two Tandem Rna Recognition Mot 6e-08
2cqg_A103 Solution Structure Of The Rna Binding Domain Of Tar 8e-08
2xsf_A89 Crystal Structure Of The Rrm Domain Of Mouse Delete 9e-08
2xs5_A87 Crystal Structure Of The Rrm Domain Of Mouse Delete 9e-08
2xs2_A102 Crystal Structure Of The Rrm Domain Of Mouse Delete 9e-08
2fj9_A86 High Resolution Crystal Structure Of The Unliganded 1e-07
2xzt_G136 Caspase-3 In Complex With Darpin-3.4_i78s Length = 1e-07
2cb8_A87 High Resolution Crystal Structure Of Liganded Human 1e-07
2lea_A135 Solution Structure Of Human Srsf2 (Sc35) Rrm Length 1e-07
2e5h_A94 Solution Structure Of Rna Binding Domain In Zinc Fi 1e-07
1d9a_A85 Solution Structure Of The Second Rna-Binding Domain 2e-07
2ki2_A90 Solution Structure Of Ss-Dna Binding Protein 12rnp2 2e-07
2xeh_A157 Structural Determinants For Improved Thermal Stabil 2e-07
1x5s_A102 Solution Structure Of Rrm Domain In A18 Hnrnp Lengt 3e-07
2xee_A157 Structural Determinants For Improved Thermal Stabil 3e-07
3zuv_B136 Crystal Structure Of A Designed Selected Ankyrin Re 3e-07
2qyj_A166 Crystal Structure Of A Designed Full Consensus Anky 3e-07
1whw_A99 Solution Structure Of The N-Terminal Rna Binding Do 3e-07
4dui_A169 Darpin D1 Binding To Tubulin Beta Chain (not In Com 3e-07
3nog_D169 Designed Ankyrin Repeat Protein (Darpin) Binders To 4e-07
4gpm_A169 Crystal Structure Of Engineered Protein. Northeast 4e-07
2jrs_A108 Solution Nmr Structure Of Caper Rrm2 Domain. Northe 4e-07
3sxl_A184 Sex-Lethal Rna Recognition Domains 1 And 2 From Dro 5e-07
4drx_E169 Gtp-Tubulin In Complex With A Darpin Length = 169 5e-07
3epy_A89 Crystal Structure Of Human Acyl-Coa Binding Domain 6e-07
1sxl_A97 Resonance Assignments And Solution Structure Of The 6e-07
3fp5_A106 Crystal Structure Of Acbp From Moniliophthora Perni 7e-07
3b7b_A 237 Euhmt1 (Glp) Ankyrin Repeat Domain (Structure 1) Le 8e-07
4hb5_A169 Crystal Structure Of Engineered Protein. Northeast 9e-07
2dnz_A95 Solution Structure Of The Second Rna Binding Domain 1e-06
2err_A109 Nmr Structure Of The Rna Binding Domain Of Human Fo 2e-06
1n0r_A126 4ank: A Designed Ankyrin Repeat Protein With Four I 2e-06
3noc_D169 Designed Ankyrin Repeat Protein (Darpin) Binders To 2e-06
2dgq_A108 Solution Structure Of The N-Terminal Rna Binding Do 2e-06
2dgp_A106 Solution Structure Of The N-Terminal Rna Binding Do 2e-06
3ucg_A89 Crystal Structure Of A Rna Binding Domain Of Hypoth 2e-06
3b4d_A96 Crystal Structure Of Human Pabpn1 Rrm Length = 96 2e-06
2cq3_A103 Solution Structure Of Rna Binding Domain In Rna Bin 2e-06
1b7f_A168 Sxl-Lethal ProteinRNA COMPLEX Length = 168 3e-06
2v4h_C136 Nemo Cc2-Lz Domain - 1d5 Darpin Complex Length = 13 3e-06
2jwn_A124 Solution Nmr Structure Of The Protease-Resistent Do 3e-06
2cph_A107 Solution Structure Of The C-Terminal Rna Recognitio 4e-06
1n0q_A93 3ank: A Designed Ankyrin Repeat Protein With Three 4e-06
3q9u_C158 In Silico And In Vitro Co-Evolution Of A High Affin 4e-06
2dh7_A105 Solution Structure Of The Second Rna Binding Domain 6e-06
1mj0_A166 Sank E3_5: An Artificial Ankyrin Repeat Protein Len 7e-06
3nmr_A175 Crystal Structure Of Cugbp1 Rrm12-Rna Complex Lengt 1e-05
4atz_D154 Ad5 Knob In Complex With A Designed Ankyrin Repeat 1e-05
3f6q_A179 Crystal Structure Of Integrin-Linked Kinase Ankyrin 1e-05
2dhs_A187 Solution Structure Of Nucleic Acid Binding Protein 2e-05
3nnc_A175 Crystal Structure Of Cugbp1 Rrm12-Rna Complex Lengt 2e-05
2kbx_A171 Solution Structure Of Ilk-Pinch Complex Length = 17 2e-05
2dgo_A115 Solution Structure Of The Rna Binding Domain In Cyt 3e-05
4gmr_A169 Crystal Structure Of Engineered Protein. Northeast 3e-05
3ehq_A222 Crystal Structure Of Human Osteoclast Stimulating F 3e-05
1u6f_A139 Nmr Solution Structure Of Tcubp1, A Single Rbd-Unit 3e-05
1wtb_A79 Complex Structure Of The C-Terminal Rna-Binding Dom 4e-05
3zu7_B169 Crystal Structure Of A Designed Selected Ankyrin Re 5e-05
2j8s_D169 Drug Export Pathway Of Multidrug Exporter Acrb Reve 5e-05
2khc_A118 Bruno Rrm3+ Length = 118 6e-05
2p2c_P169 Inhibition Of Caspase-2 By A Designed Ankyrin Repea 6e-05
2xnr_A97 Structural Insights Into Cis Element Recognition Of 8e-05
2xnq_A97 Structural Insights Into Cis Element Recognition Of 9e-05
3nnh_A88 Crystal Structure Of The Cugbp1 Rrm1 With Guuguuuug 1e-04
3sde_B261 Crystal Structure Of A Paraspeckle-Protein Heterodi 1e-04
2km8_B84 Interdomain Rrm Packing Contributes To Rna Recognit 1e-04
1mx4_A168 Structure Of P18ink4c (F82q) Length = 168 1e-04
2x1f_A96 Structure Of Rna15 Rrm With Bound Rna (Gu) Length = 1e-04
2x1a_A97 Structure Of Rna15 Rrm With Rna Bound (G) Length = 1e-04
1iqt_A75 Solution Structure Of The C-Terminal Rna-Binding Do 1e-04
2qfj_A216 Crystal Structure Of First Two Rrm Domains Of Fir B 1e-04
2d9p_A103 Solution Structure Of Rna Binding Domain 4 In Polya 1e-04
4f6r_D169 Tubulin:stathmin-Like Domain Complex Length = 169 2e-04
2l41_A77 Nab3 Rrm - Ucuu Complex Length = 77 2e-04
2kvi_A96 Structure Of Nab3 Rrm Length = 96 2e-04
2cpz_A115 Solution Structure Of Rna Binding Domain 3 In Cug T 2e-04
1mx6_A168 Structure Of P18ink4c (F92n) Length = 168 2e-04
1ycs_B 239 P53-53bp2 Complex Length = 239 2e-04
4a63_B 239 Crystal Structure Of The P73-Aspp2 Complex At 2.6a 2e-04
2rrb_A96 Refinement Of Rna Binding Domain In Human Tra2 Beta 2e-04
2cpf_A98 Solution Structure Of The Penultimate Rna Recogniti 2e-04
2i38_A150 Solution Structure Of The Rrm Of Srp20 Length = 150 2e-04
2e5g_A94 Solution Structure Of Rna Binding Domain In Rna Bin 2e-04
3uwt_A200 Crystal Structure Of A Rna Binding Domain Of Poly-U 2e-04
2i2y_A150 Solution Structure Of The Rrm Of Srp20 Bound To The 2e-04
4f25_A115 Crystal Structure Of The Second Rrm Domain Of Human 2e-04
2cqc_A95 Solution Structure Of The Rna Recognition Motif In 2e-04
2rra_A99 Solution Structure Of Rna Binding Domain In Human T 3e-04
2kxf_A199 Solution Structure Of The First Two Rrm Domains Of 3e-04
4f02_A213 Crystal Structure Of The Pabp-Binding Site Of Eif4g 3e-04
3v30_A172 Crystal Structure Of The Peptide Bound Complex Of T 3e-04
2kxn_B129 Nmr Structure Of Human Tra2beta1 Rrm In Complex Wit 3e-04
1cvj_A190 X-Ray Crystal Structure Of The Poly(A)-Binding Prot 3e-04
3hi9_A84 The X-Ray Crystal Structure Of The First Rna Recogn 3e-04
1ihb_A162 Crystal Structure Of P18-Ink4c(Ink6) Length = 162 4e-04
1bu9_A168 Solution Structure Of P18-Ink4c, 21 Structures Leng 4e-04
1mx2_A168 Structure Of F71n Mutant Of P18ink4c Length = 168 4e-04
3uxg_A172 Crystal Structure Of Rfxank Length = 172 4e-04
3md3_A166 Crystal Structure Of The First Two Rrm Domains Of Y 4e-04
2k8g_A95 Solution Structure Of Rrm2 Domain Of Pabp1 Length = 4e-04
2cpj_A99 Solution Structure Of The N-Terminal Rna Recognitio 4e-04
2dnq_A90 Solution Structure Of Rna Binding Domain 1 In Rna-B 4e-04
1x4a_A109 Solution Structure Of Rrm Domain In Splicing Factor 5e-04
4grg_A135 Crystal Structure Of Ige Complexed With E2_79, An A 5e-04
3eu9_A 240 The Ankyrin Repeat Domain Of Huntingtin Interacting 5e-04
1s70_B 299 Complex Between Protein Ser/thr Phosphatase-1 (delt 5e-04
1d8z_A89 Solution Structure Of The First Rna-Binding Domain 5e-04
3md1_A83 Crystal Structure Of The Second Rrm Domain Of Yeast 6e-04
2do0_A114 Solution Structure Of The Rna Binding Domain Of Het 6e-04
2hvz_A101 Solution Structure Of The Rrm Domain Of Sr Rich Fac 6e-04
2dnm_A103 Solution Structure Of Rna Binding Domain In Srp46 S 6e-04
2dgt_A92 Solution Structure Of The Second Rna Binding Domain 8e-04
3v2o_A183 Crystal Structure Of The Peptide Bound Complex Of T 8e-04
>pdb|2COP|A Chain A, Solution Structure Of Rsgi Ruh-040, An Acbp Domain From Human Cdna Length = 109 Back     alignment and structure

Iteration: 1

Score = 79.7 bits (195), Expect = 2e-15, Method: Compositional matrix adjust. Identities = 36/92 (39%), Positives = 56/92 (60%) Query: 93 NMEDRFNQACDYLPSLVKKLDSSTLLKFYALYKQATVGQCNIDKPSWYNMEAKSKYNAWN 152 + + F +A +L L++ LL YA YKQ VG CN KPS+++ E K K+ AW Sbjct: 7 GLAELFEKAAAHLQGLIQVASREQLLYLYARYKQVKVGNCNTPKPSFFDFEGKQKWEAWK 66 Query: 153 SLGQMAKSEAMSKYIALLKEVDAGWEDKEQEE 184 +LG + S+AM +YIA++K++D GW + E+ Sbjct: 67 ALGDSSPSQAMQEYIAVVKKLDPGWNPQIPEK 98
>pdb|2DH8|A Chain A, Solution Structure Of The N-Terminal Rna Binding Domain In Daz-Associated Protein 1 Length = 105 Back     alignment and structure
>pdb|2CJK|A Chain A, Structure Of The Rna Binding Domain Of Hrp1 In Complex With Rna Length = 167 Back     alignment and structure
>pdb|3FLV|A Chain A, The Crystal Structure Of Human Acyl-Coenzymea Binding Domain Containing 5 Length = 119 Back     alignment and structure
>pdb|2RS2|A Chain A, 1h, 13c, And 15n Chemical Shift Assignments For Musashi1 Rbd1:r(Guagu) Complex Length = 109 Back     alignment and structure
>pdb|2WH5|A Chain A, Crystal Structure Of Human Acyl-Coa Binding Domain 4 Complexed With Stearoyl-Coa Length = 106 Back     alignment and structure
>pdb|1HD0|A Chain A, Heterogeneous Nuclear Ribonucleoprotein D0 (Hnrnp D0 Rbd1), Nmr Length = 75 Back     alignment and structure
>pdb|3S7R|A Chain A, Crystal Structure Of A Heterogeneous Nuclear Ribonucleoprotein AB (Hnrpab) From Homo Sapiens At 2.15 A Resolution Length = 87 Back     alignment and structure
>pdb|1UAW|A Chain A, Solution Structure Of The N-Terminal Rna-Binding Domain Of Mouse Musashi1 Length = 77 Back     alignment and structure
>pdb|2CQD|A Chain A, Solution Structure Of The Rna Recognition Motif In Rna- Binding Region Containing Protein 1 Length = 116 Back     alignment and structure
>pdb|2DGS|A Chain A, Solution Structure Of The Second Rna Binding Domain In Daz- Associated Protein 1 Length = 99 Back     alignment and structure
>pdb|2UP1|A Chain A, Structure Of Up1-Telomeric Dna Complex Length = 183 Back     alignment and structure
>pdb|2CQU|A Chain A, Solution Structure Of Rsgi Ruh-045, A Human Acyl-Coa Binding Protein Length = 116 Back     alignment and structure
>pdb|1PGZ|A Chain A, Crystal Structure Of Up1 Complexed With D(Ttagggttag(6-Mi) G); A Human Telomeric Repeat Containing 6-Methyl-8-(2- Deoxy-Beta-Ribofuranosyl)isoxanthopteridine (6-Mi) Length = 195 Back     alignment and structure
>pdb|2LYV|A Chain A, Solution Structure Of The Two Rrm Domains Of Hnrnp A1 (up1) Using Segmental Isotope Labeling Length = 197 Back     alignment and structure
>pdb|1L3K|A Chain A, Up1, The Two Rna-Recognition Motif Domain Of Hnrnp A1 Length = 196 Back     alignment and structure
>pdb|1HA1|A Chain A, Hnrnp A1 (Rbd1,2) From Homo Sapiens Length = 184 Back     alignment and structure
>pdb|1UP1|A Chain A, Up1, The Two Rna-Recognition Motif Domain Of Hnrnp A1 Length = 182 Back     alignment and structure
>pdb|1FNX|H Chain H, Solution Structure Of The Huc Rbd1-Rbd2 Complexed With The Au-Rich Element Length = 174 Back     alignment and structure
>pdb|4HQD|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or265. Length = 169 Back     alignment and structure
>pdb|1P1T|A Chain A, Nmr Structure Of The N-Terminal Rrm Domain Of Cleavage Stimulation Factor 64 Kda Subunit Length = 104 Back     alignment and structure
>pdb|1FXL|A Chain A, Crystal Structure Of Hud And Au-Rich Element Of The C-Fos Rna Length = 167 Back     alignment and structure
>pdb|1HBK|A Chain A, Acyl-Coa Binding Protein From Plasmodium Falciparum Length = 89 Back     alignment and structure
>pdb|2MSS|A Chain A, Musashi1 Rbd2, Nmr Length = 75 Back     alignment and structure
>pdb|1X4B|A Chain A, Solution Structure Of Rrm Domain In Heterogeneous Nuclear Ribonucleaoproteins A2B1 Length = 116 Back     alignment and structure
>pdb|2KN4|A Chain A, The Structure Of The Rrm Domain Of Sc35 Length = 158 Back     alignment and structure
>pdb|2FDQ|A Chain A, Crystal Structure Of Acbp From Armadillo Harderian Gland Length = 86 Back     alignment and structure
>pdb|1HB6|A Chain A, Structure Of Bovine Acyl-Coa Binding Protein In Orthorhombic Crystal Form Length = 86 Back     alignment and structure
>pdb|2LBB|A Chain A, Solution Structure Of Acyl Coa Binding Protein From Babesia Bovis T2bo Length = 96 Back     alignment and structure
>pdb|1ST7|A Chain A, Solution Structure Of Acyl Coenzyme A Binding Protein From Yeast Length = 86 Back     alignment and structure
>pdb|4ED5|A Chain A, Crystal Structure Of The Two N-Terminal Rrm Domains Of Hur Complexed With Rna Length = 177 Back     alignment and structure
>pdb|4EGL|A Chain A, Crystal Structure Of Two Tandem Rna Recognition Motifs Of Human Antigen R Length = 177 Back     alignment and structure
>pdb|2CQG|A Chain A, Solution Structure Of The Rna Binding Domain Of Tar Dna- Binding Protein-43 Length = 103 Back     alignment and structure
>pdb|2XSF|A Chain A, Crystal Structure Of The Rrm Domain Of Mouse Deleted In Azoospermia-Like Length = 89 Back     alignment and structure
>pdb|2XS5|A Chain A, Crystal Structure Of The Rrm Domain Of Mouse Deleted In Azoospermia-Like In Complex With Mvh Rna, Uguuc Length = 87 Back     alignment and structure
>pdb|2XS2|A Chain A, Crystal Structure Of The Rrm Domain Of Mouse Deleted In Azoospermia-Like In Complex With Rna, Uuguucuu Length = 102 Back     alignment and structure
>pdb|2FJ9|A Chain A, High Resolution Crystal Structure Of The Unliganded Human Acbp Length = 86 Back     alignment and structure
>pdb|2XZT|G Chain G, Caspase-3 In Complex With Darpin-3.4_i78s Length = 136 Back     alignment and structure
>pdb|2CB8|A Chain A, High Resolution Crystal Structure Of Liganded Human L-Acbp Length = 87 Back     alignment and structure
>pdb|2LEA|A Chain A, Solution Structure Of Human Srsf2 (Sc35) Rrm Length = 135 Back     alignment and structure
>pdb|2E5H|A Chain A, Solution Structure Of Rna Binding Domain In Zinc Finger Cchc-Type And Rna Binding Motif 1 Length = 94 Back     alignment and structure
>pdb|1D9A|A Chain A, Solution Structure Of The Second Rna-Binding Domain (Rbd2) Of Hu Antigen C (Huc) Length = 85 Back     alignment and structure
>pdb|2KI2|A Chain A, Solution Structure Of Ss-Dna Binding Protein 12rnp2 Precursor, Hp0827(O25501_helpy) Form Helicobacter Pylori Length = 90 Back     alignment and structure
>pdb|2XEH|A Chain A, Structural Determinants For Improved Thermal Stability Of Designed Ankyrin Repeat Proteins With A Redesigned C- Capping Module. Length = 157 Back     alignment and structure
>pdb|1X5S|A Chain A, Solution Structure Of Rrm Domain In A18 Hnrnp Length = 102 Back     alignment and structure
>pdb|2XEE|A Chain A, Structural Determinants For Improved Thermal Stability Of Designed Ankyrin Repeat Proteins With A Redesigned C- Capping Module. Length = 157 Back     alignment and structure
>pdb|3ZUV|B Chain B, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Phosphorylated Map Kinase Erk2 Length = 136 Back     alignment and structure
>pdb|2QYJ|A Chain A, Crystal Structure Of A Designed Full Consensus Ankyrin Length = 166 Back     alignment and structure
>pdb|1WHW|A Chain A, Solution Structure Of The N-Terminal Rna Binding Domain From Hypothetical Protein Bab23448 Length = 99 Back     alignment and structure
>pdb|4DUI|A Chain A, Darpin D1 Binding To Tubulin Beta Chain (not In Complex) Length = 169 Back     alignment and structure
>pdb|3NOG|D Chain D, Designed Ankyrin Repeat Protein (Darpin) Binders To Acrb: Plasticity Of The Interface Length = 169 Back     alignment and structure
>pdb|4GPM|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or264. Length = 169 Back     alignment and structure
>pdb|2JRS|A Chain A, Solution Nmr Structure Of Caper Rrm2 Domain. Northeast Structural Genomics Target Hr4730a Length = 108 Back     alignment and structure
>pdb|3SXL|A Chain A, Sex-Lethal Rna Recognition Domains 1 And 2 From Drosophila Melanogaster Length = 184 Back     alignment and structure
>pdb|4DRX|E Chain E, Gtp-Tubulin In Complex With A Darpin Length = 169 Back     alignment and structure
>pdb|3EPY|A Chain A, Crystal Structure Of Human Acyl-Coa Binding Domain 7 Complexed With Palmitoyl-Coa Length = 89 Back     alignment and structure
>pdb|1SXL|A Chain A, Resonance Assignments And Solution Structure Of The Second Rna-Binding Domain Of Sex-Lethal Determined By Multidimensional Heteronuclear Magnetic Resonance Spectroscopy Length = 97 Back     alignment and structure
>pdb|3FP5|A Chain A, Crystal Structure Of Acbp From Moniliophthora Perniciosa Length = 106 Back     alignment and structure
>pdb|3B7B|A Chain A, Euhmt1 (Glp) Ankyrin Repeat Domain (Structure 1) Length = 237 Back     alignment and structure
>pdb|4HB5|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or267. Length = 169 Back     alignment and structure
>pdb|2DNZ|A Chain A, Solution Structure Of The Second Rna Binding Domain Of Rna Binding Motif Protein 23 Length = 95 Back     alignment and structure
>pdb|2ERR|A Chain A, Nmr Structure Of The Rna Binding Domain Of Human Fox-1 In Complex With Ugcaugu Length = 109 Back     alignment and structure
>pdb|1N0R|A Chain A, 4ank: A Designed Ankyrin Repeat Protein With Four Identical Consensus Repeats Length = 126 Back     alignment and structure
>pdb|3NOC|D Chain D, Designed Ankyrin Repeat Protein (Darpin) Binders To Acrb: Plasticity Of The Interface Length = 169 Back     alignment and structure
>pdb|2DGQ|A Chain A, Solution Structure Of The N-Terminal Rna Binding Domain In Bruno-Like 6 Rna-Binding Protein Length = 108 Back     alignment and structure
>pdb|2DGP|A Chain A, Solution Structure Of The N-Terminal Rna Binding Domain In Bruno-Like 4 Rna-Binding Protein Length = 106 Back     alignment and structure
>pdb|3UCG|A Chain A, Crystal Structure Of A Rna Binding Domain Of Hypothetical Polyadenylate-Binding Protein (Pabpn1) From Homo Sapiens At 1.95 A Resolution Length = 89 Back     alignment and structure
>pdb|3B4D|A Chain A, Crystal Structure Of Human Pabpn1 Rrm Length = 96 Back     alignment and structure
>pdb|2CQ3|A Chain A, Solution Structure Of Rna Binding Domain In Rna Binding Motif Protein 9 Length = 103 Back     alignment and structure
>pdb|1B7F|A Chain A, Sxl-Lethal ProteinRNA COMPLEX Length = 168 Back     alignment and structure
>pdb|2V4H|C Chain C, Nemo Cc2-Lz Domain - 1d5 Darpin Complex Length = 136 Back     alignment and structure
>pdb|2JWN|A Chain A, Solution Nmr Structure Of The Protease-Resistent Domain Of Xenopus Laevis Epabp2 Length = 124 Back     alignment and structure
>pdb|2CPH|A Chain A, Solution Structure Of The C-Terminal Rna Recognition Motif Of Hypothetical Rna-Binding Protein Rbm19 Length = 107 Back     alignment and structure
>pdb|1N0Q|A Chain A, 3ank: A Designed Ankyrin Repeat Protein With Three Identical Consensus Repeats Length = 93 Back     alignment and structure
>pdb|3Q9U|C Chain C, In Silico And In Vitro Co-Evolution Of A High Affinity Complementary Protein-Protein Interface Length = 158 Back     alignment and structure
>pdb|2DH7|A Chain A, Solution Structure Of The Second Rna Binding Domain In Nucleolysin Tiar Length = 105 Back     alignment and structure
>pdb|1MJ0|A Chain A, Sank E3_5: An Artificial Ankyrin Repeat Protein Length = 166 Back     alignment and structure
>pdb|3NMR|A Chain A, Crystal Structure Of Cugbp1 Rrm12-Rna Complex Length = 175 Back     alignment and structure
>pdb|4ATZ|D Chain D, Ad5 Knob In Complex With A Designed Ankyrin Repeat Protein Length = 154 Back     alignment and structure
>pdb|3F6Q|A Chain A, Crystal Structure Of Integrin-Linked Kinase Ankyrin Repeat Domain In Complex With Pinch1 Lim1 Domain Length = 179 Back     alignment and structure
>pdb|2DHS|A Chain A, Solution Structure Of Nucleic Acid Binding Protein Cugbp1ab And Its Binding Study With Dna And Rna Length = 187 Back     alignment and structure
>pdb|3NNC|A Chain A, Crystal Structure Of Cugbp1 Rrm12-Rna Complex Length = 175 Back     alignment and structure
>pdb|2KBX|A Chain A, Solution Structure Of Ilk-Pinch Complex Length = 171 Back     alignment and structure
>pdb|2DGO|A Chain A, Solution Structure Of The Rna Binding Domain In Cytotoxic Granule-Associated Rna Binding Protein 1 Length = 115 Back     alignment and structure
>pdb|4GMR|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or266. Length = 169 Back     alignment and structure
>pdb|3EHQ|A Chain A, Crystal Structure Of Human Osteoclast Stimulating Factor Length = 222 Back     alignment and structure
>pdb|1U6F|A Chain A, Nmr Solution Structure Of Tcubp1, A Single Rbd-Unit From Trypanosoma Cruzi Length = 139 Back     alignment and structure
>pdb|1WTB|A Chain A, Complex Structure Of The C-Terminal Rna-Binding Domain Of Hnrnp D (Auf1) With Telomere Dna Length = 79 Back     alignment and structure
>pdb|3ZU7|B Chain B, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Map Kinase Erk2 Length = 169 Back     alignment and structure
>pdb|2J8S|D Chain D, Drug Export Pathway Of Multidrug Exporter Acrb Revealed By Darpin Inhibitors Length = 169 Back     alignment and structure
>pdb|2KHC|A Chain A, Bruno Rrm3+ Length = 118 Back     alignment and structure
>pdb|2P2C|P Chain P, Inhibition Of Caspase-2 By A Designed Ankyrin Repeat Protein (Darpin) Length = 169 Back     alignment and structure
>pdb|2XNR|A Chain A, Structural Insights Into Cis Element Recognition Of Non- Polyadenylated Rnas By The Nab3-Rrm Length = 97 Back     alignment and structure
>pdb|2XNQ|A Chain A, Structural Insights Into Cis Element Recognition Of Non- Polyadenylated Rnas By The Nab3-Rrm Length = 97 Back     alignment and structure
>pdb|3NNH|A Chain A, Crystal Structure Of The Cugbp1 Rrm1 With Guuguuuuguuu Rna Length = 88 Back     alignment and structure
>pdb|3SDE|B Chain B, Crystal Structure Of A Paraspeckle-Protein Heterodimer, Pspc1NONO Length = 261 Back     alignment and structure
>pdb|2KM8|B Chain B, Interdomain Rrm Packing Contributes To Rna Recognition In The Rna15, Hrp1, Anchor Rna 3' Processing Ternary Complex Length = 84 Back     alignment and structure
>pdb|1MX4|A Chain A, Structure Of P18ink4c (F82q) Length = 168 Back     alignment and structure
>pdb|2X1F|A Chain A, Structure Of Rna15 Rrm With Bound Rna (Gu) Length = 96 Back     alignment and structure
>pdb|2X1A|A Chain A, Structure Of Rna15 Rrm With Rna Bound (G) Length = 97 Back     alignment and structure
>pdb|1IQT|A Chain A, Solution Structure Of The C-Terminal Rna-Binding Domain Of Heterogeneous Nuclear Ribonucleoprotein D0 (Auf1) Length = 75 Back     alignment and structure
>pdb|2QFJ|A Chain A, Crystal Structure Of First Two Rrm Domains Of Fir Bound To Ssdna From A Portion Of Fuse Length = 216 Back     alignment and structure
>pdb|2D9P|A Chain A, Solution Structure Of Rna Binding Domain 4 In Polyadenylation Binding Protein 3 Length = 103 Back     alignment and structure
>pdb|4F6R|D Chain D, Tubulin:stathmin-Like Domain Complex Length = 169 Back     alignment and structure
>pdb|2L41|A Chain A, Nab3 Rrm - Ucuu Complex Length = 77 Back     alignment and structure
>pdb|2KVI|A Chain A, Structure Of Nab3 Rrm Length = 96 Back     alignment and structure
>pdb|2CPZ|A Chain A, Solution Structure Of Rna Binding Domain 3 In Cug Triplet Repeat Rna-Binding Protein 1 Length = 115 Back     alignment and structure
>pdb|1MX6|A Chain A, Structure Of P18ink4c (F92n) Length = 168 Back     alignment and structure
>pdb|1YCS|B Chain B, P53-53bp2 Complex Length = 239 Back     alignment and structure
>pdb|4A63|B Chain B, Crystal Structure Of The P73-Aspp2 Complex At 2.6a Resolution Length = 239 Back     alignment and structure
>pdb|2RRB|A Chain A, Refinement Of Rna Binding Domain In Human Tra2 Beta Protein Length = 96 Back     alignment and structure
>pdb|2CPF|A Chain A, Solution Structure Of The Penultimate Rna Recognition Motif Of Hypothetical Rna-Binding Protein Rbm19 Length = 98 Back     alignment and structure
>pdb|2I38|A Chain A, Solution Structure Of The Rrm Of Srp20 Length = 150 Back     alignment and structure
>pdb|2E5G|A Chain A, Solution Structure Of Rna Binding Domain In Rna Binding Motif Protein 21 Length = 94 Back     alignment and structure
>pdb|3UWT|A Chain A, Crystal Structure Of A Rna Binding Domain Of Poly-U Binding Splicing Factor 60kda (Puf60) From Homo Sapiens At 2.50 A Resolution Length = 200 Back     alignment and structure
>pdb|2I2Y|A Chain A, Solution Structure Of The Rrm Of Srp20 Bound To The Rna Cauc Length = 150 Back     alignment and structure
>pdb|4F25|A Chain A, Crystal Structure Of The Second Rrm Domain Of Human Pabpc1 At Ph 6.0 Length = 115 Back     alignment and structure
>pdb|2CQC|A Chain A, Solution Structure Of The Rna Recognition Motif In ArginineSERINE-Rich Splicing Factor 10 Length = 95 Back     alignment and structure
>pdb|2RRA|A Chain A, Solution Structure Of Rna Binding Domain In Human Tra2 Beta Protein In Complex With Rna (Gaagaa) Length = 99 Back     alignment and structure
>pdb|2KXF|A Chain A, Solution Structure Of The First Two Rrm Domains Of Fbp-Interacting Repressor (Fir) Length = 199 Back     alignment and structure
>pdb|4F02|A Chain A, Crystal Structure Of The Pabp-Binding Site Of Eif4g In Complex With Rrm1-2 Of Pabp And Poly(A) Length = 213 Back     alignment and structure
>pdb|3V30|A Chain A, Crystal Structure Of The Peptide Bound Complex Of The Ankyrin Repeat Domains Of Human Rfxank Length = 172 Back     alignment and structure
>pdb|2KXN|B Chain B, Nmr Structure Of Human Tra2beta1 Rrm In Complex With Aagaac Rna Length = 129 Back     alignment and structure
>pdb|1CVJ|A Chain A, X-Ray Crystal Structure Of The Poly(A)-Binding Protein In Complex With Polyadenylate Rna Length = 190 Back     alignment and structure
>pdb|3HI9|A Chain A, The X-Ray Crystal Structure Of The First Rna Recognition Motif (Rrm1) Of The Au-Rich Element (Are) Binding Protein Hur At 2.0 Angstrom Resolution Length = 84 Back     alignment and structure
>pdb|1IHB|A Chain A, Crystal Structure Of P18-Ink4c(Ink6) Length = 162 Back     alignment and structure
>pdb|1BU9|A Chain A, Solution Structure Of P18-Ink4c, 21 Structures Length = 168 Back     alignment and structure
>pdb|1MX2|A Chain A, Structure Of F71n Mutant Of P18ink4c Length = 168 Back     alignment and structure
>pdb|3UXG|A Chain A, Crystal Structure Of Rfxank Length = 172 Back     alignment and structure
>pdb|3MD3|A Chain A, Crystal Structure Of The First Two Rrm Domains Of Yeast Poly Binding Protein (Pub1) Length = 166 Back     alignment and structure
>pdb|2K8G|A Chain A, Solution Structure Of Rrm2 Domain Of Pabp1 Length = 95 Back     alignment and structure
>pdb|2CPJ|A Chain A, Solution Structure Of The N-Terminal Rna Recognition Motif Of Nono Length = 99 Back     alignment and structure
>pdb|2DNQ|A Chain A, Solution Structure Of Rna Binding Domain 1 In Rna-Binding Protein 30 Length = 90 Back     alignment and structure
>pdb|1X4A|A Chain A, Solution Structure Of Rrm Domain In Splicing Factor Sf2 Length = 109 Back     alignment and structure
>pdb|4GRG|A Chain A, Crystal Structure Of Ige Complexed With E2_79, An Anti-Ige Inhibitor Length = 135 Back     alignment and structure
>pdb|3EU9|A Chain A, The Ankyrin Repeat Domain Of Huntingtin Interacting Protein 14 Length = 240 Back     alignment and structure
>pdb|1S70|B Chain B, Complex Between Protein Ser/thr Phosphatase-1 (delta) And The Myosin Phosphatase Targeting Subunit 1 (mypt1) Length = 299 Back     alignment and structure
>pdb|1D8Z|A Chain A, Solution Structure Of The First Rna-Binding Domain (Rbd1) Of Hu Antigen C (Huc) Length = 89 Back     alignment and structure
>pdb|3MD1|A Chain A, Crystal Structure Of The Second Rrm Domain Of Yeast Poly(U)-Binding Protein (Pub1) Length = 83 Back     alignment and structure
>pdb|2DO0|A Chain A, Solution Structure Of The Rna Binding Domain Of Heterogeneous Nuclear Ribonucleoprotein M Length = 114 Back     alignment and structure
>pdb|2HVZ|A Chain A, Solution Structure Of The Rrm Domain Of Sr Rich Factor 9g8 Length = 101 Back     alignment and structure
>pdb|2DNM|A Chain A, Solution Structure Of Rna Binding Domain In Srp46 Splicing Factor Length = 103 Back     alignment and structure
>pdb|2DGT|A Chain A, Solution Structure Of The Second Rna Binding Domain In Rna- Binding Protein 30 Length = 92 Back     alignment and structure
>pdb|3V2O|A Chain A, Crystal Structure Of The Peptide Bound Complex Of The Ankyrin Repeat Domains Of Human Ankra2 Length = 183 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query347
2dgs_A99 DAZ-associated protein 1; RRM domain, structural g 8e-29
2cqd_A116 RNA-binding region containing protein 1; RNA recog 2e-28
2mss_A75 Protein (musashi1); RNA-binding domain, RNA bindin 5e-28
2cjk_A167 Nuclear polyadenylated RNA-binding protein 4; HRP1 6e-28
2cjk_A167 Nuclear polyadenylated RNA-binding protein 4; HRP1 5e-25
1l3k_A196 Heterogeneous nuclear ribonucleoprotein A1; nuclea 6e-28
1l3k_A196 Heterogeneous nuclear ribonucleoprotein A1; nuclea 3e-26
2cqu_A116 Peroxisomal D3,D2-enoyl-COA isomerase; acyl-COA bi 9e-28
1x4b_A116 Heterogeneous nuclear ribonucleoproteins A2/B1; st 3e-27
1iqt_A75 AUF1, heterogeneous nuclear ribonucleoprotein D0; 3e-27
2rs2_A109 Musashi-1, RNA-binding protein musashi homolog 1; 7e-27
2cop_A109 Acyl-coenzyme A binding domain containing 6; acyl 1e-26
1uaw_A77 Mouse-musashi-1; RNP-type structure, RNA binding p 2e-26
2dh8_A105 DAZ-associated protein 1; RRM domain, structural g 2e-26
1hbk_A89 ACBP, acyl-COA binding protein; fatty acid metabol 3e-26
2cqg_A103 TDP-43, TAR DNA-binding protein-43; RNA recognitio 3e-26
3s7r_A87 Heterogeneous nuclear ribonucleoprotein A/B; ferre 9e-26
2lbb_A96 Acyl COA binding protein; protein binding, structu 1e-25
2cb8_A87 Acyl-COA-binding protein; acyl-coenzyme A binding 1e-25
2cq4_A114 RNA binding motif protein 23; RRM domain, structur 1e-25
1st7_A86 ACBP, acyl-COA-binding protein; four helix bundle, 2e-25
2xs2_A102 Deleted in azoospermia-like; RNA binding protein-R 3e-24
3epy_A89 Acyl-COA-binding domain-containing protein 7; acyl 3e-24
1x4h_A111 RNA-binding protein 28; structural genomics, RRM d 1e-23
3fp5_A106 Acyl-COA binding protein; ACBP, cacao disease, fat 2e-23
3flv_A119 Acyl-COA-binding domain-containing protein 5; lipi 3e-23
3ucg_A89 Polyadenylate-binding protein 2; ferredoxin-like, 3e-23
2e5g_A94 U6 snRNA-specific terminal uridylyltransferase 1; 4e-23
1x5s_A102 Cold-inducible RNA-binding protein; structure geno 6e-23
2g4b_A172 Splicing factor U2AF 65 kDa subunit; protein-RNA c 6e-23
2g4b_A172 Splicing factor U2AF 65 kDa subunit; protein-RNA c 3e-18
2jwn_A124 Embryonic polyadenylate-binding protein 2-B; epabp 9e-23
2qfj_A216 FBP-interacting repressor; protein-DNA complex; HE 2e-22
2qfj_A216 FBP-interacting repressor; protein-DNA complex; HE 3e-21
2wh5_A106 Acyl-COA-binding domain-containing protein 4; alte 2e-22
2dgp_A106 Bruno-like 4, RNA binding protein; RRM domain, str 3e-22
1whw_A99 Hypothetical protein riken cDNA 1200009A02; RNA re 3e-22
2e5h_A94 Zinc finger CCHC-type and RNA-binding motif- conta 4e-22
3md1_A83 Nuclear and cytoplasmic polyadenylated RNA-bindin 4e-22
1fxl_A167 Paraneoplastic encephalomyelitis antigen HUD; prot 5e-22
1fxl_A167 Paraneoplastic encephalomyelitis antigen HUD; prot 2e-18
2lea_A135 Serine/arginine-rich splicing factor 2; SR protein 5e-22
1x4e_A85 RNA binding motif, single-stranded interacting pro 8e-22
1wf0_A88 TDP-43, TAR DNA-binding protein-43; structural gen 1e-21
2dnz_A95 Probable RNA-binding protein 23; RNA recognition m 2e-21
1p1t_A104 Cleavage stimulation factor, 64 kDa subunit; RNA r 3e-21
3bs9_A87 Nucleolysin TIA-1 isoform P40; RNA recognition mot 3e-21
2cqc_A95 Arginine/serine-rich splicing factor 10; RNA recog 4e-21
2do4_A100 Squamous cell carcinoma antigen recognized by T- c 4e-21
2yh0_A198 Splicing factor U2AF 65 kDa subunit; PRE-mRNA spli 5e-21
2yh0_A198 Splicing factor U2AF 65 kDa subunit; PRE-mRNA spli 2e-18
1fje_B175 Nucleolin RBD12, protein C23; RNP, RRM, RNA bindin 5e-21
1fje_B175 Nucleolin RBD12, protein C23; RNP, RRM, RNA bindin 1e-16
2ki2_A90 SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA 6e-21
1b7f_A168 Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP 6e-21
1b7f_A168 Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP 2e-18
2kxn_B129 Transformer-2 protein homolog beta; SR protein, RR 6e-21
1u6f_A139 Tcubp1, RNA-binding protein UBP1; trypanosome, mRN 6e-21
2fy1_A116 RNA-binding motif protein, Y chromosome, family 1 7e-21
2do0_A114 HnRNP M, heterogeneous nuclear ribonucleoprotein M 8e-21
2dgo_A115 Cytotoxic granule-associated RNA binding protein 1 9e-21
2cqb_A102 Peptidyl-prolyl CIS-trans isomerase E; RNA recogni 1e-20
2khc_A118 Testis-specific RNP-type RNA binding protein; RRM, 1e-20
3mdf_A85 Peptidyl-prolyl CIS-trans isomerase E; RRM domain, 2e-20
2dnm_A103 SRP46 splicing factor; RRM domain, RBD, structural 2e-20
3d2w_A89 TAR DNA-binding protein 43; DP-43 proteinopathy, T 3e-20
2cpz_A115 CUG triplet repeat RNA-binding protein 1; RRM doma 3e-20
2cq0_A103 Eukaryotic translation initiation factor 3 subunit 3e-20
3md3_A166 Nuclear and cytoplasmic polyadenylated RNA-bindin 3e-20
3md3_A166 Nuclear and cytoplasmic polyadenylated RNA-bindin 2e-14
3s8s_A110 Histone-lysine N-methyltransferase SETD1A; chromat 4e-20
2kn4_A158 Immunoglobulin G-binding protein G, splicing FACT 5e-20
2cpf_A98 RNA binding motif protein 19; RNA recognition moti 6e-20
2jrs_A108 RNA-binding protein 39; RNA binding motif of RBM39 6e-20
3n9u_C156 Cleavage and polyadenylation specificity factor S; 7e-20
2x1f_A96 MRNA 3'-END-processing protein RNA15; transcriptio 9e-20
2ku7_A140 MLL1 PHD3-CYP33 RRM chimeric protein; transcriptio 1e-19
2cq3_A103 RNA-binding protein 9; RRM domain, structural geno 2e-19
2err_A109 Ataxin-2-binding protein 1; protein-RNA complex, R 3e-19
4a8x_A88 RNA-binding protein with serine-rich domain 1; tra 3e-19
3sde_A261 Paraspeckle component 1; RRM, anti parallel right 4e-19
3sde_A261 Paraspeckle component 1; RRM, anti parallel right 6e-14
1fj7_A101 Nucleolin RBD1, protein C23; RNP, RRM, RNA binding 5e-19
3nmr_A175 Cugbp ELAV-like family member 1; RRM, PRE-mRNA spl 5e-19
3nmr_A175 Cugbp ELAV-like family member 1; RRM, PRE-mRNA spl 2e-18
2cph_A107 RNA binding motif protein 19; RNA recognition moti 7e-19
2dng_A103 Eukaryotic translation initiation factor 4H; RRM d 7e-19
3ulh_A107 THO complex subunit 4; nuclear protein, RNA bindin 7e-19
3ex7_B126 RNA-binding protein 8A; protein-RNA complex, mRNA 1e-18
1x5u_A105 Splicing factor 3B subunit 4 (spliceosome associat 1e-18
2d9p_A103 Polyadenylate-binding protein 3; RRM domain, struc 2e-18
1p27_B106 RNA-binding protein 8A; nuclear protein, mRNA spli 2e-18
1x5o_A114 RNA binding motif, single-stranded interacting pro 2e-18
2dgv_A92 HnRNP M, heterogeneous nuclear ribonucleoprotein M 2e-18
2dgt_A92 RNA-binding protein 30; RRM domain, structural gen 2e-18
2kt5_A124 RNA and export factor-binding protein 2; chaperone 2e-18
2ywk_A95 Putative RNA-binding protein 11; RRM-domain, struc 3e-18
1x5t_A96 Splicing factor 3B subunit 4; structure genomics, 3e-18
3smz_A284 Protein raver-1, ribonucleoprotein PTB-binding 1; 4e-18
3smz_A284 Protein raver-1, ribonucleoprotein PTB-binding 1; 8e-15
3smz_A284 Protein raver-1, ribonucleoprotein PTB-binding 1; 2e-11
2la6_A99 RNA-binding protein FUS; structural genomics, nort 5e-18
3p5t_L90 Cleavage and polyadenylation specificity factor S; 5e-18
3q2s_C229 Cleavage and polyadenylation specificity factor S; 6e-18
2hvz_A101 Splicing factor, arginine/serine-rich 7; RRM, RNA 6e-18
2f3j_A177 RNA and export factor binding protein 2; RRM domai 6e-18
1oo0_B110 CG8781-PA, drosophila Y14; RNA recognition motif, 1e-17
2dnq_A90 RNA-binding protein 4B; RRM domain,RBD, structural 1e-17
4f25_A115 Polyadenylate-binding protein 1; RRM fold, transla 1e-17
2dnp_A90 RNA-binding protein 14; RRM domain, RBD, structura 1e-17
1x4a_A109 Splicing factor, arginine/serine-rich 1 (splicing 3e-17
2cpx_A115 Hypothetical protein FLJ11016; RRM domain, structu 3e-17
2dnl_A114 Cytoplasmic polyadenylation element binding protei 4e-17
1fjc_A96 Nucleolin RBD2, protein C23; RNP, RRM, RNA binding 4e-17
2dnh_A105 Bruno-like 5, RNA binding protein; RRM domain, RBD 4e-17
2lkz_A95 RNA-binding protein 5; RRM; NMR {Homo sapiens} Len 5e-17
2cpe_A113 RNA-binding protein EWS; RNA recognition motif, RR 5e-17
2lcw_A116 RNA-binding protein FUS; RRM, nucleic acid binding 5e-17
1wi8_A104 EIF-4B, eukaryotic translation initiation factor 4 6e-17
2j76_E100 EIF-4B, EIF4B, eukaryotic translation initiation f 7e-17
2cpy_A114 RNA-binding protein 12; RRM domain, structural gen 7e-17
1rk8_A165 CG8781-PA, CG8781-PA protein; mRNA processing, RRM 9e-17
2fc9_A101 NCL protein; structure genomics, RRM_1 domain, str 1e-16
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 1e-16
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 4e-15
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 1e-11
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 1e-08
3ehr_A 222 Osteoclast-stimulating factor 1; beta barrel, heli 2e-07
3ehr_A 222 Osteoclast-stimulating factor 1; beta barrel, heli 3e-06
2fc8_A102 NCL protein; structure genomics, RRM_1 domain, str 1e-16
2ghp_A292 U4/U6 snRNA-associated splicing factor PRP24; RNA 3e-16
2ghp_A292 U4/U6 snRNA-associated splicing factor PRP24; RNA 3e-16
2ghp_A292 U4/U6 snRNA-associated splicing factor PRP24; RNA 9e-16
1h2v_Z156 20 kDa nuclear CAP binding protein; CAP-binding-co 3e-16
4f02_A213 Polyadenylate-binding protein 1; mRNA, eukaryotic 3e-16
4f02_A213 Polyadenylate-binding protein 1; mRNA, eukaryotic 1e-14
1s79_A103 Lupus LA protein; RRM, alpha/beta, RNA binding pro 5e-16
1wel_A124 RNA-binding protein 12; structural genomics, NPPSF 5e-16
2ek1_A95 RNA-binding protein 12; RNA recognition motif, dim 7e-16
2cqh_A93 IGF-II mRNA-binding protein 2 isoform A; RNA recog 8e-16
2cpj_A99 Non-POU domain-containing octamer-binding protein; 1e-15
1wg5_A104 Heterogeneous nuclear ribonucleoprotein H; structu 1e-15
2jvo_A108 Nucleolar protein 3; nucleus, phosphorylation, rib 2e-15
2hzc_A87 Splicing factor U2AF 65 kDa subunit; RNA splicing, 2e-15
2kvi_A96 Nuclear polyadenylated RNA-binding protein 3; RNA- 2e-15
2div_A99 TRNA selenocysteine associated protein; structural 2e-15
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 2e-15
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 1e-14
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 2e-13
3f6q_A 179 Integrin-linked protein kinase; ILK, integrin-link 5e-10
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 1e-07
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 3e-15
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 5e-14
1n11_A 437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 1e-13
1n11_A 437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 1e-13
1n11_A 437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 1e-13
1n11_A 437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 1e-12
1n11_A 437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 1e-12
1n11_A 437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 3e-12
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 9e-08
2cqp_A98 RNA-binding protein 12; RNA recognition motif, RRM 3e-15
2hgm_A126 HNRPF protein, heterogeneous nuclear ribonucleopro 3e-15
3v30_A172 DNA-binding protein rfxank; structural genomics co 4e-15
3v30_A172 DNA-binding protein rfxank; structural genomics co 3e-14
3v30_A172 DNA-binding protein rfxank; structural genomics co 1e-11
3v30_A 172 DNA-binding protein rfxank; structural genomics co 1e-07
2xnq_A97 Nuclear polyadenylated RNA-binding protein 3; tran 4e-15
3v31_A167 Ankyrin repeat family A protein 2; structural geno 4e-15
3v31_A167 Ankyrin repeat family A protein 2; structural geno 2e-14
3v31_A 167 Ankyrin repeat family A protein 2; structural geno 2e-09
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 4e-15
2fo1_E 373 LIN-12 protein; beta-barrel, protein-DNA complex, 2e-10
2fo1_E 373 LIN-12 protein; beta-barrel, protein-DNA complex, 3e-10
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 5e-10
2fo1_E 373 LIN-12 protein; beta-barrel, protein-DNA complex, 1e-09
2fo1_E 373 LIN-12 protein; beta-barrel, protein-DNA complex, 3e-08
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 1e-05
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 6e-15
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 7e-13
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 3e-10
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 3e-07
2i2y_A150 Fusion protein consists of immunoglobin G- binding 6e-15
2dhx_A104 Poly (ADP-ribose) polymerase family, member 10 var 1e-14
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 1e-14
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 1e-13
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 9e-11
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 2e-14
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 3e-13
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 6e-12
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 2e-14
1wdy_A 285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 1e-11
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 8e-11
1wdy_A 285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 1e-09
1wdy_A 285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 3e-08
3hra_A201 Ankyrin repeat family protein; structural protein; 2e-14
3hra_A201 Ankyrin repeat family protein; structural protein; 1e-12
3hra_A 201 Ankyrin repeat family protein; structural protein; 2e-12
3hra_A201 Ankyrin repeat family protein; structural protein; 9e-12
3hra_A201 Ankyrin repeat family protein; structural protein; 5e-04
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 2e-14
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 4e-13
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 9e-08
1wf1_A110 RNA-binding protein RALY; structural genomics, RRM 3e-14
2dhg_A104 TRNA selenocysteine associated protein (SECP43); R 3e-14
2vge_A 229 RELA-associated inhibitor; iaspp, nucleus, apoptos 3e-14
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 6e-08
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 5e-14
3ljn_A 364 Hypothetical protein; ankyrin, structural genomics 2e-13
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 3e-12
3ljn_A 364 Hypothetical protein; ankyrin, structural genomics 9e-10
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 2e-09
3ljn_A 364 Hypothetical protein; ankyrin, structural genomics 7e-07
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 7e-14
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 7e-13
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 5e-12
2dzn_A 228 Probable 26S proteasome regulatory subunit P28; an 3e-11
2dzn_A 228 Probable 26S proteasome regulatory subunit P28; an 6e-08
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 9e-14
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 7e-13
3b7b_A 237 Euchromatic histone-lysine N-methyltransferase 1; 2e-12
3b7b_A 237 Euchromatic histone-lysine N-methyltransferase 1; 1e-11
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 1e-06
2dha_A123 FLJ20171 protein; RRM domain, structural genomics, 1e-13
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 1e-13
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 5e-12
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 4e-09
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 3e-05
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 2e-13
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 2e-13
1ihb_A 162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 5e-10
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 6e-09
1x4c_A108 Splicing factor, arginine/serine-rich 1; structura 2e-13
2dis_A109 Unnamed protein product; structural genomics, RRM 2e-13
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 2e-13
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 7e-12
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 1e-11
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 3e-09
3beg_B115 Splicing factor, arginine/serine-rich 1; kinase, S 2e-13
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 2e-13
1k1a_A 241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 6e-12
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 8e-12
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 3e-11
1k1a_A 241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 2e-10
1k1a_A 241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 2e-09
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 3e-13
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 2e-11
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 9e-08
2dnn_A109 RNA-binding protein 12; RRM domain, RBD, structura 3e-13
1awc_B153 Protein (GA binding protein beta 1); complex (tran 4e-13
1awc_B153 Protein (GA binding protein beta 1); complex (tran 1e-10
1awc_B153 Protein (GA binding protein beta 1); complex (tran 4e-09
1awc_B153 Protein (GA binding protein beta 1); complex (tran 5e-06
2dgu_A103 Heterogeneous nuclear ribonucleoprotein Q; RRM dom 4e-13
3lqv_A115 PRE-mRNA branch site protein P14; cysless mutant, 5e-13
2e5j_A97 Methenyltetrahydrofolate synthetase domain contain 6e-13
1ycs_B 239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 6e-13
1ycs_B 239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 1e-10
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 1e-09
1ycs_B 239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 4e-08
2cqi_A103 Nucleolysin TIAR; RNA recognition motif, RRM, RNA 6e-13
1wg1_A88 KIAA1579 protein, homolog EXC-7; RBD, structural g 6e-13
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 8e-13
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 4e-11
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 8e-11
2e44_A96 Insulin-like growth factor 2 mRNA binding protein 9e-13
2dgw_A91 Probable RNA-binding protein 19; RRM domain, struc 9e-13
3eu9_A 240 Huntingtin-interacting protein 14; epigenetics, an 1e-12
3eu9_A 240 Huntingtin-interacting protein 14; epigenetics, an 4e-12
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 1e-11
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 3e-11
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 9e-10
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 8e-05
2cpd_A99 Apobec-1 stimulating protein; RNA recognition moti 1e-12
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 1e-12
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 2e-12
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 1e-11
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 1e-10
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 1e-12
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 2e-11
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 5e-11
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 2e-04
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 2e-12
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 3e-11
1yyh_A 253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 1e-10
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 3e-06
1yyh_A 253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 9e-06
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 2e-12
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 3e-12
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 4e-12
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 3e-08
2jvr_A111 Nucleolar protein 3; RNA recognition motif, nucleu 3e-12
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 3e-12
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 3e-11
2f8y_A 223 Notch homolog 1, translocation-associated (drosoph 6e-11
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 8e-06
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 4e-12
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 5e-11
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 4e-08
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 2e-04
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 5e-12
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 3e-10
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 4e-05
2la4_A101 Nuclear and cytoplasmic polyadenylated RNA-bindin 5e-12
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 6e-12
2xai_A 261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 1e-11
2xai_A 261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 4e-11
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 1e-10
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 9e-09
2xai_A 261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 2e-08
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 4e-04
1x4g_A109 Nucleolysin TIAR; structural genomics, RRM domain, 6e-12
3deo_A183 Signal recognition particle 43 kDa protein; chloro 8e-12
3deo_A183 Signal recognition particle 43 kDa protein; chloro 2e-11
3deo_A183 Signal recognition particle 43 kDa protein; chloro 6e-08
3deo_A183 Signal recognition particle 43 kDa protein; chloro 2e-05
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 1e-11
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 7e-11
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 4e-09
1ikn_D 236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 5e-09
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 8e-09
1ikn_D 236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 9e-06
1wez_A102 HnRNP H', FTP-3, heterogeneous nuclear ribonucleop 1e-11
1s70_B 299 130 kDa myosin-binding subunit of smooth muscle my 2e-11
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 8e-11
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 3e-10
1s70_B 299 130 kDa myosin-binding subunit of smooth muscle my 2e-08
1s70_B 299 130 kDa myosin-binding subunit of smooth muscle my 8e-06
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 2e-11
3utm_A 351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 1e-10
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 1e-10
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 2e-08
3utm_A 351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 6e-08
3utm_A 351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 3e-06
2hgn_A139 Heterogeneous nuclear ribonucleoprotein F; RNA rec 2e-11
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 2e-11
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 3e-08
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 3e-08
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 1e-07
2cpi_A111 CCR4-NOT transcription complex subunit 4; RNA reco 2e-11
2aja_A 376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 2e-11
2aja_A 376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 5e-10
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 2e-06
2aja_A 376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 3e-04
3pgw_S437 U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM 2e-11
3d9h_A 285 CDNA FLJ77766, highly similar to HOMO sapiens anky 2e-11
3d9h_A 285 CDNA FLJ77766, highly similar to HOMO sapiens anky 5e-11
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 3e-10
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 1e-09
3d9h_A 285 CDNA FLJ77766, highly similar to HOMO sapiens anky 5e-09
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 2e-04
2db1_A118 Heterogeneous nuclear ribonucleoprotein F; RRM dom 2e-11
3tyt_A205 Heterogeneous nuclear ribonucleoprotein L; ferredo 2e-11
3tyt_A205 Heterogeneous nuclear ribonucleoprotein L; ferredo 4e-07
1nu4_A97 U1A RNA binding domain; RNA recognition motif, U1 3e-11
3egn_A143 RNA-binding protein 40; RNA recognition motif (RRM 4e-11
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 4e-11
3kea_A 285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 4e-11
3kea_A 285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 5e-10
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 2e-06
3pgw_A282 U1-A; protein-RNA complex, U1 snRNA, SM fold, SM c 5e-11
3pgw_A282 U1-A; protein-RNA complex, U1 snRNA, SM fold, SM c 9e-06
3ns6_A100 Eukaryotic translation initiation factor 3 subuni; 5e-11
1why_A97 Hypothetical protein riken cDNA 1810017N16; RNA re 6e-11
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 7e-11
3ui2_A 244 Signal recognition particle 43 kDa protein, chlor; 8e-11
3ui2_A 244 Signal recognition particle 43 kDa protein, chlor; 2e-07
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 1e-06
2ytc_A85 PRE-mRNA-splicing factor RBM22; RRM domain, RBD, s 8e-11
2nlw_A105 Eukaryotic translation initiation factor 3 subunit 2e-10
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 2e-10
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 2e-10
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 1e-09
1oy3_D 282 Transcription factor inhibitor I-kappa-B-beta; pro 3e-09
1oy3_D 282 Transcription factor inhibitor I-kappa-B-beta; pro 5e-08
1oy3_D 282 Transcription factor inhibitor I-kappa-B-beta; pro 4e-07
2hgl_A136 HNRPF protein, heterogeneous nuclear ribonucleopro 2e-10
2lmi_A107 GRSF-1, G-rich sequence factor 1; G-rich RNA seque 2e-10
2bz2_A121 Negative elongation factor E; NELF E, RNA recognit 3e-10
1x5p_A97 Negative elongation factor E; structure genomics, 5e-10
2adc_A229 Polypyrimidine tract-binding protein 1; RBD, RRM, 9e-10
2adc_A229 Polypyrimidine tract-binding protein 1; RBD, RRM, 2e-09
1wex_A104 Hypothetical protein (riken cDNA 2810036L13); stru 9e-10
2voo_A193 Lupus LA protein; RNA-binding protein, RNA recogni 9e-10
2etb_A256 Transient receptor potential cation channel subfam 1e-09
2etb_A 256 Transient receptor potential cation channel subfam 2e-07
2etb_A256 Transient receptor potential cation channel subfam 1e-06
2etb_A256 Transient receptor potential cation channel subfam 1e-06
2etb_A256 Transient receptor potential cation channel subfam 2e-05
3r27_A100 HnRNP L, heterogeneous nuclear ribonucleoprotein L 1e-09
1sw6_A327 Regulatory protein SWI6; transcription regulation, 1e-09
1sw6_A 327 Regulatory protein SWI6; transcription regulation, 4e-09
1sw6_A 327 Regulatory protein SWI6; transcription regulation, 6e-05
3aji_A 231 26S proteasome non-ATPase regulatory subunit 10; g 1e-09
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 4e-08
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 3e-07
2a3j_A127 U1 small nuclear ribonucleoprotein A; computationa 1e-09
1qm9_A198 Polypyrimidine tract-binding protein; ribonucleopr 2e-09
1qm9_A198 Polypyrimidine tract-binding protein; ribonucleopr 5e-09
2pnn_A 273 Transient receptor potential cation channel subfa 2e-09
2pnn_A273 Transient receptor potential cation channel subfa 3e-05
2pnn_A273 Transient receptor potential cation channel subfa 3e-05
2ad9_A119 Polypyrimidine tract-binding protein 1; RBD, RRM, 4e-09
1sjq_A105 Polypyrimidine tract-binding protein 1; babbab mot 6e-09
1whx_A111 Hypothetical protein riken cDNA 1200009A02; RNA re 7e-09
2krb_A81 Eukaryotic translation initiation factor 3 subunit 1e-08
2cq1_A101 PTB-like protein L; RRM domain, structural genomic 2e-08
2rfa_A 232 Transient receptor potential cation channel subfa 3e-08
2rfa_A232 Transient receptor potential cation channel subfa 4e-07
2rfa_A232 Transient receptor potential cation channel subfa 1e-05
2rfa_A232 Transient receptor potential cation channel subfa 1e-05
2rfa_A 232 Transient receptor potential cation channel subfa 2e-05
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 5e-08
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 1e-07
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 1e-04
3jxi_A260 Vanilloid receptor-related osmotically activated p 2e-07
3jxi_A260 Vanilloid receptor-related osmotically activated p 6e-05
3jxi_A260 Vanilloid receptor-related osmotically activated p 9e-05
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 2e-07
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 2e-05
1x4f_A112 Matrin 3; structural genomics, RRM domain, NPPSFA, 3e-07
2cq2_A114 Hypothetical protein LOC91801; RRM domain, structu 5e-07
1qzv_F154 Plant photosystem I: subunit PSAF; photosynthesis, 5e-05
3lvq_E 497 ARF-GAP with SH3 domain, ANK repeat and PH domain 2e-04
1sjr_A164 Polypyrimidine tract-binding protein 1; extended b 3e-04
3zzy_A130 Polypyrimidine tract-binding protein 1; protein bi 5e-04
>2dgs_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 99 Back     alignment and structure
 Score =  106 bits (266), Expect = 8e-29
 Identities = 23/75 (30%), Positives = 45/75 (60%)

Query: 2  SNSIRQLNKIFVGNLPWTVSHNELKKFFSEYGQIMNASVMFDKNTGLSKGFGFVTFQNKE 61
           +S  + NKIFVG +P      EL+++F ++G +    +++D      +GFGF+TF++++
Sbjct: 4  GSSGSKSNKIFVGGIPHNCGETELREYFKKFGVVTEVVMIYDAEKQRPRGFGFITFEDEQ 63

Query: 62 AVDKVFSTDSHVLEG 76
          +VD+  +   H + G
Sbjct: 64 SVDQAVNMHFHDIMG 78


>2cqd_A RNA-binding region containing protein 1; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 116 Back     alignment and structure
>2mss_A Protein (musashi1); RNA-binding domain, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 PDB: 2mst_A Length = 75 Back     alignment and structure
>2cjk_A Nuclear polyadenylated RNA-binding protein 4; HRP1, RNA-binding, RNA processing, mRNA processing, nonsense-mediated mRNA decay, cleavage; NMR {Saccharomyces cerevisiae} PDB: 2km8_C Length = 167 Back     alignment and structure
>2cjk_A Nuclear polyadenylated RNA-binding protein 4; HRP1, RNA-binding, RNA processing, mRNA processing, nonsense-mediated mRNA decay, cleavage; NMR {Saccharomyces cerevisiae} PDB: 2km8_C Length = 167 Back     alignment and structure
>1l3k_A Heterogeneous nuclear ribonucleoprotein A1; nuclear protein hnRNP A1, RNA-recognition motif, RNA- binding, UP1, RNA binding protein; 1.10A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1u1k_A* 1u1l_A* 1u1m_A* 1u1n_A* 1u1o_A 1u1p_A* 1u1q_A 1u1r_A* 1pgz_A* 1ha1_A 1po6_A* 2up1_A* 1up1_A Length = 196 Back     alignment and structure
>1l3k_A Heterogeneous nuclear ribonucleoprotein A1; nuclear protein hnRNP A1, RNA-recognition motif, RNA- binding, UP1, RNA binding protein; 1.10A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1u1k_A* 1u1l_A* 1u1m_A* 1u1n_A* 1u1o_A 1u1p_A* 1u1q_A 1u1r_A* 1pgz_A* 1ha1_A 1po6_A* 2up1_A* 1up1_A Length = 196 Back     alignment and structure
>2cqu_A Peroxisomal D3,D2-enoyl-COA isomerase; acyl-COA binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 116 Back     alignment and structure
>1x4b_A Heterogeneous nuclear ribonucleoproteins A2/B1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 116 Back     alignment and structure
>1iqt_A AUF1, heterogeneous nuclear ribonucleoprotein D0; RNA-binding protein, hnRNP, telomere, DNA-binding protein, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wtb_A 1x0f_A Length = 75 Back     alignment and structure
>2rs2_A Musashi-1, RNA-binding protein musashi homolog 1; protein-RNA complex, RRM, RBD, RNA binding protein- complex; NMR {Mus musculus} Length = 109 Back     alignment and structure
>2cop_A Acyl-coenzyme A binding domain containing 6; acyl COA binding protein, COA binding protein, lipid binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 109 Back     alignment and structure
>1uaw_A Mouse-musashi-1; RNP-type structure, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 Length = 77 Back     alignment and structure
>2dh8_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 105 Back     alignment and structure
>1hbk_A ACBP, acyl-COA binding protein; fatty acid metabolism; HET: COA MYR; 2.0A {Plasmodium falciparum} SCOP: a.11.1.1 Length = 89 Back     alignment and structure
>2cqg_A TDP-43, TAR DNA-binding protein-43; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>3s7r_A Heterogeneous nuclear ribonucleoprotein A/B; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 2.15A {Homo sapiens} PDB: 1hd0_A 1hd1_A Length = 87 Back     alignment and structure
>2lbb_A Acyl COA binding protein; protein binding, structural genomi seattle structural genomics center for infectious disease,; NMR {Babesia bovis} Length = 96 Back     alignment and structure
>2cb8_A Acyl-COA-binding protein; acyl-coenzyme A binding protein, fatty acid, acetylation, alternative splicing, lipid-binding, transport; HET: MYA; 1.4A {Homo sapiens} PDB: 2fj9_A 1aca_A* 1hb6_A 1hb8_A 1nti_A 1nvl_A* 2abd_A 2fdq_A Length = 87 Back     alignment and structure
>2cq4_A RNA binding motif protein 23; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 114 Back     alignment and structure
>1st7_A ACBP, acyl-COA-binding protein; four helix bundle, transport protein; NMR {Saccharomyces cerevisiae} Length = 86 Back     alignment and structure
>2xs2_A Deleted in azoospermia-like; RNA binding protein-RNA complex; 1.35A {Mus musculus} PDB: 2xs7_A 2xs5_A 2xsf_A Length = 102 Back     alignment and structure
>3epy_A Acyl-COA-binding domain-containing protein 7; acyl-COA binding protein, fatty acid, lipid metabolism, structural genomics; HET: COA PLM; 2.00A {Homo sapiens} Length = 89 Back     alignment and structure
>1x4h_A RNA-binding protein 28; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Length = 111 Back     alignment and structure
>3fp5_A Acyl-COA binding protein; ACBP, cacao disease, fatty acid metabolism, lipid binding protein; HET: MES; 1.61A {Moniliophthora perniciosa} Length = 106 Back     alignment and structure
>3flv_A Acyl-COA-binding domain-containing protein 5; lipid binding, structural genomics, struct genomics consortium, SGC, lipid-binding, membrane; HET: STE COA; 1.70A {Homo sapiens} Length = 119 Back     alignment and structure
>3ucg_A Polyadenylate-binding protein 2; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative; HET: PGE; 1.95A {Homo sapiens} PDB: 3b4d_A 3b4m_A Length = 89 Back     alignment and structure
>2e5g_A U6 snRNA-specific terminal uridylyltransferase 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 94 Back     alignment and structure
>1x5s_A Cold-inducible RNA-binding protein; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 102 Back     alignment and structure
>2g4b_A Splicing factor U2AF 65 kDa subunit; protein-RNA complex, RNA splicing factor, RNA recognition motif, RNA binding protein/RNA complex; 2.50A {Homo sapiens} PDB: 2u2f_A Length = 172 Back     alignment and structure
>2g4b_A Splicing factor U2AF 65 kDa subunit; protein-RNA complex, RNA splicing factor, RNA recognition motif, RNA binding protein/RNA complex; 2.50A {Homo sapiens} PDB: 2u2f_A Length = 172 Back     alignment and structure
>2jwn_A Embryonic polyadenylate-binding protein 2-B; epabp2, poly(A) binding, structural genomics, protein structure initiative, PSI-2; NMR {Xenopus laevis} Length = 124 Back     alignment and structure
>2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A Length = 216 Back     alignment and structure
>2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A Length = 216 Back     alignment and structure
>2wh5_A Acyl-COA-binding domain-containing protein 4; alternative splicing, fatty acid metabolism, lipid transport, lipid binding protein; HET: STE ST9 COA; 2.60A {Homo sapiens} Length = 106 Back     alignment and structure
>2dgp_A Bruno-like 4, RNA binding protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dgq_A Length = 106 Back     alignment and structure
>1whw_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Length = 99 Back     alignment and structure
>2e5h_A Zinc finger CCHC-type and RNA-binding motif- containing protein 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 94 Back     alignment and structure
>3md1_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RBD, RNP, poly(U) binding, nucleus, RNA-binding, binding protein; 1.60A {Saccharomyces cerevisiae} Length = 83 Back     alignment and structure
>1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A Length = 167 Back     alignment and structure
>1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A Length = 167 Back     alignment and structure
>2lea_A Serine/arginine-rich splicing factor 2; SR protein, RNA binding protein; NMR {Homo sapiens} PDB: 2leb_A 2lec_A Length = 135 Back     alignment and structure
>1x4e_A RNA binding motif, single-stranded interacting protein 2; structural genomics, RRM domain, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 85 Back     alignment and structure
>1wf0_A TDP-43, TAR DNA-binding protein-43; structural genomics, RRM domain, riken structural genomics/proteomics initiative RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 88 Back     alignment and structure
>2dnz_A Probable RNA-binding protein 23; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>1p1t_A Cleavage stimulation factor, 64 kDa subunit; RNA recognition motif, C-terminal helix, N-terminal helix, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 104 Back     alignment and structure
>3bs9_A Nucleolysin TIA-1 isoform P40; RNA recognition motif, RRM, RNA binding domain, RBD, RNA splicing, apoptosis, phosphoprotein, RNA-binding; 1.95A {Homo sapiens} Length = 87 Back     alignment and structure
>2cqc_A Arginine/serine-rich splicing factor 10; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 95 Back     alignment and structure
>2do4_A Squamous cell carcinoma antigen recognized by T- cells 3; RRM domaim, RDB, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2yh0_A Splicing factor U2AF 65 kDa subunit; PRE-mRNA splicing, transcription, RNA binding protein, mRNA processing; NMR {Homo sapiens} PDB: 2yh1_A Length = 198 Back     alignment and structure
>2yh0_A Splicing factor U2AF 65 kDa subunit; PRE-mRNA splicing, transcription, RNA binding protein, mRNA processing; NMR {Homo sapiens} PDB: 2yh1_A Length = 198 Back     alignment and structure
>1fje_B Nucleolin RBD12, protein C23; RNP, RRM, RNA binding domain, RNA-protein complex, nucleolus, structural protein/RNA complex; NMR {Mesocricetus auratus} SCOP: d.58.7.1 d.58.7.1 PDB: 1rkj_A 2krr_A Length = 175 Back     alignment and structure
>1fje_B Nucleolin RBD12, protein C23; RNP, RRM, RNA binding domain, RNA-protein complex, nucleolus, structural protein/RNA complex; NMR {Mesocricetus auratus} SCOP: d.58.7.1 d.58.7.1 PDB: 1rkj_A 2krr_A Length = 175 Back     alignment and structure
>2ki2_A SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA binding proteins, RNA binding protein/SS-DNA binding protein complex; NMR {Helicobacter pylori} Length = 90 Back     alignment and structure
>1b7f_A Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP*GP*UP*UP*UP*UP*UP*UP*UP*U)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A Length = 168 Back     alignment and structure
>1b7f_A Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP*GP*UP*UP*UP*UP*UP*UP*UP*U)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A Length = 168 Back     alignment and structure
>2kxn_B Transformer-2 protein homolog beta; SR protein, RRM, splicing factor, RNA protein complex, SMN, binding protein-RNA complex; NMR {Homo sapiens} PDB: 2rra_A 2rrb_A Length = 129 Back     alignment and structure
>1u6f_A Tcubp1, RNA-binding protein UBP1; trypanosome, mRNA-binding protein, GU-rich RNA, structure; NMR {Trypanosoma cruzi} SCOP: d.58.7.1 Length = 139 Back     alignment and structure
>2fy1_A RNA-binding motif protein, Y chromosome, family 1 member A1; RNA binding protein, structure, protein-RNA complex, RNA stem-loop, structural protein/RNA complex; NMR {Homo sapiens} Length = 116 Back     alignment and structure
>2do0_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RNA recognition motif, RRM, RNA binding domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 114 Back     alignment and structure
>2dgo_A Cytotoxic granule-associated RNA binding protein 1; RRM domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2rne_A 2dh7_A Length = 115 Back     alignment and structure
>2cqb_A Peptidyl-prolyl CIS-trans isomerase E; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 102 Back     alignment and structure
>2khc_A Testis-specific RNP-type RNA binding protein; RRM, RNA recognition motif, bruno; NMR {Drosophila melanogaster} Length = 118 Back     alignment and structure
>3mdf_A Peptidyl-prolyl CIS-trans isomerase E; RRM domain, PHD finger, CYP33, MLL, RNA binding protein, ALT splicing, mRNA processing, mRNA splicing; 1.85A {Homo sapiens} PDB: 2kyx_A 3lpy_A* Length = 85 Back     alignment and structure
>2dnm_A SRP46 splicing factor; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 103 Back     alignment and structure
>3d2w_A TAR DNA-binding protein 43; DP-43 proteinopathy, TDP-43 inclusions, RNA recognition MOTI U, ALS, RRM; HET: DNA; 1.65A {Mus musculus} Length = 89 Back     alignment and structure
>2cpz_A CUG triplet repeat RNA-binding protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2rq4_A 2rqc_A Length = 115 Back     alignment and structure
>2cq0_A Eukaryotic translation initiation factor 3 subunit 4; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>3md3_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNP, RBD, poly(U) binding, tandem, acetylation, cytopla nucleus; 2.70A {Saccharomyces cerevisiae} Length = 166 Back     alignment and structure
>3md3_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNP, RBD, poly(U) binding, tandem, acetylation, cytopla nucleus; 2.70A {Saccharomyces cerevisiae} Length = 166 Back     alignment and structure
>3s8s_A Histone-lysine N-methyltransferase SETD1A; chromatin modification, transcription regulation, structural genomics, structural genomics consortium; 1.30A {Homo sapiens} Length = 110 Back     alignment and structure
>2kn4_A Immunoglobulin G-binding protein G, splicing FACT arginine/serine-rich 2, S35, splicing factor SC35,; RRM domain, cell WALL; NMR {Streptococcus SP} Length = 158 Back     alignment and structure
>2cpf_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 98 Back     alignment and structure
>2jrs_A RNA-binding protein 39; RNA binding motif of RBM39_human (caper), RRM2 domain, solution structure, structural genomics, PSI-2; NMR {Homo sapiens} Length = 108 Back     alignment and structure
>3n9u_C Cleavage and polyadenylation specificity factor S; protein-protein complex, coexpression, heterotetramer, mRNA maturation, mRNA cleavage; 1.92A {Homo sapiens} Length = 156 Back     alignment and structure
>2x1f_A MRNA 3'-END-processing protein RNA15; transcription-RNA complex, mRNA processing; 1.60A {Saccharomyces cerevisiae} PDB: 2x1b_A 2x1a_A 2km8_B Length = 96 Back     alignment and structure
>2ku7_A MLL1 PHD3-CYP33 RRM chimeric protein; transcriptional regulation, RRM domain, transcr; NMR {Homo sapiens} Length = 140 Back     alignment and structure
>2cq3_A RNA-binding protein 9; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>2err_A Ataxin-2-binding protein 1; protein-RNA complex, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109 Back     alignment and structure
>4a8x_A RNA-binding protein with serine-rich domain 1; transcription, splicing, RNA processing, nonsense mediated D NMD, HDAC, histone deacetylation; 1.90A {Homo sapiens} Length = 88 Back     alignment and structure
>3sde_A Paraspeckle component 1; RRM, anti parallel right handed coiled-coil, NOPS, DBHS, RNA protein, RNA binding; 1.90A {Homo sapiens} PDB: 3sde_B Length = 261 Back     alignment and structure
>3sde_A Paraspeckle component 1; RRM, anti parallel right handed coiled-coil, NOPS, DBHS, RNA protein, RNA binding; 1.90A {Homo sapiens} PDB: 3sde_B Length = 261 Back     alignment and structure
>1fj7_A Nucleolin RBD1, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Length = 101 Back     alignment and structure
>3nmr_A Cugbp ELAV-like family member 1; RRM, PRE-mRNA splicing, RNA binding protein-RNA complex; 1.85A {Homo sapiens} PDB: 3nna_A 3nnc_A 2dhs_A 3nnh_A Length = 175 Back     alignment and structure
>3nmr_A Cugbp ELAV-like family member 1; RRM, PRE-mRNA splicing, RNA binding protein-RNA complex; 1.85A {Homo sapiens} PDB: 3nna_A 3nnc_A 2dhs_A 3nnh_A Length = 175 Back     alignment and structure
>2cph_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 107 Back     alignment and structure
>2dng_A Eukaryotic translation initiation factor 4H; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Length = 103 Back     alignment and structure
>3ulh_A THO complex subunit 4; nuclear protein, RNA binding, structural genomi center for structural genomics, JCSG, protein structure INI PSI-biology; 2.54A {Homo sapiens} PDB: 1no8_A Length = 107 Back     alignment and structure
>3ex7_B RNA-binding protein 8A; protein-RNA complex, mRNA processing, mRNA splicing, mRNA transport, nonsense-mediated mRNA decay, nucleus; HET: ADP; 2.30A {Homo sapiens} PDB: 2j0q_D* Length = 126 Back     alignment and structure
>1x5u_A Splicing factor 3B subunit 4 (spliceosome associated protein 49) (SAP 49) (SF3B50)...; structure genomics,RRM domain,splicing factor 3B; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 105 Back     alignment and structure
>2d9p_A Polyadenylate-binding protein 3; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 103 Back     alignment and structure
>1p27_B RNA-binding protein 8A; nuclear protein, mRNA splicing; 2.00A {Homo sapiens} SCOP: d.58.7.1 Length = 106 Back     alignment and structure
>1x5o_A RNA binding motif, single-stranded interacting protein 1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 114 Back     alignment and structure
>2dgv_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2dh9_A Length = 92 Back     alignment and structure
>2dgt_A RNA-binding protein 30; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 92 Back     alignment and structure
>2kt5_A RNA and export factor-binding protein 2; chaperone, mRNA processing, mRNA splicing, transport, nucleus, RNA-binding, spliceosome, transport; NMR {Mus musculus} Length = 124 Back     alignment and structure
>2ywk_A Putative RNA-binding protein 11; RRM-domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.54A {Homo sapiens} Length = 95 Back     alignment and structure
>1x5t_A Splicing factor 3B subunit 4; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 96 Back     alignment and structure
>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3h2u_B 3h2v_E Length = 284 Back     alignment and structure
>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3h2u_B 3h2v_E Length = 284 Back     alignment and structure
>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3h2u_B 3h2v_E Length = 284 Back     alignment and structure
>2la6_A RNA-binding protein FUS; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, RNA recognition; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>3p5t_L Cleavage and polyadenylation specificity factor S; RRM domain, poly(A) site recognition, RNA, nuclear, RNA BIND protein; 2.70A {Homo sapiens} PDB: 3p6y_C Length = 90 Back     alignment and structure
>3q2s_C Cleavage and polyadenylation specificity factor S; CFIM, CFIM25, CFIM68, CPSF5, CPSF6, CPSF, 3' END processing, processing, cleavage factor; 2.90A {Homo sapiens} PDB: 3q2t_C Length = 229 Back     alignment and structure
>2hvz_A Splicing factor, arginine/serine-rich 7; RRM, RNA binding protein; NMR {Homo sapiens} Length = 101 Back     alignment and structure
>2f3j_A RNA and export factor binding protein 2; RRM domain, RBD domain., transport protein; NMR {Mus musculus} Length = 177 Back     alignment and structure
>1oo0_B CG8781-PA, drosophila Y14; RNA recognition motif, splicing, protein complex, EXON junct complex, signaling protein; 1.85A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 2hyi_B* 2j0s_D* 2xb2_D* Length = 110 Back     alignment and structure
>2dnq_A RNA-binding protein 4B; RRM domain,RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 90 Back     alignment and structure
>4f25_A Polyadenylate-binding protein 1; RRM fold, translation initiation, RNA-binding, EIF4G-binding translation; 1.90A {Homo sapiens} PDB: 4f26_A 2k8g_A Length = 115 Back     alignment and structure
>2dnp_A RNA-binding protein 14; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 90 Back     alignment and structure
>1x4a_A Splicing factor, arginine/serine-rich 1 (splicing factor 2, alternate splicing factor)...; structure genomics, SURP domain, splicing factor SF2; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109 Back     alignment and structure
>2cpx_A Hypothetical protein FLJ11016; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 115 Back     alignment and structure
>2dnl_A Cytoplasmic polyadenylation element binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 114 Back     alignment and structure
>1fjc_A Nucleolin RBD2, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Length = 96 Back     alignment and structure
>2dnh_A Bruno-like 5, RNA binding protein; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dnk_A 2dno_A Length = 105 Back     alignment and structure
>2lkz_A RNA-binding protein 5; RRM; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>2cpe_A RNA-binding protein EWS; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 113 Back     alignment and structure
>2lcw_A RNA-binding protein FUS; RRM, nucleic acid binding protein; NMR {Homo sapiens} Length = 116 Back     alignment and structure
>1wi8_A EIF-4B, eukaryotic translation initiation factor 4B; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 104 Back     alignment and structure
>2j76_E EIF-4B, EIF4B, eukaryotic translation initiation factor 4B; protein biosynthesis, RNA recognition motif, RNA binding domain, RRM, RBD, RNP; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2cpy_A RNA-binding protein 12; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 114 Back     alignment and structure
>1rk8_A CG8781-PA, CG8781-PA protein; mRNA processing, RRM, RBD, NMD, oskar mRNA localization, translation; 1.90A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 1hl6_A 2x1g_A Length = 165 Back     alignment and structure
>2fc9_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 101 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>2fc8_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 102 Back     alignment and structure
>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Length = 292 Back     alignment and structure
>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Length = 292 Back     alignment and structure
>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Length = 292 Back     alignment and structure
>1h2v_Z 20 kDa nuclear CAP binding protein; CAP-binding-complex, RNP domain, MIF4G domain, RNA maturation, RNA export, nuclear protein, RNA-binding; 2.0A {Homo sapiens} SCOP: d.58.7.1 PDB: 1h2u_X* 1h2t_Z 1n52_B* 1n54_B 3fex_B 3fey_B 1h6k_X Length = 156 Back     alignment and structure
>4f02_A Polyadenylate-binding protein 1; mRNA, eukaryotic initiation factors PAIP1 and PAIP2, translation-RNA complex; 2.00A {Homo sapiens} PDB: 1cvj_A* Length = 213 Back     alignment and structure
>4f02_A Polyadenylate-binding protein 1; mRNA, eukaryotic initiation factors PAIP1 and PAIP2, translation-RNA complex; 2.00A {Homo sapiens} PDB: 1cvj_A* Length = 213 Back     alignment and structure
>1s79_A Lupus LA protein; RRM, alpha/beta, RNA binding protein, translation; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>1wel_A RNA-binding protein 12; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 124 Back     alignment and structure
>2ek1_A RNA-binding protein 12; RNA recognition motif, dimer, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.00A {Homo sapiens} PDB: 2ek6_A Length = 95 Back     alignment and structure
>2cqh_A IGF-II mRNA-binding protein 2 isoform A; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 93 Back     alignment and structure
>2cpj_A Non-POU domain-containing octamer-binding protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 99 Back     alignment and structure
>1wg5_A Heterogeneous nuclear ribonucleoprotein H; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 104 Back     alignment and structure
>2jvo_A Nucleolar protein 3; nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding, rRNA processing; NMR {Saccharomyces cerevisiae} PDB: 2osq_A Length = 108 Back     alignment and structure
>2hzc_A Splicing factor U2AF 65 kDa subunit; RNA splicing, RRM, RNA recognition, alternative conformation binding protein; HET: P6G; 1.47A {Homo sapiens} PDB: 1u2f_A Length = 87 Back     alignment and structure
>2kvi_A Nuclear polyadenylated RNA-binding protein 3; RNA-binding motif, RRM, transcription termination, NUC phosphoprotein; NMR {Saccharomyces cerevisiae} Length = 96 Back     alignment and structure
>2div_A TRNA selenocysteine associated protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>2cqp_A RNA-binding protein 12; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 98 Back     alignment and structure
>2hgm_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg0_A Length = 126 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>2xnq_A Nuclear polyadenylated RNA-binding protein 3; transcription termination, RNA processi recognition, RRM; HET: CAF; 1.30A {Saccharomyces cerevisiae} PDB: 2xnr_A 2l41_A Length = 97 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>2i2y_A Fusion protein consists of immunoglobin G- binding protein G and splicing factor,...; protein-RNA complex RRM alpha-beta sandwich BETA1-alpha1- BETA2-BETA3-alpha2-BETA4; NMR {Streptococcus SP} PDB: 2i38_A Length = 150 Back     alignment and structure
>2dhx_A Poly (ADP-ribose) polymerase family, member 10 variant; RRM domain, RNA- binding, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 104 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1wf1_A RNA-binding protein RALY; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wf2_A Length = 110 Back     alignment and structure
>2dhg_A TRNA selenocysteine associated protein (SECP43); RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 104 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>2dha_A FLJ20171 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 123 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1x4c_A Splicing factor, arginine/serine-rich 1; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Length = 108 Back     alignment and structure
>2dis_A Unnamed protein product; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>3beg_B Splicing factor, arginine/serine-rich 1; kinase, SR protein kinase, SR protein, PRE-mRNA splicing, at binding, chromosome partition; HET: SEP ANP; 2.90A {Homo sapiens} SCOP: d.58.7.1 PDB: 2o3d_A 1wg4_A Length = 115 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>2dnn_A RNA-binding protein 12; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 109 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>2dgu_A Heterogeneous nuclear ribonucleoprotein Q; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dk2_A Length = 103 Back     alignment and structure
>3lqv_A PRE-mRNA branch site protein P14; cysless mutant, PRE-mRNA splicing, adenine, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: ADE; 2.38A {Homo sapiens} PDB: 2f9d_A 2f9j_A 2fho_B Length = 115 Back     alignment and structure
>2e5j_A Methenyltetrahydrofolate synthetase domain containing; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 97 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>2cqi_A Nucleolysin TIAR; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, ST genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>1wg1_A KIAA1579 protein, homolog EXC-7; RBD, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wi6_A Length = 88 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>2e44_A Insulin-like growth factor 2 mRNA binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 96 Back     alignment and structure
>2dgw_A Probable RNA-binding protein 19; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 91 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>2cpd_A Apobec-1 stimulating protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 99 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>2jvr_A Nucleolar protein 3; RNA recognition motif, nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding; NMR {Saccharomyces cerevisiae} PDB: 2osr_A Length = 111 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>2la4_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNA recognition, stress granules, nucleus, RNA-binding, transcription; NMR {Saccharomyces cerevisiae} Length = 101 Back     alignment and structure
>1x4g_A Nucleolysin TIAR; structural genomics, RRM domain, TIA-1 related protein, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1wez_A HnRNP H', FTP-3, heterogeneous nuclear ribonucleoprotein H'; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 102 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>2hgn_A Heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg1_A Length = 139 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>2cpi_A CCR4-NOT transcription complex subunit 4; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 111 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>3pgw_S U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_K 2l5i_A 2l5j_A* Length = 437 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>2db1_A Heterogeneous nuclear ribonucleoprotein F; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 118 Back     alignment and structure
>3tyt_A Heterogeneous nuclear ribonucleoprotein L; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 1.60A {Mus musculus} PDB: 3s01_A 3to8_A Length = 205 Back     alignment and structure
>3tyt_A Heterogeneous nuclear ribonucleoprotein L; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 1.60A {Mus musculus} PDB: 3s01_A 3to8_A Length = 205 Back     alignment and structure
>1nu4_A U1A RNA binding domain; RNA recognition motif, U1 small nuclear ribonucleoprotein, R binding domain, RNA binding protein; HET: MLA; 1.80A {Homo sapiens} SCOP: d.58.7.1 PDB: 1drz_A* 1urn_A 3hhn_B* 3egz_A* 1zzn_A* 1u6b_A* 3cun_A* 3cul_A* 3g8s_A* 3g8t_A* 3g96_A* 3g9c_A* 3irw_P* 3mum_P* 3mur_P* 3mut_P* 3muv_P* 3mxh_P* 3p49_B 3r1h_A* ... Length = 97 Back     alignment and structure
>3egn_A RNA-binding protein 40; RNA recognition motif (RRM), RNP motif, U11/U12-65K protein, DI-snRNP, U1A protein, U2B protein; 2.50A {Homo sapiens} Length = 143 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3pgw_A U1-A; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 1fht_A 2u1a_A 2aym_A 2b0g_A Length = 282 Back     alignment and structure
>3pgw_A U1-A; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 1fht_A 2u1a_A 2aym_A 2b0g_A Length = 282 Back     alignment and structure
>3ns6_A Eukaryotic translation initiation factor 3 subuni; 1.25A {Saccharomyces cerevisiae} PDB: 3ns5_A Length = 100 Back     alignment and structure
>1why_A Hypothetical protein riken cDNA 1810017N16; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Length = 97 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>2ytc_A PRE-mRNA-splicing factor RBM22; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 85 Back     alignment and structure
>2nlw_A Eukaryotic translation initiation factor 3 subunit 9; eukaryotic initiation factor 3 complex, RNA recognition motif; NMR {Homo sapiens} Length = 105 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>2hgl_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative, splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kfy_A Length = 136 Back     alignment and structure
>2lmi_A GRSF-1, G-rich sequence factor 1; G-rich RNA sequence binding factor, RNA binding domain, STRU genomics, joint center for structural genomics, JCSG; NMR {Homo sapiens} Length = 107 Back     alignment and structure
>1x5p_A Negative elongation factor E; structure genomics, RRM domain, PARP14, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 97 Back     alignment and structure
>2adc_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 2evz_A Length = 229 Back     alignment and structure
>2adc_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 2evz_A Length = 229 Back     alignment and structure
>1wex_A Hypothetical protein (riken cDNA 2810036L13); structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.58.7.1 Length = 104 Back     alignment and structure
>2voo_A Lupus LA protein; RNA-binding protein, RNA recognition motif, systemic lupus erythematosus, phosphoprotein, RNA maturation; 1.8A {Homo sapiens} SCOP: a.4.5.46 d.58.7.1 PDB: 2von_A 2vod_A 2vop_A 1zh5_A 1yty_A 1s7a_A Length = 193 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>3r27_A HnRNP L, heterogeneous nuclear ribonucleoprotein L; RBD fold, protein binding, nucleus; 2.04A {Homo sapiens} Length = 100 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>2a3j_A U1 small nuclear ribonucleoprotein A; computationally designed protein, RRM, U1A, RNA binding protein; NMR {Homo sapiens} Length = 127 Back     alignment and structure
>1qm9_A Polypyrimidine tract-binding protein; ribonucleoprotein, RNP, RNA, spicing, translation; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 Length = 198 Back     alignment and structure
>1qm9_A Polypyrimidine tract-binding protein; ribonucleoprotein, RNP, RNA, spicing, translation; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 Length = 198 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2ad9_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 119 Back     alignment and structure
>1sjq_A Polypyrimidine tract-binding protein 1; babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 105 Back     alignment and structure
>1whx_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Length = 111 Back     alignment and structure
>2krb_A Eukaryotic translation initiation factor 3 subunit B; EIF3, eukaryotic initiation factor, EIF3B, EIF3J; NMR {Homo sapiens} Length = 81 Back     alignment and structure
>2cq1_A PTB-like protein L; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 101 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Length = 301 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} Length = 368 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} Length = 368 Back     alignment and structure
>1x4f_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Length = 112 Back     alignment and structure
>2cq2_A Hypothetical protein LOC91801; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 114 Back     alignment and structure
>1qzv_F Plant photosystem I: subunit PSAF; photosynthesis,plant photosynthetic reaction center, peripheral antenna; HET: CL1 PQN; 4.44A {Pisum sativum} SCOP: i.5.1.1 Length = 154 Back     alignment and structure
>3lvq_E ARF-GAP with SH3 domain, ANK repeat and PH domain containing protein 3, ADP-ribosylation...; GDP, ASAP3, UPLC1, linkers, alternat splicing; HET: GDP; 3.38A {Homo sapiens} PDB: 3lvr_E* Length = 497 Back     alignment and structure
>1sjr_A Polypyrimidine tract-binding protein 1; extended babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2adb_A Length = 164 Back     alignment and structure
>3zzy_A Polypyrimidine tract-binding protein 1; protein binding, peptide binding, RNA recognition motif; 1.40A {Homo sapiens} PDB: 3zzz_A Length = 130 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query347
1l3k_A196 Heterogeneous nuclear ribonucleoprotein A1; nuclea 99.9
4f02_A213 Polyadenylate-binding protein 1; mRNA, eukaryotic 99.9
1fxl_A167 Paraneoplastic encephalomyelitis antigen HUD; prot 99.89
1b7f_A168 Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP 99.88
2cjk_A167 Nuclear polyadenylated RNA-binding protein 4; HRP1 99.88
3md3_A166 Nuclear and cytoplasmic polyadenylated RNA-bindin 99.87
2qfj_A216 FBP-interacting repressor; protein-DNA complex; HE 99.87
4gpm_A169 Engineered protein OR264; de novo protein, structu 99.87
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 99.86
4f25_A115 Polyadenylate-binding protein 1; RRM fold, transla 99.86
1hbk_A89 ACBP, acyl-COA binding protein; fatty acid metabol 99.86
3nmr_A175 Cugbp ELAV-like family member 1; RRM, PRE-mRNA spl 99.86
1st7_A86 ACBP, acyl-COA-binding protein; four helix bundle, 99.86
2lbb_A96 Acyl COA binding protein; protein binding, structu 99.85
2cop_A109 Acyl-coenzyme A binding domain containing 6; acyl 99.85
3epy_A89 Acyl-COA-binding domain-containing protein 7; acyl 99.85
2cb8_A87 Acyl-COA-binding protein; acyl-coenzyme A binding 99.84
4gpm_A169 Engineered protein OR264; de novo protein, structu 99.84
4fxv_A99 ELAV-like protein 1; RNA recognition motif, putati 99.84
2cqu_A116 Peroxisomal D3,D2-enoyl-COA isomerase; acyl-COA bi 99.84
1fje_B175 Nucleolin RBD12, protein C23; RNP, RRM, RNA bindin 99.83
3tyt_A205 Heterogeneous nuclear ribonucleoprotein L; ferredo 99.82
3pgw_A282 U1-A; protein-RNA complex, U1 snRNA, SM fold, SM c 99.82
3smz_A284 Protein raver-1, ribonucleoprotein PTB-binding 1; 99.82
2g4b_A172 Splicing factor U2AF 65 kDa subunit; protein-RNA c 99.82
2lxi_A91 RNA-binding protein 10; NMR {Homo sapiens} 99.81
2wh5_A106 Acyl-COA-binding domain-containing protein 4; alte 99.8
3s8s_A110 Histone-lysine N-methyltransferase SETD1A; chromat 99.8
3fp5_A106 Acyl-COA binding protein; ACBP, cacao disease, fat 99.8
3flv_A119 Acyl-COA-binding domain-containing protein 5; lipi 99.8
2ghp_A292 U4/U6 snRNA-associated splicing factor PRP24; RNA 99.8
2lkz_A95 RNA-binding protein 5; RRM; NMR {Homo sapiens} 99.8
3s7r_A87 Heterogeneous nuclear ribonucleoprotein A/B; ferre 99.8
3sde_A261 Paraspeckle component 1; RRM, anti parallel right 99.79
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 99.79
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 99.79
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 99.79
2adc_A229 Polypyrimidine tract-binding protein 1; RBD, RRM, 99.79
2yh0_A198 Splicing factor U2AF 65 kDa subunit; PRE-mRNA spli 99.79
2dgs_A99 DAZ-associated protein 1; RRM domain, structural g 99.79
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 99.79
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 99.79
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 99.78
2jrs_A108 RNA-binding protein 39; RNA binding motif of RBM39 99.78
1s79_A103 Lupus LA protein; RRM, alpha/beta, RNA binding pro 99.78
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 99.78
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 99.77
3md1_A83 Nuclear and cytoplasmic polyadenylated RNA-bindin 99.77
3p5t_L90 Cleavage and polyadenylation specificity factor S; 99.77
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 99.77
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 99.77
2ghp_A292 U4/U6 snRNA-associated splicing factor PRP24; RNA 99.77
2mss_A75 Protein (musashi1); RNA-binding domain, RNA bindin 99.77
3mdf_A85 Peptidyl-prolyl CIS-trans isomerase E; RRM domain, 99.77
2rs2_A109 Musashi-1, RNA-binding protein musashi homolog 1; 99.77
3bs9_A87 Nucleolysin TIA-1 isoform P40; RNA recognition mot 99.77
2dh8_A105 DAZ-associated protein 1; RRM domain, structural g 99.77
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 99.77
1qm9_A198 Polypyrimidine tract-binding protein; ribonucleopr 99.77
1whw_A99 Hypothetical protein riken cDNA 1200009A02; RNA re 99.77
3smz_A284 Protein raver-1, ribonucleoprotein PTB-binding 1; 99.76
3lqv_A115 PRE-mRNA branch site protein P14; cysless mutant, 99.76
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 99.76
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 99.76
2div_A99 TRNA selenocysteine associated protein; structural 99.76
3ucg_A89 Polyadenylate-binding protein 2; ferredoxin-like, 99.76
2la6_A99 RNA-binding protein FUS; structural genomics, nort 99.76
2dnz_A95 Probable RNA-binding protein 23; RNA recognition m 99.76
1x4h_A111 RNA-binding protein 28; structural genomics, RRM d 99.76
2cqc_A95 Arginine/serine-rich splicing factor 10; RNA recog 99.76
1awc_B153 Protein (GA binding protein beta 1); complex (tran 99.76
1p27_B106 RNA-binding protein 8A; nuclear protein, mRNA spli 99.76
3ns6_A100 Eukaryotic translation initiation factor 3 subuni; 99.76
1x5u_A105 Splicing factor 3B subunit 4 (spliceosome associat 99.76
2dnm_A103 SRP46 splicing factor; RRM domain, RBD, structural 99.76
2x1f_A96 MRNA 3'-END-processing protein RNA15; transcriptio 99.76
2dhg_A104 TRNA selenocysteine associated protein (SECP43); R 99.76
3v30_A172 DNA-binding protein rfxank; structural genomics co 99.76
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 99.75
2dng_A103 Eukaryotic translation initiation factor 4H; RRM d 99.75
3v31_A167 Ankyrin repeat family A protein 2; structural geno 99.75
2do4_A100 Squamous cell carcinoma antigen recognized by T- c 99.75
4b93_B269 Ankyrin repeat domain-containing protein 27; endoc 99.75
2cq0_A103 Eukaryotic translation initiation factor 3 subunit 99.75
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 99.75
2cpz_A115 CUG triplet repeat RNA-binding protein 1; RRM doma 99.75
2cqg_A103 TDP-43, TAR DNA-binding protein-43; RNA recognitio 99.75
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 99.75
2dgo_A115 Cytotoxic granule-associated RNA binding protein 1 99.75
1x5s_A102 Cold-inducible RNA-binding protein; structure geno 99.75
2kxn_B129 Transformer-2 protein homolog beta; SR protein, RR 99.75
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 99.75
1x5t_A96 Splicing factor 3B subunit 4; structure genomics, 99.75
2cpf_A98 RNA binding motif protein 19; RNA recognition moti 99.75
1iqt_A75 AUF1, heterogeneous nuclear ribonucleoprotein D0; 99.75
1wez_A102 HnRNP H', FTP-3, heterogeneous nuclear ribonucleop 99.74
1x4e_A85 RNA binding motif, single-stranded interacting pro 99.74
3n9u_C156 Cleavage and polyadenylation specificity factor S; 99.74
2e5h_A94 Zinc finger CCHC-type and RNA-binding motif- conta 99.74
1wg5_A104 Heterogeneous nuclear ribonucleoprotein H; structu 99.74
1x4b_A116 Heterogeneous nuclear ribonucleoproteins A2/B1; st 99.74
2d9p_A103 Polyadenylate-binding protein 3; RRM domain, struc 99.74
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 99.74
2j76_E100 EIF-4B, EIF4B, eukaryotic translation initiation f 99.74
3v30_A172 DNA-binding protein rfxank; structural genomics co 99.74
2cqb_A102 Peptidyl-prolyl CIS-trans isomerase E; RNA recogni 99.74
2dgp_A106 Bruno-like 4, RNA binding protein; RRM domain, str 99.74
2ywk_A95 Putative RNA-binding protein 11; RRM-domain, struc 99.74
1p1t_A104 Cleavage stimulation factor, 64 kDa subunit; RNA r 99.74
2dnh_A105 Bruno-like 5, RNA binding protein; RRM domain, RBD 99.74
1sjq_A105 Polypyrimidine tract-binding protein 1; babbab mot 99.74
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 99.73
1oo0_B110 CG8781-PA, drosophila Y14; RNA recognition motif, 99.73
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 99.73
2fy1_A116 RNA-binding motif protein, Y chromosome, family 1 99.73
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 99.73
2cqd_A116 RNA-binding region containing protein 1; RNA recog 99.73
1ycs_B 239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 99.73
2cph_A107 RNA binding motif protein 19; RNA recognition moti 99.73
2dgv_A92 HnRNP M, heterogeneous nuclear ribonucleoprotein M 99.73
1u6f_A139 Tcubp1, RNA-binding protein UBP1; trypanosome, mRN 99.73
1uaw_A77 Mouse-musashi-1; RNP-type structure, RNA binding p 99.73
1wi8_A104 EIF-4B, eukaryotic translation initiation factor 4 99.73
4a8x_A88 RNA-binding protein with serine-rich domain 1; tra 99.73
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 99.73
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 99.73
2hgl_A136 HNRPF protein, heterogeneous nuclear ribonucleopro 99.73
2ki2_A90 SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA 99.73
3lvq_E 497 ARF-GAP with SH3 domain, ANK repeat and PH domain 99.73
2cpy_A114 RNA-binding protein 12; RRM domain, structural gen 99.73
2cpe_A113 RNA-binding protein EWS; RNA recognition motif, RR 99.73
3deo_A183 Signal recognition particle 43 kDa protein; chloro 99.72
2ek1_A95 RNA-binding protein 12; RNA recognition motif, dim 99.72
2dgw_A91 Probable RNA-binding protein 19; RRM domain, struc 99.72
2khc_A118 Testis-specific RNP-type RNA binding protein; RRM, 99.72
2cq4_A114 RNA binding motif protein 23; RRM domain, structur 99.72
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 99.72
3ulh_A107 THO complex subunit 4; nuclear protein, RNA bindin 99.72
2m2b_A131 RNA-binding protein 10; T-cell, JCSG, MPP, PSI-bio 99.72
2jwn_A124 Embryonic polyadenylate-binding protein 2-B; epabp 99.72
1awc_B153 Protein (GA binding protein beta 1); complex (tran 99.72
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 99.72
2hvz_A101 Splicing factor, arginine/serine-rich 7; RRM, RNA 99.72
2lmi_A107 GRSF-1, G-rich sequence factor 1; G-rich RNA seque 99.72
2dgx_A96 KIAA0430 protein; RRM domain, structural genomics, 99.72
2db1_A118 Heterogeneous nuclear ribonucleoprotein F; RRM dom 99.72
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 99.72
2xs2_A102 Deleted in azoospermia-like; RNA binding protein-R 99.72
2hgm_A126 HNRPF protein, heterogeneous nuclear ribonucleopro 99.72
2cq3_A103 RNA-binding protein 9; RRM domain, structural geno 99.72
2dis_A109 Unnamed protein product; structural genomics, RRM 99.71
2cqp_A98 RNA-binding protein 12; RNA recognition motif, RRM 99.71
3ui2_A 244 Signal recognition particle 43 kDa protein, chlor; 99.71
2cqi_A103 Nucleolysin TIAR; RNA recognition motif, RRM, RNA 99.71
2krb_A81 Eukaryotic translation initiation factor 3 subunit 99.71
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 99.71
4b93_B269 Ankyrin repeat domain-containing protein 27; endoc 99.71
4hbd_A276 KN motif and ankyrin repeat domain-containing Pro; 99.71
3v31_A167 Ankyrin repeat family A protein 2; structural geno 99.71
2lea_A135 Serine/arginine-rich splicing factor 2; SR protein 99.71
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 99.7
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 99.7
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 99.7
3ex7_B126 RNA-binding protein 8A; protein-RNA complex, mRNA 99.7
1wel_A124 RNA-binding protein 12; structural genomics, NPPSF 99.7
2do0_A114 HnRNP M, heterogeneous nuclear ribonucleoprotein M 99.7
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 99.7
2vge_A 229 RELA-associated inhibitor; iaspp, nucleus, apoptos 99.7
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 99.7
2err_A109 Ataxin-2-binding protein 1; protein-RNA complex, R 99.7
1h2v_Z156 20 kDa nuclear CAP binding protein; CAP-binding-co 99.69
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 99.69
1fj7_A101 Nucleolin RBD1, protein C23; RNP, RRM, RNA binding 99.69
2ku7_A140 MLL1 PHD3-CYP33 RRM chimeric protein; transcriptio 99.69
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 99.69
2dnn_A109 RNA-binding protein 12; RRM domain, RBD, structura 99.69
3hra_A201 Ankyrin repeat family protein; structural protein; 99.69
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 99.69
2kt5_A124 RNA and export factor-binding protein 2; chaperone 99.69
3utm_A 351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 99.69
2nlw_A105 Eukaryotic translation initiation factor 3 subunit 99.69
2dha_A123 FLJ20171 protein; RRM domain, structural genomics, 99.69
2wbr_A89 GW182, gawky, LD47780P; DNA-binding protein, RRM, 99.69
1x5o_A114 RNA binding motif, single-stranded interacting pro 99.69
1oy3_D 282 Transcription factor inhibitor I-kappa-B-beta; pro 99.69
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 99.69
2rfa_A232 Transient receptor potential cation channel subfa 99.69
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 99.69
2cpi_A111 CCR4-NOT transcription complex subunit 4; RNA reco 99.69
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 99.69
2kn4_A158 Immunoglobulin G-binding protein G, splicing FACT 99.68
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 99.68
2hgn_A139 Heterogeneous nuclear ribonucleoprotein F; RNA rec 99.68
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 99.68
2a3j_A127 U1 small nuclear ribonucleoprotein A; computationa 99.68
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 99.68
4g8k_A337 2-5A-dependent ribonuclease; ankyrin-repeat domain 99.68
1x4a_A109 Splicing factor, arginine/serine-rich 1 (splicing 99.68
3kea_A 285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 99.68
3jxi_A260 Vanilloid receptor-related osmotically activated p 99.68
2etb_A256 Transient receptor potential cation channel subfam 99.68
3q2s_C229 Cleavage and polyadenylation specificity factor S; 99.68
2dnq_A90 RNA-binding protein 4B; RRM domain,RBD, structural 99.68
2etb_A256 Transient receptor potential cation channel subfam 99.68
2xai_A 261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 99.68
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 99.68
2rfa_A232 Transient receptor potential cation channel subfa 99.68
3d9h_A 285 CDNA FLJ77766, highly similar to HOMO sapiens anky 99.68
2e5g_A94 U6 snRNA-specific terminal uridylyltransferase 1; 99.68
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 99.67
2pnn_A273 Transient receptor potential cation channel subfa 99.67
1rk8_A165 CG8781-PA, CG8781-PA protein; mRNA processing, RRM 99.67
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 99.67
2ad9_A119 Polypyrimidine tract-binding protein 1; RBD, RRM, 99.67
3jxi_A260 Vanilloid receptor-related osmotically activated p 99.67
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 99.67
3hra_A201 Ankyrin repeat family protein; structural protein; 99.67
3r27_A100 HnRNP L, heterogeneous nuclear ribonucleoprotein L 99.67
2cq1_A101 PTB-like protein L; RRM domain, structural genomic 99.67
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 99.67
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 99.67
2pnn_A273 Transient receptor potential cation channel subfa 99.66
2la4_A101 Nuclear and cytoplasmic polyadenylated RNA-bindin 99.66
3deo_A183 Signal recognition particle 43 kDa protein; chloro 99.66
2jvr_A111 Nucleolar protein 3; RNA recognition motif, nucleu 99.66
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 99.66
1s70_B 299 130 kDa myosin-binding subunit of smooth muscle my 99.66
4g8k_A337 2-5A-dependent ribonuclease; ankyrin-repeat domain 99.66
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 99.66
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 99.65
2fc8_A102 NCL protein; structure genomics, RRM_1 domain, str 99.65
2fc9_A101 NCL protein; structure genomics, RRM_1 domain, str 99.65
1x4d_A102 Matrin 3; structural genomics, RRM domain, NPPSFA, 99.65
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 99.65
2lcw_A116 RNA-binding protein FUS; RRM, nucleic acid binding 99.46
1wex_A104 Hypothetical protein (riken cDNA 2810036L13); stru 99.65
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 99.65
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 99.65
3ljn_A 364 Hypothetical protein; ankyrin, structural genomics 99.65
1nu4_A97 U1A RNA binding domain; RNA recognition motif, U1 99.65
1why_A97 Hypothetical protein riken cDNA 1810017N16; RNA re 99.65
2e5j_A97 Methenyltetrahydrofolate synthetase domain contain 99.64
2ytc_A85 PRE-mRNA-splicing factor RBM22; RRM domain, RBD, s 99.64
2j8a_A136 Histone-lysine N-methyltransferase, H3 lysine-4 sp 99.64
4hbd_A276 KN motif and ankyrin repeat domain-containing Pro; 99.64
2cpx_A115 Hypothetical protein FLJ11016; RRM domain, structu 99.64
1x4f_A112 Matrin 3; structural genomics, RRM domain, NPPSFA, 99.64
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 99.64
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 99.64
2xnq_A97 Nuclear polyadenylated RNA-binding protein 3; tran 99.64
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 99.64
3d2w_A89 TAR DNA-binding protein 43; DP-43 proteinopathy, T 99.63
1n11_A 437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 99.63
1x4g_A109 Nucleolysin TIAR; structural genomics, RRM domain, 99.63
2cpj_A99 Non-POU domain-containing octamer-binding protein; 99.63
1x4c_A108 Splicing factor, arginine/serine-rich 1; structura 99.63
2xai_A 261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 99.63
2jvo_A108 Nucleolar protein 3; nucleus, phosphorylation, rib 99.63
1wdy_A 285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 99.63
3b7b_A 237 Euchromatic histone-lysine N-methyltransferase 1; 99.63
2dnl_A114 Cytoplasmic polyadenylation element binding protei 99.62
2dnp_A90 RNA-binding protein 14; RRM domain, RBD, structura 99.62
2f3j_A177 RNA and export factor binding protein 2; RRM domai 99.62
1fjc_A96 Nucleolin RBD2, protein C23; RNP, RRM, RNA binding 99.62
2i2y_A150 Fusion protein consists of immunoglobin G- binding 99.62
1l3k_A196 Heterogeneous nuclear ribonucleoprotein A1; nuclea 99.62
2cqh_A93 IGF-II mRNA-binding protein 2 isoform A; RNA recog 99.62
2dgt_A92 RNA-binding protein 30; RRM domain, structural gen 99.62
2dgu_A103 Heterogeneous nuclear ribonucleoprotein Q; RRM dom 99.61
2kvi_A96 Nuclear polyadenylated RNA-binding protein 3; RNA- 99.61
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 99.61
2cjk_A167 Nuclear polyadenylated RNA-binding protein 4; HRP1 99.61
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 99.61
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 99.61
3md3_A166 Nuclear and cytoplasmic polyadenylated RNA-bindin 99.6
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 99.6
3egn_A143 RNA-binding protein 40; RNA recognition motif (RRM 99.6
2hzc_A87 Splicing factor U2AF 65 kDa subunit; RNA splicing, 99.6
2e44_A96 Insulin-like growth factor 2 mRNA binding protein 99.6
1whx_A111 Hypothetical protein riken cDNA 1200009A02; RNA re 99.6
2cpd_A99 Apobec-1 stimulating protein; RNA recognition moti 99.59
2voo_A193 Lupus LA protein; RNA-binding protein, RNA recogni 99.59
2g4b_A172 Splicing factor U2AF 65 kDa subunit; protein-RNA c 99.59
2diu_A96 KIAA0430 protein; structural genomics, RRM domain, 99.59
1wf0_A88 TDP-43, TAR DNA-binding protein-43; structural gen 99.59
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 99.59
1sw6_A327 Regulatory protein SWI6; transcription regulation, 99.59
1wf1_A110 RNA-binding protein RALY; structural genomics, RRM 99.58
1sw6_A327 Regulatory protein SWI6; transcription regulation, 99.58
2yh0_A198 Splicing factor U2AF 65 kDa subunit; PRE-mRNA spli 99.58
1wg1_A88 KIAA1579 protein, homolog EXC-7; RBD, structural g 99.58
2qfj_A216 FBP-interacting repressor; protein-DNA complex; HE 99.58
4f02_A213 Polyadenylate-binding protein 1; mRNA, eukaryotic 99.57
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 99.56
3eu9_A 240 Huntingtin-interacting protein 14; epigenetics, an 99.56
1sjr_A164 Polypyrimidine tract-binding protein 1; extended b 99.56
3lvq_E 497 ARF-GAP with SH3 domain, ANK repeat and PH domain 99.56
3pgw_S437 U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM 99.56
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 99.55
3zzy_A130 Polypyrimidine tract-binding protein 1; protein bi 99.55
1x5p_A97 Negative elongation factor E; structure genomics, 99.55
1b7f_A168 Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP 99.55
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 99.54
2cq2_A114 Hypothetical protein LOC91801; RRM domain, structu 99.54
3beg_B115 Splicing factor, arginine/serine-rich 1; kinase, S 99.54
1fxl_A167 Paraneoplastic encephalomyelitis antigen HUD; prot 99.53
3sde_A261 Paraspeckle component 1; RRM, anti parallel right 99.53
3nmr_A175 Cugbp ELAV-like family member 1; RRM, PRE-mRNA spl 99.51
2e5i_A124 Heterogeneous nuclear ribonucleoprotein L-like; RR 99.51
2pe8_A105 Splicing factor 45; RRM, protein binding; 2.00A {H 99.51
2bz2_A121 Negative elongation factor E; NELF E, RNA recognit 99.49
1fje_B175 Nucleolin RBD12, protein C23; RNP, RRM, RNA bindin 99.45
2aja_A 376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 99.45
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 99.45
3u1l_A240 PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 99.44
2dit_A112 HIV TAT specific factor 1 variant; structural geno 99.37
2aja_A 376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 99.36
1jmt_A104 Splicing factor U2AF 35 kDa subunit; RRM, RNA spli 99.35
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 99.35
3tyt_A205 Heterogeneous nuclear ribonucleoprotein L; ferredo 99.34
3pgw_A282 U1-A; protein-RNA complex, U1 snRNA, SM fold, SM c 99.33
2d9o_A100 DNAJ (HSP40) homolog, subfamily C, member 17; RRM 99.3
1qm9_A198 Polypyrimidine tract-binding protein; ribonucleopr 99.3
3v4m_A105 Splicing factor U2AF 65 kDa subunit; canonical RNA 99.29
2adc_A229 Polypyrimidine tract-binding protein 1; RBD, RRM, 99.29
3ue2_A118 Poly(U)-binding-splicing factor PUF60; RNA recogni 99.27
3tht_A345 Alkylated DNA repair protein ALKB homolog 8; struc 99.17
2dnr_A91 Synaptojanin-1; RRM domain, RBD, structural genomi 98.97
3s6e_A114 RNA-binding protein 39; ferredoxin-like, structura 98.97
2kn4_A158 Immunoglobulin G-binding protein G, splicing FACT 98.92
1owx_A121 Lupus LA protein, SS-B, LA; RRM, transcription; NM 98.88
1ufw_A95 Synaptojanin 2; RNP domain, structural genomics, r 98.8
2i2y_A150 Fusion protein consists of immunoglobin G- binding 98.59
3dxb_A222 Thioredoxin N-terminally fused to PUF60(UHM); spli 98.58
2dhx_A104 Poly (ADP-ribose) polymerase family, member 10 var 98.3
3pgw_S437 U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM 98.08
2l9w_A117 U4/U6 snRNA-associated-splicing factor PRP24; RRM, 97.91
2lea_A135 Serine/arginine-rich splicing factor 2; SR protein 97.86
4fxv_A99 ELAV-like protein 1; RNA recognition motif, putati 97.86
2lxi_A91 RNA-binding protein 10; NMR {Homo sapiens} 97.68
2lkz_A95 RNA-binding protein 5; RRM; NMR {Homo sapiens} 97.55
3s8s_A110 Histone-lysine N-methyltransferase SETD1A; chromat 97.41
1sjq_A105 Polypyrimidine tract-binding protein 1; babbab mot 97.41
1uw4_A91 UPF3X; nonsense mediated mRNA decay protein, RNA-b 97.37
2hgn_A139 Heterogeneous nuclear ribonucleoprotein F; RNA rec 97.37
2mss_A75 Protein (musashi1); RNA-binding domain, RNA bindin 97.3
1iqt_A75 AUF1, heterogeneous nuclear ribonucleoprotein D0; 97.29
1wwh_A119 Nucleoporin 35, nucleoporin; structural genomics, 97.28
3p5t_L90 Cleavage and polyadenylation specificity factor S; 97.28
1rk8_A165 CG8781-PA, CG8781-PA protein; mRNA processing, RRM 97.28
3mdf_A85 Peptidyl-prolyl CIS-trans isomerase E; RRM domain, 97.24
2ad9_A119 Polypyrimidine tract-binding protein 1; RBD, RRM, 97.24
3ns6_A100 Eukaryotic translation initiation factor 3 subuni; 97.21
1uaw_A77 Mouse-musashi-1; RNP-type structure, RNA binding p 97.2
2cqb_A102 Peptidyl-prolyl CIS-trans isomerase E; RNA recogni 97.2
2jrs_A108 RNA-binding protein 39; RNA binding motif of RBM39 97.19
2dgp_A106 Bruno-like 4, RNA binding protein; RRM domain, str 97.19
4f25_A115 Polyadenylate-binding protein 1; RRM fold, transla 97.18
3r27_A100 HnRNP L, heterogeneous nuclear ribonucleoprotein L 97.17
2x1f_A96 MRNA 3'-END-processing protein RNA15; transcriptio 97.16
1x5s_A102 Cold-inducible RNA-binding protein; structure geno 97.16
2m2b_A131 RNA-binding protein 10; T-cell, JCSG, MPP, PSI-bio 97.14
3bs9_A87 Nucleolysin TIA-1 isoform P40; RNA recognition mot 97.12
2rs2_A109 Musashi-1, RNA-binding protein musashi homolog 1; 97.11
1whw_A99 Hypothetical protein riken cDNA 1200009A02; RNA re 97.11
1x5t_A96 Splicing factor 3B subunit 4; structure genomics, 97.09
1x4h_A111 RNA-binding protein 28; structural genomics, RRM d 97.09
3s7r_A87 Heterogeneous nuclear ribonucleoprotein A/B; ferre 97.08
1x4e_A85 RNA binding motif, single-stranded interacting pro 97.07
2cph_A107 RNA binding motif protein 19; RNA recognition moti 97.07
1whv_A100 Poly(A)-specific ribonuclease; RNA recognition mot 97.07
3md1_A83 Nuclear and cytoplasmic polyadenylated RNA-bindin 97.06
2e5h_A94 Zinc finger CCHC-type and RNA-binding motif- conta 97.05
2cpz_A115 CUG triplet repeat RNA-binding protein 1; RRM doma 97.04
2div_A99 TRNA selenocysteine associated protein; structural 97.03
2lcw_A116 RNA-binding protein FUS; RRM, nucleic acid binding 96.09
1oo0_B110 CG8781-PA, drosophila Y14; RNA recognition motif, 97.01
2dnz_A95 Probable RNA-binding protein 23; RNA recognition m 97.01
1x5u_A105 Splicing factor 3B subunit 4 (spliceosome associat 97.01
2cq1_A101 PTB-like protein L; RRM domain, structural genomic 97.0
2la6_A99 RNA-binding protein FUS; structural genomics, nort 97.0
1p27_B106 RNA-binding protein 8A; nuclear protein, mRNA spli 96.98
2cqc_A95 Arginine/serine-rich splicing factor 10; RNA recog 96.97
2dgs_A99 DAZ-associated protein 1; RRM domain, structural g 96.97
2cpe_A113 RNA-binding protein EWS; RNA recognition motif, RR 96.96
2fy1_A116 RNA-binding motif protein, Y chromosome, family 1 96.95
2dgx_A96 KIAA0430 protein; RRM domain, structural genomics, 96.95
2kxn_B129 Transformer-2 protein homolog beta; SR protein, RR 96.95
2cqg_A103 TDP-43, TAR DNA-binding protein-43; RNA recognitio 96.94
1x4b_A116 Heterogeneous nuclear ribonucleoproteins A2/B1; st 96.94
3ex7_B126 RNA-binding protein 8A; protein-RNA complex, mRNA 96.93
2do4_A100 Squamous cell carcinoma antigen recognized by T- c 96.93
2dnl_A114 Cytoplasmic polyadenylation element binding protei 96.92
2cq4_A114 RNA binding motif protein 23; RRM domain, structur 96.92
2cqd_A116 RNA-binding region containing protein 1; RNA recog 96.92
2jvr_A111 Nucleolar protein 3; RNA recognition motif, nucleu 96.92
1s79_A103 Lupus LA protein; RRM, alpha/beta, RNA binding pro 96.9
1p1t_A104 Cleavage stimulation factor, 64 kDa subunit; RNA r 96.89
2dnh_A105 Bruno-like 5, RNA binding protein; RRM domain, RBD 96.88
2err_A109 Ataxin-2-binding protein 1; protein-RNA complex, R 96.88
3n9u_C156 Cleavage and polyadenylation specificity factor S; 96.87
3ucg_A89 Polyadenylate-binding protein 2; ferredoxin-like, 96.86
3d2w_A89 TAR DNA-binding protein 43; DP-43 proteinopathy, T 96.86
2jvo_A108 Nucleolar protein 3; nucleus, phosphorylation, rib 96.85
2ek1_A95 RNA-binding protein 12; RNA recognition motif, dim 96.84
2cpy_A114 RNA-binding protein 12; RRM domain, structural gen 96.81
2dgo_A115 Cytotoxic granule-associated RNA binding protein 1 96.81
2dnm_A103 SRP46 splicing factor; RRM domain, RBD, structural 96.81
2dh8_A105 DAZ-associated protein 1; RRM domain, structural g 96.81
1x4d_A102 Matrin 3; structural genomics, RRM domain, NPPSFA, 96.8
2ku7_A140 MLL1 PHD3-CYP33 RRM chimeric protein; transcriptio 96.8
2j8a_A136 Histone-lysine N-methyltransferase, H3 lysine-4 sp 96.79
2wbr_A89 GW182, gawky, LD47780P; DNA-binding protein, RRM, 96.79
2dha_A123 FLJ20171 protein; RRM domain, structural genomics, 96.79
2jwn_A124 Embryonic polyadenylate-binding protein 2-B; epabp 96.78
2krb_A81 Eukaryotic translation initiation factor 3 subunit 96.78
1wg5_A104 Heterogeneous nuclear ribonucleoprotein H; structu 96.77
2dis_A109 Unnamed protein product; structural genomics, RRM 96.76
1wey_A104 Calcipressin 1; structural genomics, RRM domain, r 96.75
1wf0_A88 TDP-43, TAR DNA-binding protein-43; structural gen 96.75
2cq0_A103 Eukaryotic translation initiation factor 3 subunit 96.75
2j76_E100 EIF-4B, EIF4B, eukaryotic translation initiation f 96.74
1whx_A111 Hypothetical protein riken cDNA 1200009A02; RNA re 96.72
2do0_A114 HnRNP M, heterogeneous nuclear ribonucleoprotein M 96.72
3beg_B115 Splicing factor, arginine/serine-rich 1; kinase, S 96.72
1wf1_A110 RNA-binding protein RALY; structural genomics, RRM 96.71
2cqp_A98 RNA-binding protein 12; RNA recognition motif, RRM 96.71
2d9p_A103 Polyadenylate-binding protein 3; RRM domain, struc 96.7
2lmi_A107 GRSF-1, G-rich sequence factor 1; G-rich RNA seque 96.7
2kt5_A124 RNA and export factor-binding protein 2; chaperone 96.7
2dgv_A92 HnRNP M, heterogeneous nuclear ribonucleoprotein M 96.69
1why_A97 Hypothetical protein riken cDNA 1810017N16; RNA re 96.68
2dnn_A109 RNA-binding protein 12; RRM domain, RBD, structura 96.67
1x4f_A112 Matrin 3; structural genomics, RRM domain, NPPSFA, 96.67
2dgt_A92 RNA-binding protein 30; RRM domain, structural gen 96.66
1wi8_A104 EIF-4B, eukaryotic translation initiation factor 4 96.65
2la4_A101 Nuclear and cytoplasmic polyadenylated RNA-bindin 96.65
2ki2_A90 SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA 96.64
2khc_A118 Testis-specific RNP-type RNA binding protein; RRM, 96.63
1nu4_A97 U1A RNA binding domain; RNA recognition motif, U1 96.63
1x4c_A108 Splicing factor, arginine/serine-rich 1; structura 96.62
2hgl_A136 HNRPF protein, heterogeneous nuclear ribonucleopro 96.61
2dnp_A90 RNA-binding protein 14; RRM domain, RBD, structura 96.6
2dnq_A90 RNA-binding protein 4B; RRM domain,RBD, structural 96.59
2hvz_A101 Splicing factor, arginine/serine-rich 7; RRM, RNA 96.58
1wel_A124 RNA-binding protein 12; structural genomics, NPPSF 96.57
1x4g_A109 Nucleolysin TIAR; structural genomics, RRM domain, 96.56
3ulh_A107 THO complex subunit 4; nuclear protein, RNA bindin 96.55
1u6f_A139 Tcubp1, RNA-binding protein UBP1; trypanosome, mRN 96.54
1wex_A104 Hypothetical protein (riken cDNA 2810036L13); stru 96.53
1sjr_A164 Polypyrimidine tract-binding protein 1; extended b 96.51
3lqv_A115 PRE-mRNA branch site protein P14; cysless mutant, 96.51
2db1_A118 Heterogeneous nuclear ribonucleoprotein F; RRM dom 96.5
1wez_A102 HnRNP H', FTP-3, heterogeneous nuclear ribonucleop 96.5
3zzy_A130 Polypyrimidine tract-binding protein 1; protein bi 96.48
2voo_A193 Lupus LA protein; RNA-binding protein, RNA recogni 96.47
1h2v_Z156 20 kDa nuclear CAP binding protein; CAP-binding-co 96.47
3p3d_A132 Nucleoporin 53; structural genomics, PSI-2, protei 96.46
2dgu_A103 Heterogeneous nuclear ribonucleoprotein Q; RRM dom 96.44
2f3j_A177 RNA and export factor binding protein 2; RRM domai 96.35
2e5j_A97 Methenyltetrahydrofolate synthetase domain contain 96.35
2cq2_A114 Hypothetical protein LOC91801; RRM domain, structu 96.32
4a8x_A88 RNA-binding protein with serine-rich domain 1; tra 96.3
2cqh_A93 IGF-II mRNA-binding protein 2 isoform A; RNA recog 96.29
2cpx_A115 Hypothetical protein FLJ11016; RRM domain, structu 96.29
1fj7_A101 Nucleolin RBD1, protein C23; RNP, RRM, RNA binding 96.29
2e5i_A124 Heterogeneous nuclear ribonucleoprotein L-like; RR 96.27
2ywk_A95 Putative RNA-binding protein 11; RRM-domain, struc 96.26
3q2s_C229 Cleavage and polyadenylation specificity factor S; 96.26
3ctr_A101 Poly(A)-specific ribonuclease PARN; protein-RNA-co 96.25
3pq1_A464 Poly(A) RNA polymerase; nucleotidyl transferase, R 96.16
2hgm_A126 HNRPF protein, heterogeneous nuclear ribonucleopro 96.16
2e44_A96 Insulin-like growth factor 2 mRNA binding protein 96.14
2cqi_A103 Nucleolysin TIAR; RNA recognition motif, RRM, RNA 96.14
1wg1_A88 KIAA1579 protein, homolog EXC-7; RBD, structural g 96.13
3egn_A143 RNA-binding protein 40; RNA recognition motif (RRM 96.12
2cq3_A103 RNA-binding protein 9; RRM domain, structural geno 96.09
2dgw_A91 Probable RNA-binding protein 19; RRM domain, struc 96.07
1x4a_A109 Splicing factor, arginine/serine-rich 1 (splicing 96.07
2nlw_A105 Eukaryotic translation initiation factor 3 subunit 96.06
2dng_A103 Eukaryotic translation initiation factor 4H; RRM d 96.05
2cpf_A98 RNA binding motif protein 19; RNA recognition moti 96.05
1x5o_A114 RNA binding motif, single-stranded interacting pro 96.05
2l08_A97 Regulator of nonsense transcripts 3A; NESG, nonsen 96.02
2ytc_A85 PRE-mRNA-splicing factor RBM22; RRM domain, RBD, s 96.02
2fc9_A101 NCL protein; structure genomics, RRM_1 domain, str 95.99
2xs2_A102 Deleted in azoospermia-like; RNA binding protein-R 95.97
2dhg_A104 TRNA selenocysteine associated protein (SECP43); R 95.95
2cpj_A99 Non-POU domain-containing octamer-binding protein; 95.95
2a3j_A127 U1 small nuclear ribonucleoprotein A; computationa 95.81
2kvi_A96 Nuclear polyadenylated RNA-binding protein 3; RNA- 95.79
2cpi_A111 CCR4-NOT transcription complex subunit 4; RNA reco 95.74
2xnq_A97 Nuclear polyadenylated RNA-binding protein 3; tran 95.63
2e5g_A94 U6 snRNA-specific terminal uridylyltransferase 1; 95.51
3u1l_A240 PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 95.34
2cpd_A99 Apobec-1 stimulating protein; RNA recognition moti 94.89
2hzc_A87 Splicing factor U2AF 65 kDa subunit; RNA splicing, 94.87
1fjc_A96 Nucleolin RBD2, protein C23; RNP, RRM, RNA binding 94.42
2bz2_A121 Negative elongation factor E; NELF E, RNA recognit 93.72
3tht_A345 Alkylated DNA repair protein ALKB homolog 8; struc 93.18
>1l3k_A Heterogeneous nuclear ribonucleoprotein A1; nuclear protein hnRNP A1, RNA-recognition motif, RNA- binding, UP1, RNA binding protein; 1.10A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1u1k_A* 1u1l_A* 1u1m_A* 1u1n_A* 1u1o_A 1u1p_A* 1u1q_A 1u1r_A* 1pgz_A* 1ha1_A 1po6_A* 2up1_A* 1up1_A Back     alignment and structure
Probab=99.90  E-value=2.2e-24  Score=181.52  Aligned_cols=155  Identities=21%  Similarity=0.359  Sum_probs=122.9

Q ss_pred             cccCCCeEEEeCCCCCCCHHHHHHHHhccCCeeEEEEeeeCCCCCceeEEEEEEcCHHHHHHHHhcCCCccCCccccccC
Q psy630            4 SIRQLNKIFVGNLPWTVSHNELKKFFSEYGQIMNASVMFDKNTGLSKGFGFVTFQNKEAVDKVFSTDSHVLEGSRLSIQP   83 (347)
Q Consensus         4 ~~~~~~~l~V~nLp~~~t~~~l~~~f~~~G~i~~~~i~~~~~t~~~~g~afV~f~~~~~a~~a~~~~~~~~~g~~l~v~~   83 (347)
                      ++.+.++|||+|||+++|+++|+++|++||.|..|.+++++.+|.++|||||+|.+.++|.+|+..++..+.|+.|.|.+
T Consensus         9 ~~~~~~~l~V~nLp~~~te~~l~~~F~~~G~i~~v~i~~~~~~g~~~g~afV~f~~~~~A~~A~~~~~~~~~g~~l~v~~   88 (196)
T 1l3k_A            9 EPEQLRKLFIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPNTKRSRGFGFVTYATVEEVDAAMNARPHKVDGRVVEPKR   88 (196)
T ss_dssp             CCGGGGEEEEESCCTTCCHHHHHHHHGGGSCEEEEEEEECTTTCCEEEEEEEEESSHHHHHHHHHTCSCEETTEECEEEE
T ss_pred             CCCCCCEEEEeCCCCCCCHHHHHHHHHhCCCEEEEEEEEcCCCCCccceEEEEeCCHHHHHHHHhcCCCEECCEEeeeec
Confidence            45677899999999999999999999999999999999999999999999999999999999999999999999999998


Q ss_pred             CCcccccchhhhhhcccccccccCCcccccchhhHHHHhhccccceecccCCCCCccchhHHHHHHHHHHcCCCCHHHHH
Q psy630           84 SDSHNRMAENMEDRFNQACDYLPSLVKKLDSSTLLKFYALYKQATVGQCNIDKPSWYNMEAKSKYNAWNSLGQMAKSEAM  163 (347)
Q Consensus        84 ~~~~~~~~~~~~~~f~~~~~~v~~l~~~~~~e~l~~~f~~fg~v~~g~~~~~~p~~~~~~~~~K~~aw~~~~~~~~~eA~  163 (347)
                      +.+...... ........++||+|||..+++++|+++|+.||.|....+..++.     .|+.|+.|+..  ..+.++|.
T Consensus        89 ~~~~~~~~~-~~~~~~~~~l~V~nLp~~~t~~~l~~~F~~~G~i~~v~i~~~~~-----~g~~~g~afV~--F~~~~~A~  160 (196)
T 1l3k_A           89 AVSREDSQR-PGAHLTVKKIFVGGIKEDTEEHHLRDYFEQYGKIEVIEIMTDRG-----SGKKRGFAFVT--FDDHDSVD  160 (196)
T ss_dssp             CCC------------CCSEEEEECCTTTCCHHHHHHHHTTTSCEEEEEEEECTT-----TCCEEEEEEEE--ESSHHHHH
T ss_pred             ccCcccccc-cccCCCcceEEEeCCCCCCCHHHHHHHHhcCCCeEEEEEeecCC-----CCCccceEEEE--ECCHHHHH
Confidence            876543221 12223457899999999999999999999999998777765532     22333334443  34577777


Q ss_pred             HHH
Q psy630          164 SKY  166 (347)
Q Consensus       164 ~~y  166 (347)
                      ++.
T Consensus       161 ~A~  163 (196)
T 1l3k_A          161 KIV  163 (196)
T ss_dssp             HHH
T ss_pred             HHH
Confidence            664



>4f02_A Polyadenylate-binding protein 1; mRNA, eukaryotic initiation factors PAIP1 and PAIP2, translation-RNA complex; 2.00A {Homo sapiens} PDB: 1cvj_A* Back     alignment and structure
>1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A Back     alignment and structure
>1b7f_A Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP*GP*UP*UP*UP*UP*UP*UP*UP*U)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A Back     alignment and structure
>2cjk_A Nuclear polyadenylated RNA-binding protein 4; HRP1, RNA-binding, RNA processing, mRNA processing, nonsense-mediated mRNA decay, cleavage; NMR {Saccharomyces cerevisiae} PDB: 2km8_C Back     alignment and structure
>3md3_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNP, RBD, poly(U) binding, tandem, acetylation, cytopla nucleus; 2.70A {Saccharomyces cerevisiae} Back     alignment and structure
>2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A Back     alignment and structure
>4gpm_A Engineered protein OR264; de novo protein, structural genomics, PSI-biology, northeast structural genomics consortium, NESG; 2.00A {Synthetic construct} PDB: 4gmr_A Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Back     alignment and structure
>4f25_A Polyadenylate-binding protein 1; RRM fold, translation initiation, RNA-binding, EIF4G-binding translation; 1.90A {Homo sapiens} PDB: 4f26_A 2k8g_A Back     alignment and structure
>1hbk_A ACBP, acyl-COA binding protein; fatty acid metabolism; HET: COA MYR; 2.0A {Plasmodium falciparum} SCOP: a.11.1.1 Back     alignment and structure
>3nmr_A Cugbp ELAV-like family member 1; RRM, PRE-mRNA splicing, RNA binding protein-RNA complex; 1.85A {Homo sapiens} PDB: 3nna_A 3nnc_A 2dhs_A 3nnh_A Back     alignment and structure
>1st7_A ACBP, acyl-COA-binding protein; four helix bundle, transport protein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2lbb_A Acyl COA binding protein; protein binding, structural genomi seattle structural genomics center for infectious disease,; NMR {Babesia bovis} Back     alignment and structure
>2cop_A Acyl-coenzyme A binding domain containing 6; acyl COA binding protein, COA binding protein, lipid binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3epy_A Acyl-COA-binding domain-containing protein 7; acyl-COA binding protein, fatty acid, lipid metabolism, structural genomics; HET: COA PLM; 2.00A {Homo sapiens} SCOP: a.11.1.1 Back     alignment and structure
>2cb8_A Acyl-COA-binding protein; acyl-coenzyme A binding protein, fatty acid, acetylation, alternative splicing, lipid-binding, transport; HET: MYA; 1.4A {Homo sapiens} PDB: 2fj9_A 1aca_A* 1hb6_A 1hb8_A 1nti_A 1nvl_A* 2abd_A 2fdq_A Back     alignment and structure
>4gpm_A Engineered protein OR264; de novo protein, structural genomics, PSI-biology, northeast structural genomics consortium, NESG; 2.00A {Synthetic construct} PDB: 4gmr_A Back     alignment and structure
>4fxv_A ELAV-like protein 1; RNA recognition motif, putative RNA-binding domain, transcri structural genomics, joint center for structural genomics; 1.90A {Homo sapiens} Back     alignment and structure
>2cqu_A Peroxisomal D3,D2-enoyl-COA isomerase; acyl-COA binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1fje_B Nucleolin RBD12, protein C23; RNP, RRM, RNA binding domain, RNA-protein complex, nucleolus, structural protein/RNA complex; NMR {Mesocricetus auratus} SCOP: d.58.7.1 d.58.7.1 PDB: 1rkj_A 2krr_A Back     alignment and structure
>3tyt_A Heterogeneous nuclear ribonucleoprotein L; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 1.60A {Mus musculus} PDB: 3s01_A 3to8_A Back     alignment and structure
>3pgw_A U1-A; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 1fht_A 2u1a_A 2aym_A 2b0g_A Back     alignment and structure
>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3vf0_B* 3h2u_B 3h2v_E Back     alignment and structure
>2g4b_A Splicing factor U2AF 65 kDa subunit; protein-RNA complex, RNA splicing factor, RNA recognition motif, RNA binding protein/RNA complex; 2.50A {Homo sapiens} PDB: 2u2f_A Back     alignment and structure
>2lxi_A RNA-binding protein 10; NMR {Homo sapiens} Back     alignment and structure
>2wh5_A Acyl-COA-binding domain-containing protein 4; alternative splicing, fatty acid metabolism, lipid transport, lipid binding protein; HET: STE ST9 COA; 2.60A {Homo sapiens} Back     alignment and structure
>3s8s_A Histone-lysine N-methyltransferase SETD1A; chromatin modification, transcription regulation, structural genomics, structural genomics consortium; 1.30A {Homo sapiens} Back     alignment and structure
>3fp5_A Acyl-COA binding protein; ACBP, cacao disease, fatty acid metabolism, lipid binding protein; HET: MES; 1.61A {Moniliophthora perniciosa} SCOP: a.11.1.0 Back     alignment and structure
>3flv_A Acyl-COA-binding domain-containing protein 5; lipid binding, structural genomics, struct genomics consortium, SGC, lipid-binding, membrane; HET: STE COA; 1.70A {Homo sapiens} Back     alignment and structure
>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Back     alignment and structure
>2lkz_A RNA-binding protein 5; RRM; NMR {Homo sapiens} Back     alignment and structure
>3s7r_A Heterogeneous nuclear ribonucleoprotein A/B; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 2.15A {Homo sapiens} PDB: 1hd0_A 1hd1_A Back     alignment and structure
>3sde_A Paraspeckle component 1; RRM, anti parallel right handed coiled-coil, NOPS, DBHS, RNA protein, RNA binding; 1.90A {Homo sapiens} PDB: 3sde_B Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Back     alignment and structure
>2adc_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 2evz_A Back     alignment and structure
>2yh0_A Splicing factor U2AF 65 kDa subunit; PRE-mRNA splicing, transcription, RNA binding protein, mRNA processing; NMR {Homo sapiens} PDB: 2yh1_A Back     alignment and structure
>2dgs_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Back     alignment and structure
>2jrs_A RNA-binding protein 39; RNA binding motif of RBM39_human (caper), RRM2 domain, solution structure, structural genomics, PSI-2; NMR {Homo sapiens} Back     alignment and structure
>1s79_A Lupus LA protein; RRM, alpha/beta, RNA binding protein, translation; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} SCOP: d.211.1.0 PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Back     alignment and structure
>3md1_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RBD, RNP, poly(U) binding, nucleus, RNA-binding, binding protein; 1.60A {Saccharomyces cerevisiae} SCOP: d.58.7.0 Back     alignment and structure
>3p5t_L Cleavage and polyadenylation specificity factor S; RRM domain, poly(A) site recognition, RNA, nuclear, RNA BIND protein; 2.70A {Homo sapiens} PDB: 3p6y_C Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Back     alignment and structure
>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Back     alignment and structure
>2mss_A Protein (musashi1); RNA-binding domain, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 PDB: 2mst_A Back     alignment and structure
>3mdf_A Peptidyl-prolyl CIS-trans isomerase E; RRM domain, PHD finger, CYP33, MLL, RNA binding protein, ISO mRNA processing, mRNA splicing, nucleus; 1.85A {Homo sapiens} SCOP: d.58.7.1 PDB: 2kyx_A 3lpy_A* Back     alignment and structure
>2rs2_A Musashi-1, RNA-binding protein musashi homolog 1; protein-RNA complex, RRM, RBD, RNA binding protein- complex; NMR {Mus musculus} Back     alignment and structure
>3bs9_A Nucleolysin TIA-1 isoform P40; RNA recognition motif, RRM, RNA binding domain, RBD, RNA splicing, apoptosis, phosphoprotein, RNA-binding; 1.95A {Homo sapiens} Back     alignment and structure
>2dh8_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Back     alignment and structure
>1qm9_A Polypyrimidine tract-binding protein; ribonucleoprotein, RNP, RNA, spicing, translation; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 Back     alignment and structure
>1whw_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3vf0_B* 3h2u_B 3h2v_E Back     alignment and structure
>3lqv_A PRE-mRNA branch site protein P14; cysless mutant, PRE-mRNA splicing, adenine, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: ADE; 2.38A {Homo sapiens} SCOP: d.58.7.1 PDB: 2f9d_A 2f9j_A 2fho_B Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Back     alignment and structure
>2div_A TRNA selenocysteine associated protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3ucg_A Polyadenylate-binding protein 2; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative; HET: PGE; 1.95A {Homo sapiens} PDB: 3b4d_A 3b4m_A Back     alignment and structure
>2la6_A RNA-binding protein FUS; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, RNA recognition; NMR {Homo sapiens} Back     alignment and structure
>2dnz_A Probable RNA-binding protein 23; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1x4h_A RNA-binding protein 28; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2cqc_A Arginine/serine-rich splicing factor 10; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Back     alignment and structure
>1p27_B RNA-binding protein 8A; nuclear protein, mRNA splicing; 2.00A {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3ns6_A Eukaryotic translation initiation factor 3 subuni; 1.25A {Saccharomyces cerevisiae} PDB: 3ns5_A Back     alignment and structure
>1x5u_A Splicing factor 3B subunit 4 (spliceosome associated protein 49) (SAP 49) (SF3B50)...; structure genomics,RRM domain,splicing factor 3B; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dnm_A SRP46 splicing factor; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2x1f_A MRNA 3'-END-processing protein RNA15; transcription-RNA complex, mRNA processing; 1.60A {Saccharomyces cerevisiae} PDB: 2x1b_A 2x1a_A 2km8_B Back     alignment and structure
>2dhg_A TRNA selenocysteine associated protein (SECP43); RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Back     alignment and structure
>2dng_A Eukaryotic translation initiation factor 4H; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Back     alignment and structure
>2do4_A Squamous cell carcinoma antigen recognized by T- cells 3; RRM domaim, RDB, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4b93_B Ankyrin repeat domain-containing protein 27; endocytosis, exocytosis, snare; 2.00A {Homo sapiens} Back     alignment and structure
>2cq0_A Eukaryotic translation initiation factor 3 subunit 4; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Back     alignment and structure
>2cpz_A CUG triplet repeat RNA-binding protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2rq4_A 2rqc_A Back     alignment and structure
>2cqg_A TDP-43, TAR DNA-binding protein-43; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Back     alignment and structure
>2dgo_A Cytotoxic granule-associated RNA binding protein 1; RRM domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2rne_A 2dh7_A Back     alignment and structure
>1x5s_A Cold-inducible RNA-binding protein; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2kxn_B Transformer-2 protein homolog beta; SR protein, RRM, splicing factor, RNA protein complex, SMN, binding protein-RNA complex; NMR {Homo sapiens} PDB: 2rra_A 2rrb_A Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>1x5t_A Splicing factor 3B subunit 4; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cpf_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1iqt_A AUF1, heterogeneous nuclear ribonucleoprotein D0; RNA-binding protein, hnRNP, telomere, DNA-binding protein, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wtb_A 1x0f_A Back     alignment and structure
>1wez_A HnRNP H', FTP-3, heterogeneous nuclear ribonucleoprotein H'; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x4e_A RNA binding motif, single-stranded interacting protein 2; structural genomics, RRM domain, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3n9u_C Cleavage and polyadenylation specificity factor S; protein-protein complex, coexpression, heterotetramer, mRNA maturation, mRNA cleavage; 1.92A {Homo sapiens} Back     alignment and structure
>2e5h_A Zinc finger CCHC-type and RNA-binding motif- containing protein 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wg5_A Heterogeneous nuclear ribonucleoprotein H; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x4b_A Heterogeneous nuclear ribonucleoproteins A2/B1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2d9p_A Polyadenylate-binding protein 3; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Back     alignment and structure
>2j76_E EIF-4B, EIF4B, eukaryotic translation initiation factor 4B; protein biosynthesis, RNA recognition motif, RNA binding domain, RRM, RBD, RNP; NMR {Homo sapiens} Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Back     alignment and structure
>2cqb_A Peptidyl-prolyl CIS-trans isomerase E; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dgp_A Bruno-like 4, RNA binding protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dgq_A Back     alignment and structure
>2ywk_A Putative RNA-binding protein 11; RRM-domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.54A {Homo sapiens} Back     alignment and structure
>1p1t_A Cleavage stimulation factor, 64 kDa subunit; RNA recognition motif, C-terminal helix, N-terminal helix, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dnh_A Bruno-like 5, RNA binding protein; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dnk_A 2dno_A Back     alignment and structure
>1sjq_A Polypyrimidine tract-binding protein 1; babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} SCOP: d.211.1.0 PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Back     alignment and structure
>1oo0_B CG8781-PA, drosophila Y14; RNA recognition motif, splicing, protein complex, EXON junct complex, signaling protein; 1.85A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 2hyi_B* 2j0s_D* 2xb2_D* Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Back     alignment and structure
>2fy1_A RNA-binding motif protein, Y chromosome, family 1 member A1; RNA binding protein, structure, protein-RNA complex, RNA stem-loop, structural protein/RNA complex; NMR {Homo sapiens} Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Back     alignment and structure
>2cqd_A RNA-binding region containing protein 1; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Back     alignment and structure
>2cph_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2dgv_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2dh9_A Back     alignment and structure
>1u6f_A Tcubp1, RNA-binding protein UBP1; trypanosome, mRNA-binding protein, GU-rich RNA, structure; NMR {Trypanosoma cruzi} SCOP: d.58.7.1 Back     alignment and structure
>1uaw_A Mouse-musashi-1; RNP-type structure, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1wi8_A EIF-4B, eukaryotic translation initiation factor 4B; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>4a8x_A RNA-binding protein with serine-rich domain 1; transcription, splicing, RNA processing, nonsense mediated D NMD, HDAC, histone deacetylation; 1.90A {Homo sapiens} Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Back     alignment and structure
>2hgl_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative, splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kfy_A Back     alignment and structure
>2ki2_A SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA binding proteins, RNA binding protein/SS-DNA binding protein complex; NMR {Helicobacter pylori} Back     alignment and structure
>3lvq_E ARF-GAP with SH3 domain, ANK repeat and PH domain containing protein 3, ADP-ribosylation...; GDP, ASAP3, UPLC1, linkers, alternat splicing; HET: GDP; 3.38A {Homo sapiens} PDB: 3lvr_E* Back     alignment and structure
>2cpy_A RNA-binding protein 12; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cpe_A RNA-binding protein EWS; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Back     alignment and structure
>2ek1_A RNA-binding protein 12; RNA recognition motif, dimer, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.00A {Homo sapiens} PDB: 2ek6_A Back     alignment and structure
>2dgw_A Probable RNA-binding protein 19; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2khc_A Testis-specific RNP-type RNA binding protein; RRM, RNA recognition motif, bruno; NMR {Drosophila melanogaster} Back     alignment and structure
>2cq4_A RNA binding motif protein 23; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Back     alignment and structure
>3ulh_A THO complex subunit 4; nuclear protein, RNA binding, structural genomi center for structural genomics, JCSG, protein structure INI PSI-biology; 2.54A {Homo sapiens} PDB: 1no8_A Back     alignment and structure
>2m2b_A RNA-binding protein 10; T-cell, JCSG, MPP, PSI-biology; NMR {Homo sapiens} Back     alignment and structure
>2jwn_A Embryonic polyadenylate-binding protein 2-B; epabp2, poly(A) binding, structural genomics, protein structure initiative, PSI-2; NMR {Xenopus laevis} Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>2hvz_A Splicing factor, arginine/serine-rich 7; RRM, RNA binding protein; NMR {Homo sapiens} Back     alignment and structure
>2lmi_A GRSF-1, G-rich sequence factor 1; G-rich RNA sequence binding factor, RNA binding domain, STRU genomics, joint center for structural genomics, JCSG; NMR {Homo sapiens} Back     alignment and structure
>2dgx_A KIAA0430 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2db1_A Heterogeneous nuclear ribonucleoprotein F; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Back     alignment and structure
>2xs2_A Deleted in azoospermia-like; RNA binding protein-RNA complex; 1.35A {Mus musculus} PDB: 2xs7_A 2xs5_A 2xsf_A Back     alignment and structure
>2hgm_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg0_A Back     alignment and structure
>2cq3_A RNA-binding protein 9; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dis_A Unnamed protein product; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cqp_A RNA-binding protein 12; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Back     alignment and structure
>2cqi_A Nucleolysin TIAR; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, ST genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2krb_A Eukaryotic translation initiation factor 3 subunit B; EIF3, eukaryotic initiation factor, EIF3B, EIF3J; NMR {Homo sapiens} Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Back     alignment and structure
>4b93_B Ankyrin repeat domain-containing protein 27; endocytosis, exocytosis, snare; 2.00A {Homo sapiens} Back     alignment and structure
>4hbd_A KN motif and ankyrin repeat domain-containing Pro; structural genomics consortium, SGC, protein binding; 1.72A {Homo sapiens} Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Back     alignment and structure
>2lea_A Serine/arginine-rich splicing factor 2; SR protein, RNA binding protein; NMR {Homo sapiens} PDB: 2leb_A 2lec_A Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Back     alignment and structure
>3ex7_B RNA-binding protein 8A; protein-RNA complex, mRNA processing, mRNA splicing, mRNA transport, nonsense-mediated mRNA decay, nucleus; HET: ADP; 2.30A {Homo sapiens} PDB: 2j0q_D* Back     alignment and structure
>1wel_A RNA-binding protein 12; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2do0_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RNA recognition motif, RRM, RNA binding domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Back     alignment and structure
>2err_A Ataxin-2-binding protein 1; protein-RNA complex, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1h2v_Z 20 kDa nuclear CAP binding protein; CAP-binding-complex, RNP domain, MIF4G domain, RNA maturation, RNA export, nuclear protein, RNA-binding; 2.0A {Homo sapiens} SCOP: d.58.7.1 PDB: 1h2u_X* 1h2t_Z 1n52_B* 1n54_B 3fex_B 3fey_B 1h6k_X Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Back     alignment and structure
>1fj7_A Nucleolin RBD1, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Back     alignment and structure
>2ku7_A MLL1 PHD3-CYP33 RRM chimeric protein; transcriptional regulation, RRM domain, transcr; NMR {Homo sapiens} Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Back     alignment and structure
>2dnn_A RNA-binding protein 12; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Back     alignment and structure
>2kt5_A RNA and export factor-binding protein 2; chaperone, mRNA processing, mRNA splicing, transport, nucleus, RNA-binding, spliceosome, transport; NMR {Mus musculus} Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Back     alignment and structure
>2nlw_A Eukaryotic translation initiation factor 3 subunit 9; eukaryotic initiation factor 3 complex, RNA recognition motif; NMR {Homo sapiens} Back     alignment and structure
>2dha_A FLJ20171 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2wbr_A GW182, gawky, LD47780P; DNA-binding protein, RRM, RBD, TNRC6A, mirnas, P-bodies, argonaute, mRNA decay; NMR {Drosophila melanogaster} Back     alignment and structure
>1x5o_A RNA binding motif, single-stranded interacting protein 1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Back     alignment and structure
>2cpi_A CCR4-NOT transcription complex subunit 4; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Back     alignment and structure
>2kn4_A Immunoglobulin G-binding protein G, splicing FACT arginine/serine-rich 2, S35, splicing factor SC35,; RRM domain, cell WALL; NMR {Streptococcus SP} Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Back     alignment and structure
>2hgn_A Heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg1_A Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Back     alignment and structure
>2a3j_A U1 small nuclear ribonucleoprotein A; computationally designed protein, RRM, U1A, RNA binding protein; NMR {Homo sapiens} Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Back     alignment and structure
>4g8k_A 2-5A-dependent ribonuclease; ankyrin-repeat domain, single-stranded RNA, hydrolase; 2.40A {Homo sapiens} PDB: 4g8l_A* Back     alignment and structure
>1x4a_A Splicing factor, arginine/serine-rich 1 (splicing factor 2, alternate splicing factor)...; structure genomics, SURP domain, splicing factor SF2; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A 4dx1_A 4dx2_A* Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Back     alignment and structure
>3q2s_C Cleavage and polyadenylation specificity factor S; CFIM, CFIM25, CFIM68, CPSF5, CPSF6, CPSF, 3' END processing, processing, cleavage factor; 2.90A {Homo sapiens} PDB: 3q2t_C Back     alignment and structure
>2dnq_A RNA-binding protein 4B; RRM domain,RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} PDB: 3t9k_A 4f1p_A Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Back     alignment and structure
>2e5g_A U6 snRNA-specific terminal uridylyltransferase 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Back     alignment and structure
>1rk8_A CG8781-PA, CG8781-PA protein; mRNA processing, RRM, RBD, NMD, oskar mRNA localization, translation; 1.90A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 1hl6_A 2x1g_A Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>2ad9_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A 4dx1_A 4dx2_A* Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Back     alignment and structure
>3r27_A HnRNP L, heterogeneous nuclear ribonucleoprotein L; RBD fold, protein binding, nucleus; 2.04A {Homo sapiens} Back     alignment and structure
>2cq1_A PTB-like protein L; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Back     alignment and structure
>2la4_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNA recognition, stress granules, nucleus, RNA-binding, transcription; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Back     alignment and structure
>2jvr_A Nucleolar protein 3; RNA recognition motif, nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding; NMR {Saccharomyces cerevisiae} PDB: 2osr_A Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Back     alignment and structure
>4g8k_A 2-5A-dependent ribonuclease; ankyrin-repeat domain, single-stranded RNA, hydrolase; 2.40A {Homo sapiens} PDB: 4g8l_A* Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Back     alignment and structure
>2fc8_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2fc9_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x4d_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>2lcw_A RNA-binding protein FUS; RRM, nucleic acid binding protein; NMR {Homo sapiens} Back     alignment and structure
>1wex_A Hypothetical protein (riken cDNA 2810036L13); structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Back     alignment and structure
>1nu4_A U1A RNA binding domain; RNA recognition motif, U1 small nuclear ribonucleoprotein, R binding domain, RNA binding protein; HET: MLA; 1.80A {Homo sapiens} SCOP: d.58.7.1 PDB: 1drz_A* 1urn_A 3hhn_B* 3egz_A* 1zzn_A* 1u6b_A* 3cun_A* 3cul_A* 3g8s_A* 3g8t_A* 3g96_A* 3g9c_A* 3irw_P* 3mum_P* 3mur_P* 3mut_P* 3muv_P* 3mxh_P* 3p49_B 3r1h_A* ... Back     alignment and structure
>1why_A Hypothetical protein riken cDNA 1810017N16; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2e5j_A Methenyltetrahydrofolate synthetase domain containing; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ytc_A PRE-mRNA-splicing factor RBM22; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2j8a_A Histone-lysine N-methyltransferase, H3 lysine-4 specific; histone methyltransferase, RRM fold, telomere, nuclear protein; 3.0A {Saccharomyces cerevisiae} Back     alignment and structure
>4hbd_A KN motif and ankyrin repeat domain-containing Pro; structural genomics consortium, SGC, protein binding; 1.72A {Homo sapiens} Back     alignment and structure
>2cpx_A Hypothetical protein FLJ11016; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x4f_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Back     alignment and structure
>2xnq_A Nuclear polyadenylated RNA-binding protein 3; transcription termination, RNA processi recognition, RRM; HET: CAF; 1.30A {Saccharomyces cerevisiae} PDB: 2xnr_A 2l41_A Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Back     alignment and structure
>3d2w_A TAR DNA-binding protein 43; DP-43 proteinopathy, TDP-43 inclusions, RNA recognition MOTI U, ALS, RRM; HET: DNA; 1.65A {Mus musculus} Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>1x4g_A Nucleolysin TIAR; structural genomics, RRM domain, TIA-1 related protein, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cpj_A Non-POU domain-containing octamer-binding protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1x4c_A Splicing factor, arginine/serine-rich 1; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2jvo_A Nucleolar protein 3; nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding, rRNA processing; NMR {Saccharomyces cerevisiae} PDB: 2osq_A Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Back     alignment and structure
>2dnl_A Cytoplasmic polyadenylation element binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dnp_A RNA-binding protein 14; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2f3j_A RNA and export factor binding protein 2; RRM domain, RBD domain., transport protein; NMR {Mus musculus} Back     alignment and structure
>1fjc_A Nucleolin RBD2, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Back     alignment and structure
>2i2y_A Fusion protein consists of immunoglobin G- binding protein G and splicing factor,...; protein-RNA complex RRM alpha-beta sandwich BETA1-alpha1- BETA2-BETA3-alpha2-BETA4; NMR {Streptococcus SP} PDB: 2i38_A Back     alignment and structure
>1l3k_A Heterogeneous nuclear ribonucleoprotein A1; nuclear protein hnRNP A1, RNA-recognition motif, RNA- binding, UP1, RNA binding protein; 1.10A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1u1k_A* 1u1l_A* 1u1m_A* 1u1n_A* 1u1o_A 1u1p_A* 1u1q_A 1u1r_A* 1pgz_A* 1ha1_A 1po6_A* 2up1_A* 1up1_A Back     alignment and structure
>2cqh_A IGF-II mRNA-binding protein 2 isoform A; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dgt_A RNA-binding protein 30; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dgu_A Heterogeneous nuclear ribonucleoprotein Q; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dk2_A Back     alignment and structure
>2kvi_A Nuclear polyadenylated RNA-binding protein 3; RNA-binding motif, RRM, transcription termination, NUC phosphoprotein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Back     alignment and structure
>2cjk_A Nuclear polyadenylated RNA-binding protein 4; HRP1, RNA-binding, RNA processing, mRNA processing, nonsense-mediated mRNA decay, cleavage; NMR {Saccharomyces cerevisiae} PDB: 2km8_C Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Back     alignment and structure
>3md3_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNP, RBD, poly(U) binding, tandem, acetylation, cytopla nucleus; 2.70A {Saccharomyces cerevisiae} Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} PDB: 3t9k_A 4f1p_A Back     alignment and structure
>3egn_A RNA-binding protein 40; RNA recognition motif (RRM), RNP motif, U11/U12-65K protein, DI-snRNP, U1A protein, U2B protein; 2.50A {Homo sapiens} Back     alignment and structure
>2hzc_A Splicing factor U2AF 65 kDa subunit; RNA splicing, RRM, RNA recognition, alternative conformation binding protein; HET: P6G; 1.47A {Homo sapiens} PDB: 1u2f_A Back     alignment and structure
>2e44_A Insulin-like growth factor 2 mRNA binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1whx_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2cpd_A Apobec-1 stimulating protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2voo_A Lupus LA protein; RNA-binding protein, RNA recognition motif, systemic lupus erythematosus, phosphoprotein, RNA maturation; 1.8A {Homo sapiens} SCOP: a.4.5.46 d.58.7.1 PDB: 2von_A 2vod_A 2vop_A 1zh5_A 1yty_A 1s7a_A Back     alignment and structure
>2g4b_A Splicing factor U2AF 65 kDa subunit; protein-RNA complex, RNA splicing factor, RNA recognition motif, RNA binding protein/RNA complex; 2.50A {Homo sapiens} PDB: 2u2f_A Back     alignment and structure
>2diu_A KIAA0430 protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1wf0_A TDP-43, TAR DNA-binding protein-43; structural genomics, RRM domain, riken structural genomics/proteomics initiative RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Back     alignment and structure
>1wf1_A RNA-binding protein RALY; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wf2_A Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Back     alignment and structure
>2yh0_A Splicing factor U2AF 65 kDa subunit; PRE-mRNA splicing, transcription, RNA binding protein, mRNA processing; NMR {Homo sapiens} PDB: 2yh1_A Back     alignment and structure
>1wg1_A KIAA1579 protein, homolog EXC-7; RBD, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wi6_A Back     alignment and structure
>2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A Back     alignment and structure
>4f02_A Polyadenylate-binding protein 1; mRNA, eukaryotic initiation factors PAIP1 and PAIP2, translation-RNA complex; 2.00A {Homo sapiens} PDB: 1cvj_A* Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Back     alignment and structure
>1sjr_A Polypyrimidine tract-binding protein 1; extended babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2adb_A Back     alignment and structure
>3lvq_E ARF-GAP with SH3 domain, ANK repeat and PH domain containing protein 3, ADP-ribosylation...; GDP, ASAP3, UPLC1, linkers, alternat splicing; HET: GDP; 3.38A {Homo sapiens} PDB: 3lvr_E* Back     alignment and structure
>3pgw_S U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_K 2l5i_A 2l5j_A* Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Back     alignment and structure
>3zzy_A Polypyrimidine tract-binding protein 1; protein binding, peptide binding, RNA recognition motif; 1.40A {Homo sapiens} PDB: 3zzz_A Back     alignment and structure
>1x5p_A Negative elongation factor E; structure genomics, RRM domain, PARP14, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1b7f_A Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP*GP*UP*UP*UP*UP*UP*UP*UP*U)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Back     alignment and structure
>2cq2_A Hypothetical protein LOC91801; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3beg_B Splicing factor, arginine/serine-rich 1; kinase, SR protein kinase, SR protein, PRE-mRNA splicing, at binding, chromosome partition; HET: SEP ANP; 2.90A {Homo sapiens} SCOP: d.58.7.1 PDB: 2o3d_A 1wg4_A Back     alignment and structure
>1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A Back     alignment and structure
>3sde_A Paraspeckle component 1; RRM, anti parallel right handed coiled-coil, NOPS, DBHS, RNA protein, RNA binding; 1.90A {Homo sapiens} PDB: 3sde_B Back     alignment and structure
>3nmr_A Cugbp ELAV-like family member 1; RRM, PRE-mRNA splicing, RNA binding protein-RNA complex; 1.85A {Homo sapiens} PDB: 3nna_A 3nnc_A 2dhs_A 3nnh_A Back     alignment and structure
>2e5i_A Heterogeneous nuclear ribonucleoprotein L-like; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2pe8_A Splicing factor 45; RRM, protein binding; 2.00A {Homo sapiens} PDB: 2peh_A Back     alignment and structure
>1fje_B Nucleolin RBD12, protein C23; RNP, RRM, RNA binding domain, RNA-protein complex, nucleolus, structural protein/RNA complex; NMR {Mesocricetus auratus} SCOP: d.58.7.1 d.58.7.1 PDB: 1rkj_A 2krr_A Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Back     alignment and structure
>3u1l_A PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 1.64A {Saccharomyces cerevisiae} PDB: 3u1m_A 3tp2_A Back     alignment and structure
>2dit_A HIV TAT specific factor 1 variant; structural genomics, RRM_1 domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Back     alignment and structure
>1jmt_A Splicing factor U2AF 35 kDa subunit; RRM, RNA splicing, proline, PPII helix, peptide recognition, RNA binding protein; 2.20A {Homo sapiens} SCOP: d.58.7.3 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Back     alignment and structure
>3tyt_A Heterogeneous nuclear ribonucleoprotein L; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 1.60A {Mus musculus} PDB: 3s01_A 3to8_A Back     alignment and structure
>3pgw_A U1-A; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 1fht_A 2u1a_A 2aym_A 2b0g_A Back     alignment and structure
>2d9o_A DNAJ (HSP40) homolog, subfamily C, member 17; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1qm9_A Polypyrimidine tract-binding protein; ribonucleoprotein, RNP, RNA, spicing, translation; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 Back     alignment and structure
>3v4m_A Splicing factor U2AF 65 kDa subunit; canonical RNA binding protein, RNA splicing, structural GENO joint center for structural genomics, JCSG; HET: MSE; 1.80A {Mus musculus} PDB: 1o0p_A 1opi_A Back     alignment and structure
>2adc_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 2evz_A Back     alignment and structure
>3ue2_A Poly(U)-binding-splicing factor PUF60; RNA recognition motif, RRM, RNA binding domain, ST genomics, joint center for structural genomics, JCSG; HET: MSE; 1.23A {Homo sapiens} SCOP: d.58.7.0 PDB: 3us5_A 2dny_A Back     alignment and structure
>3tht_A Alkylated DNA repair protein ALKB homolog 8; structural genomics, PSI-biology, northeast structural genom consortium, NESG; HET: AKG; 3.01A {Homo sapiens} PDB: 3thp_A* Back     alignment and structure
>2dnr_A Synaptojanin-1; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3s6e_A RNA-binding protein 39; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative, PSI-biology; HET: MSE CIT; 0.95A {Mus musculus} PDB: 2lq5_A Back     alignment and structure
>2kn4_A Immunoglobulin G-binding protein G, splicing FACT arginine/serine-rich 2, S35, splicing factor SC35,; RRM domain, cell WALL; NMR {Streptococcus SP} Back     alignment and structure
>1owx_A Lupus LA protein, SS-B, LA; RRM, transcription; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1ufw_A Synaptojanin 2; RNP domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2i2y_A Fusion protein consists of immunoglobin G- binding protein G and splicing factor,...; protein-RNA complex RRM alpha-beta sandwich BETA1-alpha1- BETA2-BETA3-alpha2-BETA4; NMR {Streptococcus SP} PDB: 2i38_A Back     alignment and structure
>3dxb_A Thioredoxin N-terminally fused to PUF60(UHM); splicing, FBP interacting repressor, RRM, electron TRAN redox-active center, transport; 2.20A {Escherichia coli O157} Back     alignment and structure
>2dhx_A Poly (ADP-ribose) polymerase family, member 10 variant; RRM domain, RNA- binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3pgw_S U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_K 2l5i_A 2l5j_A* Back     alignment and structure
>2l9w_A U4/U6 snRNA-associated-splicing factor PRP24; RRM, U6 snRNP, RNA binding protein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2lea_A Serine/arginine-rich splicing factor 2; SR protein, RNA binding protein; NMR {Homo sapiens} PDB: 2leb_A 2lec_A Back     alignment and structure
>4fxv_A ELAV-like protein 1; RNA recognition motif, putative RNA-binding domain, transcri structural genomics, joint center for structural genomics; 1.90A {Homo sapiens} Back     alignment and structure
>2lxi_A RNA-binding protein 10; NMR {Homo sapiens} Back     alignment and structure
>2lkz_A RNA-binding protein 5; RRM; NMR {Homo sapiens} Back     alignment and structure
>3s8s_A Histone-lysine N-methyltransferase SETD1A; chromatin modification, transcription regulation, structural genomics, structural genomics consortium; 1.30A {Homo sapiens} Back     alignment and structure
>1sjq_A Polypyrimidine tract-binding protein 1; babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1uw4_A UPF3X; nonsense mediated mRNA decay protein, RNA-binding protein, N domain, MIF4G domain; 1.95A {Homo sapiens} SCOP: d.58.7.4 Back     alignment and structure
>2hgn_A Heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg1_A Back     alignment and structure
>2mss_A Protein (musashi1); RNA-binding domain, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 PDB: 2mst_A Back     alignment and structure
>1iqt_A AUF1, heterogeneous nuclear ribonucleoprotein D0; RNA-binding protein, hnRNP, telomere, DNA-binding protein, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wtb_A 1x0f_A Back     alignment and structure
>1wwh_A Nucleoporin 35, nucleoporin; structural genomics, MPPN, riken structural genomics/proteomics initiative, RSGI, protein transport; 2.70A {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>3p5t_L Cleavage and polyadenylation specificity factor S; RRM domain, poly(A) site recognition, RNA, nuclear, RNA BIND protein; 2.70A {Homo sapiens} PDB: 3p6y_C Back     alignment and structure
>1rk8_A CG8781-PA, CG8781-PA protein; mRNA processing, RRM, RBD, NMD, oskar mRNA localization, translation; 1.90A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 1hl6_A 2x1g_A Back     alignment and structure
>3mdf_A Peptidyl-prolyl CIS-trans isomerase E; RRM domain, PHD finger, CYP33, MLL, RNA binding protein, ISO mRNA processing, mRNA splicing, nucleus; 1.85A {Homo sapiens} SCOP: d.58.7.1 PDB: 2kyx_A 3lpy_A* Back     alignment and structure
>2ad9_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3ns6_A Eukaryotic translation initiation factor 3 subuni; 1.25A {Saccharomyces cerevisiae} PDB: 3ns5_A Back     alignment and structure
>1uaw_A Mouse-musashi-1; RNP-type structure, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2cqb_A Peptidyl-prolyl CIS-trans isomerase E; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2jrs_A RNA-binding protein 39; RNA binding motif of RBM39_human (caper), RRM2 domain, solution structure, structural genomics, PSI-2; NMR {Homo sapiens} Back     alignment and structure
>2dgp_A Bruno-like 4, RNA binding protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dgq_A Back     alignment and structure
>4f25_A Polyadenylate-binding protein 1; RRM fold, translation initiation, RNA-binding, EIF4G-binding translation; 1.90A {Homo sapiens} PDB: 4f26_A 2k8g_A Back     alignment and structure
>3r27_A HnRNP L, heterogeneous nuclear ribonucleoprotein L; RBD fold, protein binding, nucleus; 2.04A {Homo sapiens} Back     alignment and structure
>2x1f_A MRNA 3'-END-processing protein RNA15; transcription-RNA complex, mRNA processing; 1.60A {Saccharomyces cerevisiae} PDB: 2x1b_A 2x1a_A 2km8_B Back     alignment and structure
>1x5s_A Cold-inducible RNA-binding protein; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2m2b_A RNA-binding protein 10; T-cell, JCSG, MPP, PSI-biology; NMR {Homo sapiens} Back     alignment and structure
>3bs9_A Nucleolysin TIA-1 isoform P40; RNA recognition motif, RRM, RNA binding domain, RBD, RNA splicing, apoptosis, phosphoprotein, RNA-binding; 1.95A {Homo sapiens} Back     alignment and structure
>2rs2_A Musashi-1, RNA-binding protein musashi homolog 1; protein-RNA complex, RRM, RBD, RNA binding protein- complex; NMR {Mus musculus} Back     alignment and structure
>1whw_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1x5t_A Splicing factor 3B subunit 4; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x4h_A RNA-binding protein 28; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>3s7r_A Heterogeneous nuclear ribonucleoprotein A/B; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 2.15A {Homo sapiens} PDB: 1hd0_A 1hd1_A Back     alignment and structure
>1x4e_A RNA binding motif, single-stranded interacting protein 2; structural genomics, RRM domain, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cph_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1whv_A Poly(A)-specific ribonuclease; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, PARN, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 PDB: 2rok_A* Back     alignment and structure
>3md1_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RBD, RNP, poly(U) binding, nucleus, RNA-binding, binding protein; 1.60A {Saccharomyces cerevisiae} SCOP: d.58.7.0 Back     alignment and structure
>2e5h_A Zinc finger CCHC-type and RNA-binding motif- containing protein 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2cpz_A CUG triplet repeat RNA-binding protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2rq4_A 2rqc_A Back     alignment and structure
>2div_A TRNA selenocysteine associated protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2lcw_A RNA-binding protein FUS; RRM, nucleic acid binding protein; NMR {Homo sapiens} Back     alignment and structure
>1oo0_B CG8781-PA, drosophila Y14; RNA recognition motif, splicing, protein complex, EXON junct complex, signaling protein; 1.85A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 2hyi_B* 2j0s_D* 2xb2_D* Back     alignment and structure
>2dnz_A Probable RNA-binding protein 23; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1x5u_A Splicing factor 3B subunit 4 (spliceosome associated protein 49) (SAP 49) (SF3B50)...; structure genomics,RRM domain,splicing factor 3B; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cq1_A PTB-like protein L; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2la6_A RNA-binding protein FUS; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, RNA recognition; NMR {Homo sapiens} Back     alignment and structure
>1p27_B RNA-binding protein 8A; nuclear protein, mRNA splicing; 2.00A {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cqc_A Arginine/serine-rich splicing factor 10; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dgs_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cpe_A RNA-binding protein EWS; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2fy1_A RNA-binding motif protein, Y chromosome, family 1 member A1; RNA binding protein, structure, protein-RNA complex, RNA stem-loop, structural protein/RNA complex; NMR {Homo sapiens} Back     alignment and structure
>2dgx_A KIAA0430 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2kxn_B Transformer-2 protein homolog beta; SR protein, RRM, splicing factor, RNA protein complex, SMN, binding protein-RNA complex; NMR {Homo sapiens} PDB: 2rra_A 2rrb_A Back     alignment and structure
>2cqg_A TDP-43, TAR DNA-binding protein-43; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x4b_A Heterogeneous nuclear ribonucleoproteins A2/B1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3ex7_B RNA-binding protein 8A; protein-RNA complex, mRNA processing, mRNA splicing, mRNA transport, nonsense-mediated mRNA decay, nucleus; HET: ADP; 2.30A {Homo sapiens} PDB: 2j0q_D* Back     alignment and structure
>2do4_A Squamous cell carcinoma antigen recognized by T- cells 3; RRM domaim, RDB, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dnl_A Cytoplasmic polyadenylation element binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2cq4_A RNA binding motif protein 23; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cqd_A RNA-binding region containing protein 1; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2jvr_A Nucleolar protein 3; RNA recognition motif, nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding; NMR {Saccharomyces cerevisiae} PDB: 2osr_A Back     alignment and structure
>1s79_A Lupus LA protein; RRM, alpha/beta, RNA binding protein, translation; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1p1t_A Cleavage stimulation factor, 64 kDa subunit; RNA recognition motif, C-terminal helix, N-terminal helix, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dnh_A Bruno-like 5, RNA binding protein; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dnk_A 2dno_A Back     alignment and structure
>2err_A Ataxin-2-binding protein 1; protein-RNA complex, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3n9u_C Cleavage and polyadenylation specificity factor S; protein-protein complex, coexpression, heterotetramer, mRNA maturation, mRNA cleavage; 1.92A {Homo sapiens} Back     alignment and structure
>3ucg_A Polyadenylate-binding protein 2; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative; HET: PGE; 1.95A {Homo sapiens} PDB: 3b4d_A 3b4m_A Back     alignment and structure
>3d2w_A TAR DNA-binding protein 43; DP-43 proteinopathy, TDP-43 inclusions, RNA recognition MOTI U, ALS, RRM; HET: DNA; 1.65A {Mus musculus} Back     alignment and structure
>2jvo_A Nucleolar protein 3; nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding, rRNA processing; NMR {Saccharomyces cerevisiae} PDB: 2osq_A Back     alignment and structure
>2ek1_A RNA-binding protein 12; RNA recognition motif, dimer, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.00A {Homo sapiens} PDB: 2ek6_A Back     alignment and structure
>2cpy_A RNA-binding protein 12; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dgo_A Cytotoxic granule-associated RNA binding protein 1; RRM domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2rne_A 2dh7_A Back     alignment and structure
>2dnm_A SRP46 splicing factor; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dh8_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x4d_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2ku7_A MLL1 PHD3-CYP33 RRM chimeric protein; transcriptional regulation, RRM domain, transcr; NMR {Homo sapiens} Back     alignment and structure
>2j8a_A Histone-lysine N-methyltransferase, H3 lysine-4 specific; histone methyltransferase, RRM fold, telomere, nuclear protein; 3.0A {Saccharomyces cerevisiae} Back     alignment and structure
>2wbr_A GW182, gawky, LD47780P; DNA-binding protein, RRM, RBD, TNRC6A, mirnas, P-bodies, argonaute, mRNA decay; NMR {Drosophila melanogaster} Back     alignment and structure
>2dha_A FLJ20171 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2jwn_A Embryonic polyadenylate-binding protein 2-B; epabp2, poly(A) binding, structural genomics, protein structure initiative, PSI-2; NMR {Xenopus laevis} Back     alignment and structure
>2krb_A Eukaryotic translation initiation factor 3 subunit B; EIF3, eukaryotic initiation factor, EIF3B, EIF3J; NMR {Homo sapiens} Back     alignment and structure
>1wg5_A Heterogeneous nuclear ribonucleoprotein H; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dis_A Unnamed protein product; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1wey_A Calcipressin 1; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1wf0_A TDP-43, TAR DNA-binding protein-43; structural genomics, RRM domain, riken structural genomics/proteomics initiative RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cq0_A Eukaryotic translation initiation factor 3 subunit 4; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2j76_E EIF-4B, EIF4B, eukaryotic translation initiation factor 4B; protein biosynthesis, RNA recognition motif, RNA binding domain, RRM, RBD, RNP; NMR {Homo sapiens} Back     alignment and structure
>1whx_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2do0_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RNA recognition motif, RRM, RNA binding domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3beg_B Splicing factor, arginine/serine-rich 1; kinase, SR protein kinase, SR protein, PRE-mRNA splicing, at binding, chromosome partition; HET: SEP ANP; 2.90A {Homo sapiens} SCOP: d.58.7.1 PDB: 2o3d_A 1wg4_A Back     alignment and structure
>1wf1_A RNA-binding protein RALY; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wf2_A Back     alignment and structure
>2cqp_A RNA-binding protein 12; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2d9p_A Polyadenylate-binding protein 3; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2lmi_A GRSF-1, G-rich sequence factor 1; G-rich RNA sequence binding factor, RNA binding domain, STRU genomics, joint center for structural genomics, JCSG; NMR {Homo sapiens} Back     alignment and structure
>2kt5_A RNA and export factor-binding protein 2; chaperone, mRNA processing, mRNA splicing, transport, nucleus, RNA-binding, spliceosome, transport; NMR {Mus musculus} Back     alignment and structure
>2dgv_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2dh9_A Back     alignment and structure
>1why_A Hypothetical protein riken cDNA 1810017N16; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2dnn_A RNA-binding protein 12; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x4f_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2dgt_A RNA-binding protein 30; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1wi8_A EIF-4B, eukaryotic translation initiation factor 4B; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2la4_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNA recognition, stress granules, nucleus, RNA-binding, transcription; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2ki2_A SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA binding proteins, RNA binding protein/SS-DNA binding protein complex; NMR {Helicobacter pylori} Back     alignment and structure
>2khc_A Testis-specific RNP-type RNA binding protein; RRM, RNA recognition motif, bruno; NMR {Drosophila melanogaster} Back     alignment and structure
>1nu4_A U1A RNA binding domain; RNA recognition motif, U1 small nuclear ribonucleoprotein, R binding domain, RNA binding protein; HET: MLA; 1.80A {Homo sapiens} SCOP: d.58.7.1 PDB: 1drz_A* 1urn_A 3hhn_B* 3egz_A* 1zzn_A* 1u6b_A* 3cun_A* 3cul_A* 3g8s_A* 3g8t_A* 3g96_A* 3g9c_A* 3irw_P* 3mum_P* 3mur_P* 3mut_P* 3muv_P* 3mxh_P* 3p49_B 3r1h_A* ... Back     alignment and structure
>1x4c_A Splicing factor, arginine/serine-rich 1; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2hgl_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative, splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kfy_A Back     alignment and structure
>2dnp_A RNA-binding protein 14; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dnq_A RNA-binding protein 4B; RRM domain,RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2hvz_A Splicing factor, arginine/serine-rich 7; RRM, RNA binding protein; NMR {Homo sapiens} Back     alignment and structure
>1wel_A RNA-binding protein 12; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x4g_A Nucleolysin TIAR; structural genomics, RRM domain, TIA-1 related protein, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3ulh_A THO complex subunit 4; nuclear protein, RNA binding, structural genomi center for structural genomics, JCSG, protein structure INI PSI-biology; 2.54A {Homo sapiens} PDB: 1no8_A Back     alignment and structure
>1u6f_A Tcubp1, RNA-binding protein UBP1; trypanosome, mRNA-binding protein, GU-rich RNA, structure; NMR {Trypanosoma cruzi} SCOP: d.58.7.1 Back     alignment and structure
>1wex_A Hypothetical protein (riken cDNA 2810036L13); structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1sjr_A Polypyrimidine tract-binding protein 1; extended babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2adb_A Back     alignment and structure
>3lqv_A PRE-mRNA branch site protein P14; cysless mutant, PRE-mRNA splicing, adenine, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: ADE; 2.38A {Homo sapiens} SCOP: d.58.7.1 PDB: 2f9d_A 2f9j_A 2fho_B Back     alignment and structure
>2db1_A Heterogeneous nuclear ribonucleoprotein F; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>1wez_A HnRNP H', FTP-3, heterogeneous nuclear ribonucleoprotein H'; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3zzy_A Polypyrimidine tract-binding protein 1; protein binding, peptide binding, RNA recognition motif; 1.40A {Homo sapiens} PDB: 3zzz_A Back     alignment and structure
>2voo_A Lupus LA protein; RNA-binding protein, RNA recognition motif, systemic lupus erythematosus, phosphoprotein, RNA maturation; 1.8A {Homo sapiens} SCOP: a.4.5.46 d.58.7.1 PDB: 2von_A 2vod_A 2vop_A 1zh5_A 1yty_A 1s7a_A Back     alignment and structure
>1h2v_Z 20 kDa nuclear CAP binding protein; CAP-binding-complex, RNP domain, MIF4G domain, RNA maturation, RNA export, nuclear protein, RNA-binding; 2.0A {Homo sapiens} SCOP: d.58.7.1 PDB: 1h2u_X* 1h2t_Z 1n52_B* 1n54_B 3fex_B 3fey_B 1h6k_X Back     alignment and structure
>3p3d_A Nucleoporin 53; structural genomics, PSI-2, protein structure initiative, NE structural genomix research consortium, nysgxrc; 2.35A {Pichia guilliermondii} Back     alignment and structure
>2dgu_A Heterogeneous nuclear ribonucleoprotein Q; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dk2_A Back     alignment and structure
>2f3j_A RNA and export factor binding protein 2; RRM domain, RBD domain., transport protein; NMR {Mus musculus} Back     alignment and structure
>2e5j_A Methenyltetrahydrofolate synthetase domain containing; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2cq2_A Hypothetical protein LOC91801; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>4a8x_A RNA-binding protein with serine-rich domain 1; transcription, splicing, RNA processing, nonsense mediated D NMD, HDAC, histone deacetylation; 1.90A {Homo sapiens} Back     alignment and structure
>2cqh_A IGF-II mRNA-binding protein 2 isoform A; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cpx_A Hypothetical protein FLJ11016; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1fj7_A Nucleolin RBD1, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Back     alignment and structure
>2e5i_A Heterogeneous nuclear ribonucleoprotein L-like; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2ywk_A Putative RNA-binding protein 11; RRM-domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.54A {Homo sapiens} Back     alignment and structure
>3q2s_C Cleavage and polyadenylation specificity factor S; CFIM, CFIM25, CFIM68, CPSF5, CPSF6, CPSF, 3' END processing, processing, cleavage factor; 2.90A {Homo sapiens} PDB: 3q2t_C Back     alignment and structure
>3ctr_A Poly(A)-specific ribonuclease PARN; protein-RNA-complex, M7G-CAP, M7GTP, RNA recognition motif, RRM, cytoplasm, exonuclease, hydrolase, magnesium; HET: MGP; 2.10A {Homo sapiens} Back     alignment and structure
>3pq1_A Poly(A) RNA polymerase; nucleotidyl transferase, RNP-type RNA binding domain, poly(A polymerase, mitochondria, transferase; 3.10A {Homo sapiens} Back     alignment and structure
>2hgm_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg0_A Back     alignment and structure
>2e44_A Insulin-like growth factor 2 mRNA binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2cqi_A Nucleolysin TIAR; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, ST genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1wg1_A KIAA1579 protein, homolog EXC-7; RBD, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wi6_A Back     alignment and structure
>3egn_A RNA-binding protein 40; RNA recognition motif (RRM), RNP motif, U11/U12-65K protein, DI-snRNP, U1A protein, U2B protein; 2.50A {Homo sapiens} Back     alignment and structure
>2cq3_A RNA-binding protein 9; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dgw_A Probable RNA-binding protein 19; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x4a_A Splicing factor, arginine/serine-rich 1 (splicing factor 2, alternate splicing factor)...; structure genomics, SURP domain, splicing factor SF2; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2nlw_A Eukaryotic translation initiation factor 3 subunit 9; eukaryotic initiation factor 3 complex, RNA recognition motif; NMR {Homo sapiens} Back     alignment and structure
>2dng_A Eukaryotic translation initiation factor 4H; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2cpf_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1x5o_A RNA binding motif, single-stranded interacting protein 1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2l08_A Regulator of nonsense transcripts 3A; NESG, nonsense regulator, structural genomics, PSI-2, protei structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2ytc_A PRE-mRNA-splicing factor RBM22; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2fc9_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2xs2_A Deleted in azoospermia-like; RNA binding protein-RNA complex; 1.35A {Mus musculus} PDB: 2xs7_A 2xs5_A 2xsf_A Back     alignment and structure
>2dhg_A TRNA selenocysteine associated protein (SECP43); RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2cpj_A Non-POU domain-containing octamer-binding protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2a3j_A U1 small nuclear ribonucleoprotein A; computationally designed protein, RRM, U1A, RNA binding protein; NMR {Homo sapiens} Back     alignment and structure
>2kvi_A Nuclear polyadenylated RNA-binding protein 3; RNA-binding motif, RRM, transcription termination, NUC phosphoprotein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2cpi_A CCR4-NOT transcription complex subunit 4; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2xnq_A Nuclear polyadenylated RNA-binding protein 3; transcription termination, RNA processi recognition, RRM; HET: CAF; 1.30A {Saccharomyces cerevisiae} PDB: 2xnr_A 2l41_A Back     alignment and structure
>2e5g_A U6 snRNA-specific terminal uridylyltransferase 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3u1l_A PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 1.64A {Saccharomyces cerevisiae} PDB: 3u1m_A 3tp2_A Back     alignment and structure
>2cpd_A Apobec-1 stimulating protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2hzc_A Splicing factor U2AF 65 kDa subunit; RNA splicing, RRM, RNA recognition, alternative conformation binding protein; HET: P6G; 1.47A {Homo sapiens} PDB: 1u2f_A Back     alignment and structure
>1fjc_A Nucleolin RBD2, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Back     alignment and structure
>3tht_A Alkylated DNA repair protein ALKB homolog 8; structural genomics, PSI-biology, northeast structural genom consortium, NESG; HET: AKG; 3.01A {Homo sapiens} PDB: 3thp_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 347
d1hbka_89 a.11.1.1 (A:) Acyl-CoA binding protein {Plasmodium 5e-28
d1hb6a_86 a.11.1.1 (A:) Acyl-CoA binding protein {Cow (Bos t 2e-24
d1uawa_77 d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [Tax 3e-17
d1x0fa175 d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0 5e-17
d2cq4a1101 d.58.7.1 (A:132-232) RNA binding protein 23 {Human 8e-17
d1l3ka184 d.58.7.1 (A:8-91) Nuclear ribonucleoprotein A1 (RN 1e-16
d2cpha194 d.58.7.1 (A:454-547) Probable RNA-binding protein 2e-16
d1x4ba1103 d.58.7.1 (A:8-110) Heterogeneous nuclear ribonucle 6e-16
d1hd0a_75 d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprot 2e-15
d2cqga190 d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TD 3e-15
d1u2fa_90 d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit 1e-14
d1cvja180 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human 5e-14
d2u2fa_85 d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit 2e-13
d2cpfa185 d.58.7.1 (A:362-446) Probable RNA-binding protein 4e-13
d1l3ka279 d.58.7.1 (A:103-181) Nuclear ribonucleoprotein A1 5e-13
d1b7fa285 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophil 6e-13
d2msta_75 d.58.7.1 (A:) Neural RNA-binding protein Musashi-1 1e-12
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 2e-12
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 2e-08
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 9e-07
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 3e-05
d1wdya_ 285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 4e-05
d2cqda1103 d.58.7.1 (A:1-103) RNA-binding region containing p 2e-12
d1h2vz_93 d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding pro 3e-12
d1wi8a_104 d.58.7.1 (A:) Eukaryotic translation initiation fa 6e-12
d1fxla285 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Ho 7e-12
d1no8a_78 d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus muscu 7e-12
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 1e-11
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 1e-04
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 2e-04
d2cqpa186 d.58.7.1 (A:917-1002) RNA-binding protein 12 {Mous 2e-11
d1x5ua193 d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Hu 2e-11
d1b7fa182 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophil 2e-11
d1whwa_99 d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm 3e-11
d1u1qa_183 d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1 3e-11
d1u1qa_183 d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1 4e-11
d1n11a_ 408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 4e-11
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 2e-10
d1n11a_ 408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 6e-09
d1n11a_ 408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 6e-08
d1n11a_ 408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 1e-06
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 4e-04
d1n11a_ 408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 7e-04
d2f9da1114 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p 4e-11
d1wf2a_98 d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprot 4e-11
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 2e-10
d1sw6a_ 301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 9e-09
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 1e-05
d2cqca183 d.58.7.1 (A:109-191) Arginine/serine-rich splicing 2e-10
d2cqba189 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomer 3e-10
d1wf0a_88 d.58.7.1 (A:) TAR DNA-binding protein 43, TDP-43 { 4e-10
d1x5ta183 d.58.7.1 (A:8-90) Splicing factor 3B subunit 4 {Hu 4e-10
d1wg5a_104 d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprot 5e-10
d2cpya1103 d.58.7.1 (A:536-638) RNA-binding protein 12 {Human 8e-10
d1fjca_96 d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocrice 1e-09
d1x4aa195 d.58.7.1 (A:9-103) Splicing factor, arginine/serin 1e-09
d1cvja289 d.58.7.1 (A:91-179) Poly(A)-binding protein {Human 1e-09
d1fxla182 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Hom 1e-09
d2disa196 d.58.7.1 (A:8-103) Hypothetical protein FLJ20273 { 2e-09
d2cq0a190 d.58.7.1 (A:231-320) Eukaryotic translation initia 2e-09
d2cqha180 d.58.7.1 (A:2-81) IGF-II mRNA-binding protein 2 is 3e-09
d1x4ha198 d.58.7.1 (A:8-105) RNA-binding protein 28 {Mouse ( 4e-09
d2cq3a193 d.58.7.1 (A:110-202) RNA-binding protein 9 {Human 4e-09
d2cpja186 d.58.7.1 (A:65-150) Non-POU domain-containing octa 6e-09
d2cpza1102 d.58.7.1 (A:383-484) CUG triplet repeat RNA-bindin 6e-09
d2ghpa181 d.58.7.1 (A:116-196) U4/U6 snRNA-associated-splici 9e-09
d1weza_102 d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprot 2e-08
d1nu4a_91 d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo 3e-08
d1x5sa190 d.58.7.1 (A:8-97) Cold-inducible RNA-binding prote 4e-08
d2ajaa1 346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 4e-08
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 7e-06
d2ajaa1 346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 4e-04
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 5e-08
d1k1aa_ 228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 2e-06
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 0.003
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 7e-08
d1s70b_ 291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 2e-06
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 6e-06
d2ghpa386 d.58.7.1 (A:206-291) U4/U6 snRNA-associated-splici 8e-08
d1wela1112 d.58.7.1 (A:412-523) RNA-binding protein 12 {Human 9e-08
d1rk8a_88 d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Dr 1e-07
d1p1ta_104 d.58.7.1 (A:) Cleavage stimulation factor, 64 kda 1e-07
d2cpea1101 d.58.7.1 (A:353-453) RNA-binding protein EWS {Huma 1e-07
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 2e-07
d1ixva_ 229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 1e-06
d2cpxa1102 d.58.7.1 (A:291-392) RNA-binding protein 41, RBM41 2e-07
d2adba1108 d.58.7.1 (A:177-284) Polypyrimidine tract-binding 3e-07
d1zh5a285 d.58.7.1 (A:105-189) Lupus LA protein {Human (Homo 3e-07
d2ghpa275 d.58.7.1 (A:41-115) U4/U6 snRNA-associated-splicin 3e-07
d1fjeb191 d.58.7.1 (B:1-91) Nucleolin {Golden hamster (Mesoc 3e-07
d2cpia189 d.58.7.1 (A:101-189) E3 ubiquitin protein ligase C 3e-07
d2cpda186 d.58.7.1 (A:223-308) APOBEC1 stimulating protein { 3e-07
d1x4ga196 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo s 3e-07
d2cqia190 d.58.7.1 (A:1-90) Nucleolysin TIAR {Human (Homo sa 4e-07
d1uoha_223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 6e-07
d1uoha_223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 2e-05
d1uoha_223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 2e-04
d1uoha_223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 0.002
d1u6fa1139 d.58.7.1 (A:1-139) RNA-binding protein UBP1 {Trypa 1e-06
d2bz2a179 d.58.7.1 (A:35-113) Negative elongation factor E, 2e-06
d1wwha181 d.58.7.1 (A:169-249) Nucleoporin 35 {Mouse (Mus mu 2e-06
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 2e-06
d1oy3d_ 255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 2e-06
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 1e-04
d1weya_104 d.58.7.1 (A:) Calcipressin-1 {Mouse (Mus musculus) 1e-05
d1wg4a_98 d.58.7.1 (A:) Splicing factor, arginine/serine-ric 1e-05
d1ot8a_209 d.211.1.1 (A:) Neurogenic locus notch receptor dom 1e-05
d1x4ea172 d.58.7.1 (A:8-79) RNA-binding motif, single-strand 2e-05
d1ihba_156 d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens 4e-05
d1wg1a_88 d.58.7.1 (A:) Probable RNA-binding protein KIAA157 5e-05
d1bd8a_156 d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Huma 7e-05
d1bd8a_156 d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Huma 0.002
U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]} Length = 104" target="_blank" href="http://scop.mrc-lmb.cam.ac.uk/scop/search.cgi?sid=d1jmta_">d1jmta_104 d.58.7.3 (A:) 7e-05
d1whya_97 d.58.7.1 (A:) Putative RNA-binding protein 15B, Rb 2e-04
d1wi6a175 d.58.7.1 (A:69-143) Ribonucleoprotein PTB-binding 2e-04
d1iknd_221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 3e-04
d1iknd_ 221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 3e-04
d1x4da189 d.58.7.1 (A:8-96) Matrin 3 {Mouse (Mus musculus) [ 3e-04
d2adca1109 d.58.7.1 (A:335-443) Polypyrimidine tract-binding 5e-04
d2dita199 d.58.7.1 (A:8-106) HIV Tat-specific factor 1 {Huma 0.001
d2adca288 d.58.7.1 (A:444-531) Polypyrimidine tract-binding 0.001
d1x5oa1101 d.58.7.1 (A:8-108) RNA-binding motif, single-stran 0.001
d1awcb_153 d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 { 0.002
d2cq2a1101 d.58.7.1 (A:25-125) Alkylation repair AlkB homolog 0.002
d1ycsb1130 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) 0.003
>d1hbka_ a.11.1.1 (A:) Acyl-CoA binding protein {Plasmodium falciparum [TaxId: 5833]} Length = 89 Back     information, alignment and structure

class: All alpha proteins
fold: Acyl-CoA binding protein-like
superfamily: Acyl-CoA binding protein
family: Acyl-CoA binding protein
domain: Acyl-CoA binding protein
species: Plasmodium falciparum [TaxId: 5833]
 Score =  102 bits (256), Expect = 5e-28
 Identities = 26/89 (29%), Positives = 47/89 (52%), Gaps = 2/89 (2%)

Query: 93  NMEDRFNQACDYLPSLVK--KLDSSTLLKFYALYKQATVGQCNIDKPSWYNMEAKSKYNA 150
           +M   F +   ++  L +   L +   L  Y  YKQ+T+G CNI +PS +    + KY A
Sbjct: 1   HMAQVFEECVSFINGLPRTINLPNELKLDLYKYYKQSTIGNCNIKEPSAHKYIDRKKYEA 60

Query: 151 WNSLGQMAKSEAMSKYIALLKEVDAGWED 179
           W S+  + + +A  +Y+ ++ E+   W+D
Sbjct: 61  WKSVENLNREDAQKRYVDIVSEIFPYWQD 89


>d1hb6a_ a.11.1.1 (A:) Acyl-CoA binding protein {Cow (Bos taurus) [TaxId: 9913]} Length = 86 Back     information, alignment and structure
>d1uawa_ d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 77 Back     information, alignment and structure
>d1x0fa1 d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo sapiens) [TaxId: 9606]} Length = 75 Back     information, alignment and structure
>d2cq4a1 d.58.7.1 (A:132-232) RNA binding protein 23 {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d1l3ka1 d.58.7.1 (A:8-91) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 84 Back     information, alignment and structure
>d2cpha1 d.58.7.1 (A:454-547) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 94 Back     information, alignment and structure
>d1x4ba1 d.58.7.1 (A:8-110) Heterogeneous nuclear ribonucleoproteins A2/B1 {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1hd0a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein d0 {Human (Homo sapiens) [TaxId: 9606]} Length = 75 Back     information, alignment and structure
>d2cqga1 d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d1u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d1cvja1 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 80 Back     information, alignment and structure
>d2u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d2cpfa1 d.58.7.1 (A:362-446) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 85 Back     information, alignment and structure
>d1l3ka2 d.58.7.1 (A:103-181) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 79 Back     information, alignment and structure
>d1b7fa2 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Length = 85 Back     information, alignment and structure
>d2msta_ d.58.7.1 (A:) Neural RNA-binding protein Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 75 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d2cqda1 d.58.7.1 (A:1-103) RNA-binding region containing protein 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1h2vz_ d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d1wi8a_ d.58.7.1 (A:) Eukaryotic translation initiation factor 4B {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1fxla2 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d1no8a_ d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 10090]} Length = 78 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2cqpa1 d.58.7.1 (A:917-1002) RNA-binding protein 12 {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 Back     information, alignment and structure
>d1x5ua1 d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d1b7fa1 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Length = 82 Back     information, alignment and structure
>d1whwa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 99 Back     information, alignment and structure
>d1u1qa_ d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 183 Back     information, alignment and structure
>d1u1qa_ d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 183 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d2f9da1 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p14 {Human (Homo sapiens) [TaxId: 9606]} Length = 114 Back     information, alignment and structure
>d1wf2a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoproteins C1/C2 {Human (Homo sapiens) [TaxId: 9606]} Length = 98 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d2cqca1 d.58.7.1 (A:109-191) Arginine/serine-rich splicing factor 10 {Human (Homo sapiens) [TaxId: 9606]} Length = 83 Back     information, alignment and structure
>d2cqba1 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomerase E, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 89 Back     information, alignment and structure
>d1wf0a_ d.58.7.1 (A:) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1x5ta1 d.58.7.1 (A:8-90) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Length = 83 Back     information, alignment and structure
>d1wg5a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d2cpya1 d.58.7.1 (A:536-638) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1fjca_ d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Length = 96 Back     information, alignment and structure
>d1x4aa1 d.58.7.1 (A:9-103) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Length = 95 Back     information, alignment and structure
>d1cvja2 d.58.7.1 (A:91-179) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 89 Back     information, alignment and structure
>d1fxla1 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Length = 82 Back     information, alignment and structure
>d2disa1 d.58.7.1 (A:8-103) Hypothetical protein FLJ20273 {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d2cq0a1 d.58.7.1 (A:231-320) Eukaryotic translation initiation factor 3 subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d2cqha1 d.58.7.1 (A:2-81) IGF-II mRNA-binding protein 2 isoform A {Human (Homo sapiens) [TaxId: 9606]} Length = 80 Back     information, alignment and structure
>d1x4ha1 d.58.7.1 (A:8-105) RNA-binding protein 28 {Mouse (Mus musculus) [TaxId: 10090]} Length = 98 Back     information, alignment and structure
>d2cq3a1 d.58.7.1 (A:110-202) RNA-binding protein 9 {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d2cpja1 d.58.7.1 (A:65-150) Non-POU domain-containing octamer-binding protein, NonO {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 Back     information, alignment and structure
>d2cpza1 d.58.7.1 (A:383-484) CUG triplet repeat RNA-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d2ghpa1 d.58.7.1 (A:116-196) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 81 Back     information, alignment and structure
>d1weza_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d1nu4a_ d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo sapiens) [TaxId: 9606]} Length = 91 Back     information, alignment and structure
>d1x5sa1 d.58.7.1 (A:8-97) Cold-inducible RNA-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d2ghpa3 d.58.7.1 (A:206-291) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 86 Back     information, alignment and structure
>d1wela1 d.58.7.1 (A:412-523) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} Length = 112 Back     information, alignment and structure
>d1rk8a_ d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 88 Back     information, alignment and structure
>d1p1ta_ d.58.7.1 (A:) Cleavage stimulation factor, 64 kda subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d2cpea1 d.58.7.1 (A:353-453) RNA-binding protein EWS {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d2cpxa1 d.58.7.1 (A:291-392) RNA-binding protein 41, RBM41 {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d2adba1 d.58.7.1 (A:177-284) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 108 Back     information, alignment and structure
>d1zh5a2 d.58.7.1 (A:105-189) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d2ghpa2 d.58.7.1 (A:41-115) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 75 Back     information, alignment and structure
>d1fjeb1 d.58.7.1 (B:1-91) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Length = 91 Back     information, alignment and structure
>d2cpia1 d.58.7.1 (A:101-189) E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musculus) [TaxId: 10090]} Length = 89 Back     information, alignment and structure
>d2cpda1 d.58.7.1 (A:223-308) APOBEC1 stimulating protein {Human (Homo sapiens) [TaxId: 9606]} Length = 86 Back     information, alignment and structure
>d1x4ga1 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d2cqia1 d.58.7.1 (A:1-90) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d1u6fa1 d.58.7.1 (A:1-139) RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId: 5693]} Length = 139 Back     information, alignment and structure
>d2bz2a1 d.58.7.1 (A:35-113) Negative elongation factor E, NELF-E {Human (Homo sapiens) [TaxId: 9606]} Length = 79 Back     information, alignment and structure
>d1wwha1 d.58.7.1 (A:169-249) Nucleoporin 35 {Mouse (Mus musculus) [TaxId: 10090]} Length = 81 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1weya_ d.58.7.1 (A:) Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 104 Back     information, alignment and structure
>d1wg4a_ d.58.7.1 (A:) Splicing factor, arginine/serine-rich 9 (SFRS9) {Mouse (Mus musculus) [TaxId: 10090]} Length = 98 Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 Back     information, alignment and structure
>d1x4ea1 d.58.7.1 (A:8-79) RNA-binding motif, single-stranded-interacting protein 2, RBMS2 {Human (Homo sapiens) [TaxId: 9606]} Length = 72 Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1wg1a_ d.58.7.1 (A:) Probable RNA-binding protein KIAA1579 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1jmta_ d.58.7.3 (A:) U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1whya_ d.58.7.1 (A:) Putative RNA-binding protein 15B, Rbm15b {Mouse (Mus musculus) [TaxId: 10090]} Length = 97 Back     information, alignment and structure
>d1wi6a1 d.58.7.1 (A:69-143) Ribonucleoprotein PTB-binding 1, Raver-1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 75 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1x4da1 d.58.7.1 (A:8-96) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} Length = 89 Back     information, alignment and structure
>d2adca1 d.58.7.1 (A:335-443) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 109 Back     information, alignment and structure
>d2dita1 d.58.7.1 (A:8-106) HIV Tat-specific factor 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 99 Back     information, alignment and structure
>d2adca2 d.58.7.1 (A:444-531) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1x5oa1 d.58.7.1 (A:8-108) RNA-binding motif, single-stranded-interacting protein 1, RBMS1 {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 153 Back     information, alignment and structure
>d2cq2a1 d.58.7.1 (A:25-125) Alkylation repair AlkB homolog 8, ALKBH8 {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 130 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query347
d1u1qa_183 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 99.87
d1l3ka184 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 99.86
d2cqga190 TAR DNA-binding protein 43, TDP-43 {Human (Homo sa 99.85
d1hd0a_75 Heterogeneous nuclear ribonucleoprotein d0 {Human 99.84
d1uawa_77 Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} 99.84
d1x0fa175 Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo s 99.84
d1x4ba1103 Heterogeneous nuclear ribonucleoproteins A2/B1 {Hu 99.84
d1x5ua193 Splicing factor 3B subunit 4 {Human (Homo sapiens) 99.83
d1l3ka279 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 99.83
d1hbka_89 Acyl-CoA binding protein {Plasmodium falciparum [T 99.83
d1hb6a_86 Acyl-CoA binding protein {Cow (Bos taurus) [TaxId: 99.83
d1b7fa182 Sex-lethal protein {Drosophila melanogaster [TaxId 99.83
d1cvja180 Poly(A)-binding protein {Human (Homo sapiens) [Tax 99.83
d2u2fa_85 Splicing factor U2AF 65 KDa subunit {Human (Homo s 99.82
d2cq4a1101 RNA binding protein 23 {Human (Homo sapiens) [TaxI 99.82
d2cqba189 Peptidyl-prolyl cis-trans isomerase E, N-terminal 99.82
d1rk8a_88 RNA-binding protein 8 {Fruit fly (Drosophila melan 99.82
d1fxla182 Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9 99.82
d1h2vz_93 CBP20, 20KDa nuclear cap-binding protein {Human (H 99.82
d2cqca183 Arginine/serine-rich splicing factor 10 {Human (Ho 99.82
d2cq0a190 Eukaryotic translation initiation factor 3 subunit 99.81
d1fxla285 Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9 99.81
d1whwa_99 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.81
d2cqda1103 RNA-binding region containing protein 1 {Human (Ho 99.81
d1ycsb1130 53BP2 {Human (Homo sapiens) [TaxId: 9606]} 99.81
d1b7fa285 Sex-lethal protein {Drosophila melanogaster [TaxId 99.81
d2cpza1102 CUG triplet repeat RNA-binding protein 1 {Human (H 99.81
d1x5sa190 Cold-inducible RNA-binding protein {Human (Homo sa 99.81
d1dcqa1154 Pyk2-associated protein beta {Mouse (Mus musculus) 99.8
d1myoa_118 Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116] 99.8
d1u6fa1139 RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId 99.8
d2msta_75 Neural RNA-binding protein Musashi-1 {Mouse (Mus m 99.8
d2cpha194 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.8
d1p1ta_104 Cleavage stimulation factor, 64 kda subunit {Human 99.8
d2cqia190 Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 960 99.79
d1x4ha198 RNA-binding protein 28 {Mouse (Mus musculus) [TaxI 99.79
d1no8a_78 Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 1 99.79
d1x5ta183 Splicing factor 3B subunit 4 {Human (Homo sapiens) 99.79
d2cpfa185 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.79
d2ghpa386 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 99.79
d2ghpa181 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 99.78
d1zh5a285 Lupus LA protein {Human (Homo sapiens) [TaxId: 960 99.78
d2cq3a193 RNA-binding protein 9 {Human (Homo sapiens) [TaxId 99.77
d1cvja289 Poly(A)-binding protein {Human (Homo sapiens) [Tax 99.77
d2f9da1114 Pre-mRNA branch site protein p14 {Human (Homo sapi 99.76
d1fjeb191 Nucleolin {Golden hamster (Mesocricetus auratus) [ 99.76
d2ghpa275 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 99.75
d2cpea1101 RNA-binding protein EWS {Human (Homo sapiens) [Tax 99.75
d1x5oa1101 RNA-binding motif, single-stranded-interacting pro 99.75
d1bi7b_125 Cell cycle inhibitor p16ink4A {Human (Homo sapiens 99.74
d1oy3d_255 Transcription factor inhibitor I-kappa-B-beta, IKB 99.74
d2cpxa1102 RNA-binding protein 41, RBM41 {Human (Homo sapiens 99.73
d1wg5a_104 Heterogeneous nuclear ribonucleoprotein H' {Human 99.73
d1x4aa195 Splicing factor, arginine/serine-rich 1, SFRS1 {Hu 99.72
d1x4ea172 RNA-binding motif, single-stranded-interacting pro 99.72
d1wi8a_104 Eukaryotic translation initiation factor 4B {Human 99.71
d2disa196 Hypothetical protein FLJ20273 {Human (Homo sapiens 99.71
d2cpia189 E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musc 99.71
d1wf0a_88 TAR DNA-binding protein 43, TDP-43 {Human (Homo sa 99.7
d1fjca_96 Nucleolin {Golden hamster (Mesocricetus auratus) [ 99.7
d1x4ga196 Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 960 99.7
d1ycsb1130 53BP2 {Human (Homo sapiens) [TaxId: 9606]} 99.69
d1weza_102 Heterogeneous nuclear ribonucleoprotein H' {Human 99.69
d2cqha180 IGF-II mRNA-binding protein 2 isoform A {Human (Ho 99.69
d2cpda186 APOBEC1 stimulating protein {Human (Homo sapiens) 99.69
d1ot8a_209 Neurogenic locus notch receptor domain {Fruit fly 99.69
d2cqpa186 RNA-binding protein 12 {Mouse (Mus musculus) [TaxI 99.69
d2cpja186 Non-POU domain-containing octamer-binding protein, 99.69
d1bd8a_156 Cell cycle inhibitor p19ink4D {Human (Homo sapiens 99.69
d1myoa_118 Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116] 99.68
d2bz2a179 Negative elongation factor E, NELF-E {Human (Homo 99.68
d1wela1112 RNA-binding protein 12 {Human (Homo sapiens) [TaxI 99.68
d2cpya1103 RNA-binding protein 12 {Human (Homo sapiens) [TaxI 99.68
d1nu4a_91 Splicesomal U1A protein {Human (Homo sapiens) [Tax 99.67
d1uoha_223 26S proteasome non-ATPase regulatory subunit 10, g 99.67
d1whxa_111 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.67
d1bi7b_125 Cell cycle inhibitor p16ink4A {Human (Homo sapiens 99.67
d3begb187 Splicing factor, arginine/serine-rich 1, SFRS1 {Hu 99.66
d1oy3d_ 255 Transcription factor inhibitor I-kappa-B-beta, IKB 99.66
d2b0ga183 Splicesomal U1A protein {Drosophila melanogaster [ 99.65
d2adca288 Polypyrimidine tract-binding protein {Human (Homo 99.65
d2adca1109 Polypyrimidine tract-binding protein {Human (Homo 99.65
d1u2fa_90 Splicing factor U2AF 65 KDa subunit {Human (Homo s 99.65
d1ixva_229 26S proteasome non-ATPase regulatory subunit 10, g 99.65
d1wf2a_98 Heterogeneous nuclear ribonucleoproteins C1/C2 {Hu 99.64
d1wdya_285 RNase L, 2-5a-dependent ribonuclease {Human (Homo 99.64
d1u1qa_183 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 99.64
d1wi6a175 Ribonucleoprotein PTB-binding 1, Raver-1 {Mouse (M 99.64
d1awcb_153 GA bindinig protein (GABP) beta 1 {Mouse (Mus musc 99.64
d1dcqa1154 Pyk2-associated protein beta {Mouse (Mus musculus) 99.63
d2cq1a188 Polypyrimidine tract-binding protein 2, PTBP2 {Hum 99.63
d1wg1a_88 Probable RNA-binding protein KIAA1579 {Human (Homo 99.63
d2adba1108 Polypyrimidine tract-binding protein {Human (Homo 99.62
d1uoha_223 26S proteasome non-ATPase regulatory subunit 10, g 99.62
d2ajaa1 346 Hypothetical protein LPG2416 {Legionella pneumophi 99.62
d2fo1e1277 Lin-12 {Caenorhabditis elegans [TaxId: 6239]} 99.62
d1n11a_408 Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} 99.62
d1wg4a_98 Splicing factor, arginine/serine-rich 9 (SFRS9) {M 99.6
d1whya_97 Putative RNA-binding protein 15B, Rbm15b {Mouse (M 99.59
d1n11a_ 408 Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} 99.59
d1x4fa199 Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} 99.58
d1sw6a_301 Swi6 ankyrin-repeat fragment {Baker's yeast (Sacch 99.58
d1wexa_104 Heterogeneous nuclear ribonucleoprotein L-like {Mo 99.58
d1k1aa_ 228 bcl-3 {Human (Homo sapiens) [TaxId: 9606]} 99.58
d2fo1e1 277 Lin-12 {Caenorhabditis elegans [TaxId: 6239]} 99.57
d1bd8a_156 Cell cycle inhibitor p19ink4D {Human (Homo sapiens 99.56
d1ihba_156 p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606] 99.56
d1awcb_153 GA bindinig protein (GABP) beta 1 {Mouse (Mus musc 99.55
d1x4da189 Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} 99.54
d1s70b_291 Myosin phosphatase targeting subunit 1, MYPT1 {Chi 99.53
d1iknd_221 I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606 99.52
d2ajaa1 346 Hypothetical protein LPG2416 {Legionella pneumophi 99.52
d1iknd_221 I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606 99.51
d1wwha181 Nucleoporin 35 {Mouse (Mus musculus) [TaxId: 10090 99.49
d1ixva_229 26S proteasome non-ATPase regulatory subunit 10, g 99.47
d1k1aa_228 bcl-3 {Human (Homo sapiens) [TaxId: 9606]} 99.46
d1weya_104 Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090 99.46
d1s70b_ 291 Myosin phosphatase targeting subunit 1, MYPT1 {Chi 99.45
U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]}" target="_blank" href="http://scop.mrc-lmb.cam.ac.uk/scop/search.cgi?sid=d1jmta_">d1jmta_104 U2 99.43
d1ihba_156 p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606] 99.42
d1ot8a_209 Neurogenic locus notch receptor domain {Fruit fly 99.38
d1owxa_113 Lupus LA protein {Human (Homo sapiens) [TaxId: 960 99.34
d2cq2a1101 Alkylation repair AlkB homolog 8, ALKBH8 {Human (H 99.34
d2dita199 HIV Tat-specific factor 1 {Human (Homo sapiens) [T 99.26
d1wdya_285 RNase L, 2-5a-dependent ribonuclease {Human (Homo 99.24
d1sw6a_ 301 Swi6 ankyrin-repeat fragment {Baker's yeast (Sacch 99.21
d1o0pa_104 Splicing factor U2AF 65 KDa subunit {Human (Homo s 99.07
d1fxla285 Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9 97.95
d1b7fa182 Sex-lethal protein {Drosophila melanogaster [TaxId 97.85
d1cvja180 Poly(A)-binding protein {Human (Homo sapiens) [Tax 97.84
d2cqba189 Peptidyl-prolyl cis-trans isomerase E, N-terminal 97.83
d1x0fa175 Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo s 97.76
d2cpha194 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 97.75
d1hd0a_75 Heterogeneous nuclear ribonucleoprotein d0 {Human 97.75
d1fxla182 Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9 97.74
d1uawa_77 Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} 97.74
d1x5sa190 Cold-inducible RNA-binding protein {Human (Homo sa 97.72
d2cqga190 TAR DNA-binding protein 43, TDP-43 {Human (Homo sa 97.67
d2msta_75 Neural RNA-binding protein Musashi-1 {Mouse (Mus m 97.67
d2ghpa181 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 97.66
d1b7fa285 Sex-lethal protein {Drosophila melanogaster [TaxId 97.66
d2cpza1102 CUG triplet repeat RNA-binding protein 1 {Human (H 97.64
d1rk8a_88 RNA-binding protein 8 {Fruit fly (Drosophila melan 97.63
d1x4ea172 RNA-binding motif, single-stranded-interacting pro 97.63
d1no8a_78 Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 1 97.62
d1x5ua193 Splicing factor 3B subunit 4 {Human (Homo sapiens) 97.61
d2u2fa_85 Splicing factor U2AF 65 KDa subunit {Human (Homo s 97.59
d1h2vz_93 CBP20, 20KDa nuclear cap-binding protein {Human (H 97.59
d1x4ba1103 Heterogeneous nuclear ribonucleoproteins A2/B1 {Hu 97.57
d2cqda1103 RNA-binding region containing protein 1 {Human (Ho 97.54
d2cqca183 Arginine/serine-rich splicing factor 10 {Human (Ho 97.53
d1uw4a_91 RNA processing protein UPF3x, RRM domain {Human (H 97.52
d1whwa_99 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 97.5
d1l3ka184 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 97.48
d1p1ta_104 Cleavage stimulation factor, 64 kda subunit {Human 97.43
d2cq0a190 Eukaryotic translation initiation factor 3 subunit 97.43
d2cq3a193 RNA-binding protein 9 {Human (Homo sapiens) [TaxId 97.36
d1x5ta183 Splicing factor 3B subunit 4 {Human (Homo sapiens) 97.35
d1x4ha198 RNA-binding protein 28 {Mouse (Mus musculus) [TaxI 97.34
d2cq4a1101 RNA binding protein 23 {Human (Homo sapiens) [TaxI 97.33
d1whxa_111 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 97.29
d1zh5a285 Lupus LA protein {Human (Homo sapiens) [TaxId: 960 97.29
d2cpea1101 RNA-binding protein EWS {Human (Homo sapiens) [Tax 97.27
d2disa196 Hypothetical protein FLJ20273 {Human (Homo sapiens 97.27
d2adba1108 Polypyrimidine tract-binding protein {Human (Homo 97.23
d2adca288 Polypyrimidine tract-binding protein {Human (Homo 97.18
d2ghpa386 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 97.14
d1fjeb191 Nucleolin {Golden hamster (Mesocricetus auratus) [ 97.11
d3begb187 Splicing factor, arginine/serine-rich 1, SFRS1 {Hu 97.1
d1wf0a_88 TAR DNA-binding protein 43, TDP-43 {Human (Homo sa 97.09
d1u6fa1139 RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId 97.08
d2cpia189 E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musc 97.05
d1ufwa_95 Synaptojanin 2 {Human (Homo sapiens) [TaxId: 9606] 97.05
d2ghpa275 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 97.03
d1l3ka279 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 97.02
d1whya_97 Putative RNA-binding protein 15B, Rbm15b {Mouse (M 97.0
d1u2fa_90 Splicing factor U2AF 65 KDa subunit {Human (Homo s 97.0
d2f9da1114 Pre-mRNA branch site protein p14 {Human (Homo sapi 97.0
d2cqha180 IGF-II mRNA-binding protein 2 isoform A {Human (Ho 96.95
d2cqia190 Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 960 96.93
d1x5oa1101 RNA-binding motif, single-stranded-interacting pro 96.92
d1x4ga196 Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 960 96.9
d1cvja289 Poly(A)-binding protein {Human (Homo sapiens) [Tax 96.89
d2cpya1103 RNA-binding protein 12 {Human (Homo sapiens) [TaxI 96.85
d2cpda186 APOBEC1 stimulating protein {Human (Homo sapiens) 96.84
d2cpja186 Non-POU domain-containing octamer-binding protein, 96.82
d2cpxa1102 RNA-binding protein 41, RBM41 {Human (Homo sapiens 96.8
d2cpfa185 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 96.77
d1wg5a_104 Heterogeneous nuclear ribonucleoprotein H' {Human 96.75
d1wexa_104 Heterogeneous nuclear ribonucleoprotein L-like {Mo 96.74
d2b0ga183 Splicesomal U1A protein {Drosophila melanogaster [ 96.69
d2cqpa186 RNA-binding protein 12 {Mouse (Mus musculus) [TaxI 96.69
d2adca1109 Polypyrimidine tract-binding protein {Human (Homo 96.67
d1x4aa195 Splicing factor, arginine/serine-rich 1, SFRS1 {Hu 96.64
d2bz2a179 Negative elongation factor E, NELF-E {Human (Homo 96.58
d1wg1a_88 Probable RNA-binding protein KIAA1579 {Human (Homo 96.57
d1wi8a_104 Eukaryotic translation initiation factor 4B {Human 96.53
d1nu4a_91 Splicesomal U1A protein {Human (Homo sapiens) [Tax 96.52
d1wi6a175 Ribonucleoprotein PTB-binding 1, Raver-1 {Mouse (M 96.5
d2cq1a188 Polypyrimidine tract-binding protein 2, PTBP2 {Hum 96.4
d1wg4a_98 Splicing factor, arginine/serine-rich 9 (SFRS9) {M 96.33
d1wela1112 RNA-binding protein 12 {Human (Homo sapiens) [TaxI 96.31
d1owxa_113 Lupus LA protein {Human (Homo sapiens) [TaxId: 960 96.27
d2cq2a1101 Alkylation repair AlkB homolog 8, ALKBH8 {Human (H 96.13
d1x4fa199 Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} 96.05
d1x4da189 Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} 96.04
d1fjca_96 Nucleolin {Golden hamster (Mesocricetus auratus) [ 96.0
d1weza_102 Heterogeneous nuclear ribonucleoprotein H' {Human 95.66
d1whva_100 Poly(A)-specific ribonuclease PARN {Mouse (Mus mus 95.21
d1wf2a_98 Heterogeneous nuclear ribonucleoproteins C1/C2 {Hu 94.8
U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]}" target="_blank" href="http://scop.mrc-lmb.cam.ac.uk/scop/search.cgi?sid=d1jmta_">d1jmta_104 U2 94.19
d2dgxa173 Limkain-b1, LKAP {Human (Homo sapiens) [TaxId: 960 93.79
d1wwha181 Nucleoporin 35 {Mouse (Mus musculus) [TaxId: 10090 93.31
d1weya_104 Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090 92.57
d1gg3a1106 Erythroid membrane protein 4.1R {Human (Homo sapie 88.8
d2dita199 HIV Tat-specific factor 1 {Human (Homo sapiens) [T 83.23
d1h4ra1111 Merlin {Human (Homo sapiens) [TaxId: 9606]} 81.43
d1mixa1114 Talin {Chicken (Gallus gallus) [TaxId: 9031]} 80.17
>d1u1qa_ d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Ferredoxin-like
superfamily: RNA-binding domain, RBD
family: Canonical RBD
domain: Nuclear ribonucleoprotein A1 (RNP A1, UP1)
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.87  E-value=2.2e-23  Score=171.69  Aligned_cols=154  Identities=21%  Similarity=0.364  Sum_probs=123.9

Q ss_pred             cccCCCeEEEeCCCCCCCHHHHHHHHhccCCeeEEEEeeeCCCCCceeEEEEEEcCHHHHHHHHhcCCCccCCccccccC
Q psy630            4 SIRQLNKIFVGNLPWTVSHNELKKFFSEYGQIMNASVMFDKNTGLSKGFGFVTFQNKEAVDKVFSTDSHVLEGSRLSIQP   83 (347)
Q Consensus         4 ~~~~~~~l~V~nLp~~~t~~~l~~~f~~~G~i~~~~i~~~~~t~~~~g~afV~f~~~~~a~~a~~~~~~~~~g~~l~v~~   83 (347)
                      +|++.|+|||||||+++|+++|+++|++||.|..+.+++++.+|.++|||||+|.+.++|.+|+...+..+.++.+.+.+
T Consensus         2 ep~~~r~lfV~nLp~~~te~~L~~~F~~~G~v~~~~~~~~~~~~~~~g~afv~f~~~~~a~~a~~~~~~~~~~~~~~~~~   81 (183)
T d1u1qa_           2 EPEQLRKLFIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPNTKRSRGFGFVTYATVEEVDAAMNARPHKVDGRVVEPKR   81 (183)
T ss_dssp             CCHHHHEEEEESCCTTCCHHHHHHHHGGGSCEEEEEEEECTTTCCEEEEEEEEESSHHHHHHHHHTCSCEETTEECEEEE
T ss_pred             CCCCCCEEEEECCCCCCCHHHHHHHHHHcCCEEEEEeeecccCCCccCceecccCCHHHHHHHHHhcCCcccccchhhhh
Confidence            46778999999999999999999999999999999999999999999999999999999999999988888888888776


Q ss_pred             CCcccccchhhhhhcccccccccCCcccccchhhHHHHhhccccceecccCCCCCccchhHHHHHHHHHHcCCCCHHHHH
Q psy630           84 SDSHNRMAENMEDRFNQACDYLPSLVKKLDSSTLLKFYALYKQATVGQCNIDKPSWYNMEAKSKYNAWNSLGQMAKSEAM  163 (347)
Q Consensus        84 ~~~~~~~~~~~~~~f~~~~~~v~~l~~~~~~e~l~~~f~~fg~v~~g~~~~~~p~~~~~~~~~K~~aw~~~~~~~~~eA~  163 (347)
                      ..+...... ........++||+|||..+++++|+++|+.||.+....+..+++     .++.|+.|+..  ..+.++|.
T Consensus        82 ~~~~~~~~~-~~~~~~~~~i~V~~lp~~~te~~L~~~f~~~G~v~~~~i~~~~~-----~~~~~g~~fV~--f~~~e~A~  153 (183)
T d1u1qa_          82 AVSREDSQR-PGAHLTVKKIFVGGIKEDTEEHHLRDYFEQYGKIEVIEIMTDRG-----SGKKRGFAFVT--FDDHDSVD  153 (183)
T ss_dssp             CCCTTGGGS-TTTTCCCSEEEEECCCTTCCHHHHHHHHGGGSCEEEEEEEECTT-----TCCEEEEEEEE--ESCHHHHH
T ss_pred             hhhcccccc-cccccccceeEEccCCCcCCHHHHhhhhccCCceeeeeeecccc-----cCccceeEEEE--ECCHHHHH
Confidence            655443221 12234457899999999999999999999999998877766543     12233333433  44577777


Q ss_pred             HH
Q psy630          164 SK  165 (347)
Q Consensus       164 ~~  165 (347)
                      ++
T Consensus       154 ~A  155 (183)
T d1u1qa_         154 KI  155 (183)
T ss_dssp             HH
T ss_pred             HH
Confidence            65



>d1l3ka1 d.58.7.1 (A:8-91) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqga1 d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hd0a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein d0 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uawa_ d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x0fa1 d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ba1 d.58.7.1 (A:8-110) Heterogeneous nuclear ribonucleoproteins A2/B1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ua1 d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l3ka2 d.58.7.1 (A:103-181) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hbka_ a.11.1.1 (A:) Acyl-CoA binding protein {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1hb6a_ a.11.1.1 (A:) Acyl-CoA binding protein {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1b7fa1 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1cvja1 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq4a1 d.58.7.1 (A:132-232) RNA binding protein 23 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqba1 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomerase E, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rk8a_ d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1fxla1 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h2vz_ d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqca1 d.58.7.1 (A:109-191) Arginine/serine-rich splicing factor 10 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq0a1 d.58.7.1 (A:231-320) Eukaryotic translation initiation factor 3 subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fxla2 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whwa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cqda1 d.58.7.1 (A:1-103) RNA-binding region containing protein 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b7fa2 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2cpza1 d.58.7.1 (A:383-484) CUG triplet repeat RNA-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5sa1 d.58.7.1 (A:8-97) Cold-inducible RNA-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1u6fa1 d.58.7.1 (A:1-139) RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d2msta_ d.58.7.1 (A:) Neural RNA-binding protein Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cpha1 d.58.7.1 (A:454-547) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1p1ta_ d.58.7.1 (A:) Cleavage stimulation factor, 64 kda subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqia1 d.58.7.1 (A:1-90) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ha1 d.58.7.1 (A:8-105) RNA-binding protein 28 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1no8a_ d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x5ta1 d.58.7.1 (A:8-90) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpfa1 d.58.7.1 (A:362-446) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ghpa3 d.58.7.1 (A:206-291) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ghpa1 d.58.7.1 (A:116-196) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1zh5a2 d.58.7.1 (A:105-189) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq3a1 d.58.7.1 (A:110-202) RNA-binding protein 9 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cvja2 d.58.7.1 (A:91-179) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f9da1 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fjeb1 d.58.7.1 (B:1-91) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Back     information, alignment and structure
>d2ghpa2 d.58.7.1 (A:41-115) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2cpea1 d.58.7.1 (A:353-453) RNA-binding protein EWS {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5oa1 d.58.7.1 (A:8-108) RNA-binding motif, single-stranded-interacting protein 1, RBMS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cpxa1 d.58.7.1 (A:291-392) RNA-binding protein 41, RBM41 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wg5a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4aa1 d.58.7.1 (A:9-103) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ea1 d.58.7.1 (A:8-79) RNA-binding motif, single-stranded-interacting protein 2, RBMS2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wi8a_ d.58.7.1 (A:) Eukaryotic translation initiation factor 4B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2disa1 d.58.7.1 (A:8-103) Hypothetical protein FLJ20273 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpia1 d.58.7.1 (A:101-189) E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wf0a_ d.58.7.1 (A:) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fjca_ d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Back     information, alignment and structure
>d1x4ga1 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1weza_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqha1 d.58.7.1 (A:2-81) IGF-II mRNA-binding protein 2 isoform A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpda1 d.58.7.1 (A:223-308) APOBEC1 stimulating protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2cqpa1 d.58.7.1 (A:917-1002) RNA-binding protein 12 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cpja1 d.58.7.1 (A:65-150) Non-POU domain-containing octamer-binding protein, NonO {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2bz2a1 d.58.7.1 (A:35-113) Negative elongation factor E, NELF-E {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wela1 d.58.7.1 (A:412-523) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpya1 d.58.7.1 (A:536-638) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nu4a_ d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whxa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3begb1 d.58.7.1 (B:121-207) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2b0ga1 d.58.7.1 (A:1-83) Splicesomal U1A protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2adca2 d.58.7.1 (A:444-531) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adca1 d.58.7.1 (A:335-443) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wf2a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoproteins C1/C2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u1qa_ d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wi6a1 d.58.7.1 (A:69-143) Ribonucleoprotein PTB-binding 1, Raver-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cq1a1 d.58.7.1 (A:51-138) Polypyrimidine tract-binding protein 2, PTBP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wg1a_ d.58.7.1 (A:) Probable RNA-binding protein KIAA1579 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adba1 d.58.7.1 (A:177-284) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wg4a_ d.58.7.1 (A:) Splicing factor, arginine/serine-rich 9 (SFRS9) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1whya_ d.58.7.1 (A:) Putative RNA-binding protein 15B, Rbm15b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4fa1 d.58.7.1 (A:8-106) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wexa_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein L-like {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x4da1 d.58.7.1 (A:8-96) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wwha1 d.58.7.1 (A:169-249) Nucleoporin 35 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1weya_ d.58.7.1 (A:) Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1jmta_ d.58.7.3 (A:) U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1owxa_ d.58.7.1 (A:) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq2a1 d.58.7.1 (A:25-125) Alkylation repair AlkB homolog 8, ALKBH8 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dita1 d.58.7.1 (A:8-106) HIV Tat-specific factor 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1o0pa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fxla2 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b7fa1 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1cvja1 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqba1 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomerase E, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x0fa1 d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpha1 d.58.7.1 (A:454-547) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1hd0a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein d0 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fxla1 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uawa_ d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x5sa1 d.58.7.1 (A:8-97) Cold-inducible RNA-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqga1 d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2msta_ d.58.7.1 (A:) Neural RNA-binding protein Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ghpa1 d.58.7.1 (A:116-196) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1b7fa2 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2cpza1 d.58.7.1 (A:383-484) CUG triplet repeat RNA-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rk8a_ d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1x4ea1 d.58.7.1 (A:8-79) RNA-binding motif, single-stranded-interacting protein 2, RBMS2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1no8a_ d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x5ua1 d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h2vz_ d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ba1 d.58.7.1 (A:8-110) Heterogeneous nuclear ribonucleoproteins A2/B1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqda1 d.58.7.1 (A:1-103) RNA-binding region containing protein 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqca1 d.58.7.1 (A:109-191) Arginine/serine-rich splicing factor 10 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uw4a_ d.58.7.4 (A:) RNA processing protein UPF3x, RRM domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whwa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1l3ka1 d.58.7.1 (A:8-91) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p1ta_ d.58.7.1 (A:) Cleavage stimulation factor, 64 kda subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq0a1 d.58.7.1 (A:231-320) Eukaryotic translation initiation factor 3 subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq3a1 d.58.7.1 (A:110-202) RNA-binding protein 9 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ta1 d.58.7.1 (A:8-90) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ha1 d.58.7.1 (A:8-105) RNA-binding protein 28 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cq4a1 d.58.7.1 (A:132-232) RNA binding protein 23 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whxa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zh5a2 d.58.7.1 (A:105-189) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpea1 d.58.7.1 (A:353-453) RNA-binding protein EWS {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2disa1 d.58.7.1 (A:8-103) Hypothetical protein FLJ20273 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adba1 d.58.7.1 (A:177-284) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adca2 d.58.7.1 (A:444-531) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ghpa3 d.58.7.1 (A:206-291) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1fjeb1 d.58.7.1 (B:1-91) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Back     information, alignment and structure
>d3begb1 d.58.7.1 (B:121-207) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wf0a_ d.58.7.1 (A:) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u6fa1 d.58.7.1 (A:1-139) RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d2cpia1 d.58.7.1 (A:101-189) E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ufwa_ d.58.7.1 (A:) Synaptojanin 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ghpa2 d.58.7.1 (A:41-115) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1l3ka2 d.58.7.1 (A:103-181) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whya_ d.58.7.1 (A:) Putative RNA-binding protein 15B, Rbm15b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f9da1 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqha1 d.58.7.1 (A:2-81) IGF-II mRNA-binding protein 2 isoform A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqia1 d.58.7.1 (A:1-90) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5oa1 d.58.7.1 (A:8-108) RNA-binding motif, single-stranded-interacting protein 1, RBMS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ga1 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cvja2 d.58.7.1 (A:91-179) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpya1 d.58.7.1 (A:536-638) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpda1 d.58.7.1 (A:223-308) APOBEC1 stimulating protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpja1 d.58.7.1 (A:65-150) Non-POU domain-containing octamer-binding protein, NonO {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cpxa1 d.58.7.1 (A:291-392) RNA-binding protein 41, RBM41 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpfa1 d.58.7.1 (A:362-446) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wg5a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wexa_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein L-like {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2b0ga1 d.58.7.1 (A:1-83) Splicesomal U1A protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2cqpa1 d.58.7.1 (A:917-1002) RNA-binding protein 12 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2adca1 d.58.7.1 (A:335-443) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4aa1 d.58.7.1 (A:9-103) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bz2a1 d.58.7.1 (A:35-113) Negative elongation factor E, NELF-E {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wg1a_ d.58.7.1 (A:) Probable RNA-binding protein KIAA1579 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wi8a_ d.58.7.1 (A:) Eukaryotic translation initiation factor 4B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nu4a_ d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wi6a1 d.58.7.1 (A:69-143) Ribonucleoprotein PTB-binding 1, Raver-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cq1a1 d.58.7.1 (A:51-138) Polypyrimidine tract-binding protein 2, PTBP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wg4a_ d.58.7.1 (A:) Splicing factor, arginine/serine-rich 9 (SFRS9) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wela1 d.58.7.1 (A:412-523) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1owxa_ d.58.7.1 (A:) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq2a1 d.58.7.1 (A:25-125) Alkylation repair AlkB homolog 8, ALKBH8 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4fa1 d.58.7.1 (A:8-106) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x4da1 d.58.7.1 (A:8-96) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fjca_ d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Back     information, alignment and structure
>d1weza_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whva_ d.58.7.1 (A:) Poly(A)-specific ribonuclease PARN {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wf2a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoproteins C1/C2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jmta_ d.58.7.3 (A:) U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dgxa1 d.58.7.1 (A:563-635) Limkain-b1, LKAP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wwha1 d.58.7.1 (A:169-249) Nucleoporin 35 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1weya_ d.58.7.1 (A:) Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1gg3a1 a.11.2.1 (A:82-187) Erythroid membrane protein 4.1R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dita1 d.58.7.1 (A:8-106) HIV Tat-specific factor 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h4ra1 a.11.2.1 (A:104-214) Merlin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mixa1 a.11.2.1 (A:195-308) Talin {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure