Psyllid ID: psy630
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 347 | ||||||
| 242009252 | 511 | conserved hypothetical protein [Pediculu | 0.798 | 0.542 | 0.360 | 4e-53 | |
| 350406915 | 240 | PREDICTED: acyl-CoA-binding domain-conta | 0.599 | 0.866 | 0.361 | 1e-36 | |
| 340721725 | 262 | PREDICTED: acyl-CoA-binding domain-conta | 0.680 | 0.900 | 0.344 | 3e-36 | |
| 383857939 | 479 | PREDICTED: uncharacterized protein LOC10 | 0.585 | 0.423 | 0.349 | 6e-36 | |
| 380028990 | 483 | PREDICTED: putative ankyrin repeat prote | 0.582 | 0.418 | 0.362 | 6e-36 | |
| 307174126 | 233 | Acyl-CoA-binding domain-containing prote | 0.585 | 0.871 | 0.333 | 6e-35 | |
| 307195671 | 238 | Acyl-CoA-binding domain-containing prote | 0.587 | 0.857 | 0.349 | 1e-34 | |
| 332031342 | 240 | Acyl-CoA-binding domain-containing prote | 0.613 | 0.887 | 0.314 | 4e-33 | |
| 322797576 | 296 | hypothetical protein SINV_80899 [Solenop | 0.639 | 0.75 | 0.300 | 2e-32 | |
| 260795083 | 251 | hypothetical protein BRAFLDRAFT_69053 [B | 0.602 | 0.832 | 0.319 | 3e-32 |
| >gi|242009252|ref|XP_002425404.1| conserved hypothetical protein [Pediculus humanus corporis] gi|212509213|gb|EEB12666.1| conserved hypothetical protein [Pediculus humanus corporis] | Back alignment and taxonomy information |
|---|
Score = 214 bits (546), Expect = 4e-53, Method: Compositional matrix adjust.
Identities = 125/347 (36%), Positives = 181/347 (52%), Gaps = 70/347 (20%)
Query: 1 MSNSIRQLNKIFVGNLPWTVSHNELKKFFSEYGQIMNASVMFDKNTGLSKGFGFVTFQNK 60
MSN I+ L K+FV NLP+TV E KK+F +G+++ A V+FD TG SKG+GF+ ++N+
Sbjct: 218 MSN-IKALKKLFVSNLPYTVGKREFKKYFETFGKVIYADVIFDWKTGFSKGYGFILYKNE 276
Query: 61 EAVDKVFSTDSHVLEGSRLSIQPSDSHNRMAENMEDRFNQACDYLPSLVKKLDSSTLLKF 120
++ V S+ H LEG RL A ++ ++V L LL+F
Sbjct: 277 SSLKSVMSSQPHTLEGGRLV--------------------ASSHVKNIVGNLTKEQLLEF 316
Query: 121 YALYKQATVGQCNIDKPSWYNMEAKSKYNAWNSLGQMAKSEAMSKYIALLKEVDAGWEDK 180
YA YKQA G CN KP WY K K+ AW +L M
Sbjct: 317 YAHYKQAIEGPCNKPKPYWYEFSEKQKWEAWTNLNDMD---------------------- 354
Query: 181 EQEEINWDWKPNQKAMSKYIALLNEVDASWEDKEQEEINWDESQESGSKENEGQTKGWVN 240
+ AM KYI LLN++D W DK + +T+GWV+
Sbjct: 355 -----------SNLAMEKYIKLLNDIDPEWNDKPVSNV---------------KTQGWVH 388
Query: 241 VSSMINDESQLDDNEKNIYEWAKEGKLDMLVKQLTKLKDFNINQLDENGLNCLHWACDRG 300
S M N++ +++++K +++W KEG LD VK LT + IN+LDE+GL LHWA DRG
Sbjct: 389 HSCMENNDEVIEESKKTVFDWVKEGNLDK-VKALTSNINLEINKLDESGLGLLHWASDRG 447
Query: 301 HLKVVQHLIEKCGADVNVTDSDGDYGLDYAKAIEHTDLIEYLVNSGS 347
++ VV++L+E+ ADVN+ D G L +A E+ D+ YL+ SG+
Sbjct: 448 NINVVKYLVEELKADVNLRDGTGQTPLHFAVICEYDDVANYLIESGA 494
|
Source: Pediculus humanus corporis Species: Pediculus humanus Genus: Pediculus Family: Pediculidae Order: Phthiraptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|350406915|ref|XP_003487922.1| PREDICTED: acyl-CoA-binding domain-containing protein 6-like [Bombus impatiens] | Back alignment and taxonomy information |
|---|
| >gi|340721725|ref|XP_003399266.1| PREDICTED: acyl-CoA-binding domain-containing protein 6-like [Bombus terrestris] | Back alignment and taxonomy information |
|---|
| >gi|383857939|ref|XP_003704461.1| PREDICTED: uncharacterized protein LOC100882258 [Megachile rotundata] | Back alignment and taxonomy information |
|---|
| >gi|380028990|ref|XP_003698166.1| PREDICTED: putative ankyrin repeat protein FPV014-like [Apis florea] | Back alignment and taxonomy information |
|---|
| >gi|307174126|gb|EFN64784.1| Acyl-CoA-binding domain-containing protein 6 [Camponotus floridanus] | Back alignment and taxonomy information |
|---|
| >gi|307195671|gb|EFN77513.1| Acyl-CoA-binding domain-containing protein 6 [Harpegnathos saltator] | Back alignment and taxonomy information |
|---|
| >gi|332031342|gb|EGI70855.1| Acyl-CoA-binding domain-containing protein 6 [Acromyrmex echinatior] | Back alignment and taxonomy information |
|---|
| >gi|322797576|gb|EFZ19620.1| hypothetical protein SINV_80899 [Solenopsis invicta] | Back alignment and taxonomy information |
|---|
| >gi|260795083|ref|XP_002592536.1| hypothetical protein BRAFLDRAFT_69053 [Branchiostoma floridae] gi|229277756|gb|EEN48547.1| hypothetical protein BRAFLDRAFT_69053 [Branchiostoma floridae] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 347 | ||||||
| DICTYBASE|DDB_G0290237 | 288 | acbd6 "acyl-CoA-binding domain | 0.700 | 0.843 | 0.314 | 2.4e-28 | |
| UNIPROTKB|F1PLQ8 | 282 | ACBD6 "Uncharacterized protein | 0.628 | 0.773 | 0.303 | 5.5e-22 | |
| RGD|1305030 | 282 | Acbd6 "acyl-CoA binding domain | 0.449 | 0.553 | 0.36 | 7e-22 | |
| UNIPROTKB|A2VDR2 | 282 | ACBD6 "Acyl-CoA-binding domain | 0.449 | 0.553 | 0.348 | 1.9e-21 | |
| UNIPROTKB|E1C483 | 268 | ACBD6 "Uncharacterized protein | 0.449 | 0.582 | 0.348 | 3e-21 | |
| UNIPROTKB|Q9BR61 | 282 | ACBD6 "Acyl-CoA-binding domain | 0.449 | 0.553 | 0.342 | 3.9e-21 | |
| UNIPROTKB|F1S683 | 282 | ACBD6 "Uncharacterized protein | 0.668 | 0.822 | 0.285 | 1e-20 | |
| MGI|MGI:1919732 | 282 | Acbd6 "acyl-Coenzyme A binding | 0.449 | 0.553 | 0.354 | 2.7e-20 | |
| FB|FBgn0064117 | 90 | CG33714 [Drosophila melanogast | 0.227 | 0.877 | 0.506 | 4.4e-20 | |
| UNIPROTKB|G3N0L6 | 221 | ACBD6 "Acyl-CoA-binding domain | 0.270 | 0.425 | 0.382 | 2.6e-19 |
| DICTYBASE|DDB_G0290237 acbd6 "acyl-CoA-binding domain-containing protein 6" [Dictyostelium discoideum (taxid:44689)] | Back alignment and assigned GO terms |
|---|
Score = 316 (116.3 bits), Expect = 2.4e-28, P = 2.4e-28
Identities = 83/264 (31%), Positives = 145/264 (54%)
Query: 94 MEDRFNQACDYLPSLVKKLDS---STLLKFYALYKQATVGQCNIDKPSWYNMEAKSKYNA 150
+E++F A DY+ + KL + L Y YKQAT+G CN P +Y+ KSK+N+
Sbjct: 6 IENKFKLAVDYITNNSGKLSNIKNEEQLYLYCNYKQATIGDCNTKAPPFYDYIGKSKWNS 65
Query: 151 WNSLGQMAKSEAMSKYIALLKEVDAGWEDKEQEEINWDWKPNQKAMSKYIALLNEVDASW 210
WNSL + K AM+ YI+L+ + GW+ + E + Q E++
Sbjct: 66 WNSLKGVEKIVAMNSYISLVNALSPGWDSNIKVE-----RATQSVFLNDEEF-KELEKK- 118
Query: 211 EDKEQEEINWDESQESGSKENEGQTKGWVN--VS--SMINDES--QLDDNEK-NIYEWAK 263
E +E+EE+ E +E+G + + ++K W+ +S S+++DE+ +L+ N K ++ W
Sbjct: 119 EKEEKEELKKLE-EENGGEIEKPKSK-WMGPVLSKFSLVDDETLEKLEKNTKQDLGYWVS 176
Query: 264 EGKLDMLVKQLTKLKDFNINQLDENGLNCLHWACDRGHLKVVQHLIEKCGADVNVTDSDG 323
++ + K++ K+ IN++DE+G L WACDRG+ ++ + LIE G++VNV D +G
Sbjct: 177 VNDIERVKKEIENDKNI-INEVDEDGRTALIWACDRGYFEIAKLLIEN-GSNVNVQDGEG 234
Query: 324 DYGLDYAKAIEHTDLIEYLVNSGS 347
L YA + ++ + L++ S
Sbjct: 235 MTPLHYAVVCDQFEICKLLLSQSS 258
|
|
| UNIPROTKB|F1PLQ8 ACBD6 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| RGD|1305030 Acbd6 "acyl-CoA binding domain containing 6" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|A2VDR2 ACBD6 "Acyl-CoA-binding domain-containing protein 6" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E1C483 ACBD6 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q9BR61 ACBD6 "Acyl-CoA-binding domain-containing protein 6" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1S683 ACBD6 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:1919732 Acbd6 "acyl-Coenzyme A binding domain containing 6" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0064117 CG33714 [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|G3N0L6 ACBD6 "Acyl-CoA-binding domain-containing protein 6" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 347 | |||
| cd12242 | 73 | cd12242, RRM_SLIRP, RNA recognition motif found in | 2e-27 | |
| pfam00887 | 87 | pfam00887, ACBP, Acyl CoA binding protein | 2e-25 | |
| cd12330 | 75 | cd12330, RRM2_Hrp1p, RNA recognition motif 2 in ye | 7e-22 | |
| cd00435 | 85 | cd00435, ACBP, Acyl CoA binding protein (ACBP) bin | 1e-21 | |
| smart00360 | 73 | smart00360, RRM, RNA recognition motif | 1e-21 | |
| cd12325 | 72 | cd12325, RRM1_hnRNPA_hnRNPD_like, RNA recognition | 1e-20 | |
| cd12384 | 76 | cd12384, RRM_RBM24_RBM38_like, RNA recognition mot | 5e-19 | |
| cd12327 | 80 | cd12327, RRM2_DAZAP1, RNA recognition motif 2 in D | 7e-19 | |
| cd12399 | 78 | cd12399, RRM_HP0827_like, RNA recognition motif in | 7e-19 | |
| pfam00076 | 70 | pfam00076, RRM_1, RNA recognition motif | 3e-18 | |
| cd12323 | 74 | cd12323, RRM2_MSI, RNA recognition motif 2 in RNA- | 1e-17 | |
| cd12574 | 82 | cd12574, RRM1_DAZAP1, RNA recognition motif 1 in D | 8e-17 | |
| cd12328 | 73 | cd12328, RRM2_hnRNPA_like, RNA recognition motif 2 | 2e-16 | |
| cd12412 | 80 | cd12412, RRM_DAZL_BOULE, RNA recognition motif in | 2e-16 | |
| cd00590 | 72 | cd00590, RRM_SF, RNA recognition motif (RRM) super | 2e-16 | |
| cd12395 | 73 | cd12395, RRM2_RBM34, RNA recognition motif 2 in RN | 7e-16 | |
| cd12576 | 75 | cd12576, RRM1_MSI, RNA recognition motif 1 in RNA- | 1e-15 | |
| cd12757 | 75 | cd12757, RRM1_hnRNPAB, RNA recognition motif 1 in | 2e-15 | |
| COG4281 | 87 | COG4281, ACB, Acyl-CoA-binding protein [Lipid meta | 2e-15 | |
| cd12326 | 79 | cd12326, RRM1_hnRNPA0, RNA recognition motif 1 fou | 3e-15 | |
| cd12329 | 75 | cd12329, RRM2_hnRNPD_like, RNA recognition motif 2 | 4e-15 | |
| cd12575 | 74 | cd12575, RRM1_hnRNPD_like, RNA recognition motif 1 | 7e-15 | |
| cd12382 | 80 | cd12382, RRM_RBMX_like, RNA recognition motif in h | 7e-15 | |
| PTZ00458 | 90 | PTZ00458, PTZ00458, acyl CoA binding protein; Prov | 1e-14 | |
| cd12577 | 76 | cd12577, RRM1_Hrp1p, RNA recognition motif 1 in ye | 2e-14 | |
| cd12578 | 78 | cd12578, RRM1_hnRNPA_like, RNA recognition motif 1 | 2e-14 | |
| cd12321 | 77 | cd12321, RRM1_TDP43, RNA recognition motif 1 in TA | 2e-14 | |
| cd12415 | 82 | cd12415, RRM3_RBM28_like, RNA recognition motif 3 | 3e-14 | |
| cd12398 | 75 | cd12398, RRM_CSTF2_RNA15_like, RNA recognition mot | 3e-14 | |
| cd12760 | 76 | cd12760, RRM1_MSI2, RNA recognition motif 1 in RNA | 7e-14 | |
| cd12316 | 74 | cd12316, RRM3_RBM19_RRM2_MRD1, RNA recognition mot | 8e-14 | |
| cd00204 | 126 | cd00204, ANK, ankyrin repeats; ankyrin repeats med | 8e-14 | |
| cd12413 | 79 | cd12413, RRM1_RBM28_like, RNA recognition motif 1 | 9e-14 | |
| cd12362 | 73 | cd12362, RRM3_CELF1-6, RNA recognition motif 3 in | 1e-13 | |
| cd00204 | 126 | cd00204, ANK, ankyrin repeats; ankyrin repeats med | 2e-13 | |
| cd12756 | 74 | cd12756, RRM1_hnRNPD, RNA recognition motif 1 in h | 2e-13 | |
| cd12758 | 76 | cd12758, RRM1_hnRPDL, RNA recognition motif 1 in h | 2e-13 | |
| cd12759 | 77 | cd12759, RRM1_MSI1, RNA recognition motif 1 in RNA | 4e-13 | |
| cd12447 | 76 | cd12447, RRM1_gar2, RNA recognition motif 1 in yea | 1e-12 | |
| cd12579 | 80 | cd12579, RRM2_hnRNPA0, RNA recognition motif 2 in | 1e-12 | |
| cd12380 | 80 | cd12380, RRM3_I_PABPs, RNA recognition motif 3 fou | 2e-12 | |
| cd00204 | 126 | cd00204, ANK, ankyrin repeats; ankyrin repeats med | 3e-12 | |
| pfam12796 | 91 | pfam12796, Ank_2, Ankyrin repeats (3 copies) | 3e-12 | |
| cd12652 | 79 | cd12652, RRM2_Hu, RNA recognition motif 2 in the H | 3e-12 | |
| cd12361 | 77 | cd12361, RRM1_2_CELF1-6_like, RNA recognition moti | 3e-12 | |
| cd12673 | 81 | cd12673, RRM_BOULE, RNA recognition motif in prote | 5e-12 | |
| cd12566 | 79 | cd12566, RRM2_MRD1, RNA recognition motif 2 in yea | 8e-12 | |
| PLN03134 | 144 | PLN03134, PLN03134, glycine-rich RNA-binding prote | 8e-12 | |
| COG0724 | 306 | COG0724, COG0724, RNA-binding proteins (RRM domain | 9e-12 | |
| pfam14259 | 69 | pfam14259, RRM_6, RNA recognition motif (a | 9e-12 | |
| cd12391 | 72 | cd12391, RRM1_SART3, RNA recognition motif 1 in sq | 1e-11 | |
| cd12572 | 74 | cd12572, RRM2_MSI1, RNA recognition motif 2 in RNA | 2e-11 | |
| cd12567 | 79 | cd12567, RRM3_RBM19, RNA recognition motif 3 in RN | 2e-11 | |
| cd12761 | 81 | cd12761, RRM1_hnRNPA1, RNA recognition motif 1 in | 2e-11 | |
| cd12450 | 77 | cd12450, RRM1_NUCLs, RNA recognition motif 1 found | 2e-11 | |
| cd12632 | 87 | cd12632, RRM1_CELF3_4_5_6, RNA recognition motif 1 | 4e-11 | |
| cd12573 | 79 | cd12573, RRM2_MSI2, RNA recognition motif 2 in RNA | 5e-11 | |
| cd12448 | 73 | cd12448, RRM2_gar2, RNA recognition motif 2 in yea | 6e-11 | |
| cd12345 | 80 | cd12345, RRM2_SECp43_like, RNA recognition motif 2 | 7e-11 | |
| cd12762 | 81 | cd12762, RRM1_hnRNPA2B1, RNA recognition motif 1 i | 9e-11 | |
| cd12651 | 79 | cd12651, RRM2_SXL, RNA recognition motif 2 in Dros | 1e-10 | |
| cd12322 | 71 | cd12322, RRM2_TDP43, RNA recognition motif 2 in TA | 1e-10 | |
| cd12449 | 80 | cd12449, RRM_CIRBP_RBM3, RNA recognition motif in | 1e-10 | |
| cd12676 | 107 | cd12676, RRM3_Nop4p, RNA recognition motif 3 in ye | 1e-10 | |
| cd12306 | 73 | cd12306, RRM_II_PABPs, RNA recognition motif in ty | 1e-10 | |
| cd12229 | 81 | cd12229, RRM_G3BP, RNA recognition motif (RRM) in | 1e-10 | |
| cd12320 | 76 | cd12320, RRM6_RBM19_RRM5_MRD1, RNA recognition mot | 1e-10 | |
| cd12763 | 81 | cd12763, RRM1_hnRNPA3, RNA recognition motif 1 in | 2e-10 | |
| cd12381 | 79 | cd12381, RRM4_I_PABPs, RNA recognition motif 4 in | 2e-10 | |
| cd12580 | 77 | cd12580, RRM2_hnRNPA1, RNA recognition motif 2 in | 2e-10 | |
| cd12387 | 72 | cd12387, RRM3_hnRNPM_like, RNA recognition motif 3 | 3e-10 | |
| cd12376 | 79 | cd12376, RRM2_Hu_like, RNA recognition motif 2 in | 3e-10 | |
| cd12671 | 75 | cd12671, RRM_CSTF2_CSTF2T, RNA recognition motif i | 4e-10 | |
| cd12775 | 90 | cd12775, RRM2_HuB, RNA recognition motif 2 in vert | 4e-10 | |
| pfam13637 | 54 | pfam13637, Ank_4, Ankyrin repeats (many copies) | 5e-10 | |
| cd12307 | 74 | cd12307, RRM_NIFK_like, RNA recognition motif in n | 5e-10 | |
| TIGR01628 | 562 | TIGR01628, PABP-1234, polyadenylate binding protei | 6e-10 | |
| cd12552 | 77 | cd12552, RRM_Nop15p, RNA recognition motif in yeas | 7e-10 | |
| cd12363 | 78 | cd12363, RRM_TRA2, RNA recognition motif in transf | 8e-10 | |
| cd12353 | 75 | cd12353, RRM2_TIA1_like, RNA recognition motif 2 i | 8e-10 | |
| cd12355 | 80 | cd12355, RRM_RBM18, RNA recognition motif in eukar | 9e-10 | |
| TIGR01628 | 562 | TIGR01628, PABP-1234, polyadenylate binding protei | 1e-09 | |
| cd12672 | 82 | cd12672, RRM_DAZL, RNA recognition motif in verteb | 1e-09 | |
| cd12581 | 80 | cd12581, RRM2_hnRNPA2B1, RNA recognition motif 2 i | 1e-09 | |
| cd12284 | 73 | cd12284, RRM2_RBM23_RBM39, RNA recognition motif 2 | 1e-09 | |
| cd12389 | 77 | cd12389, RRM2_RAVER, RNA recognition motif 2 in ri | 1e-09 | |
| cd12619 | 75 | cd12619, RRM2_PUB1, RNA recognition motif 2 in yea | 1e-09 | |
| cd12408 | 77 | cd12408, RRM_eIF3G_like, RNA recognition motif in | 1e-09 | |
| cd12400 | 74 | cd12400, RRM_Nop6, RNA recognition motif in Saccha | 1e-09 | |
| cd12272 | 72 | cd12272, RRM2_PHIP1, RNA recognition motif 2 in Ar | 1e-09 | |
| cd12290 | 80 | cd12290, RRM1_LARP7, RNA recognition motif 1 in La | 2e-09 | |
| cd12298 | 78 | cd12298, RRM3_Prp24, RNA recognition motif 3 in fu | 2e-09 | |
| cd12311 | 73 | cd12311, RRM_SRSF2_SRSF8, RNA recognition motif in | 2e-09 | |
| cd12582 | 80 | cd12582, RRM2_hnRNPA3, RNA recognition motif 2 in | 2e-09 | |
| cd12377 | 78 | cd12377, RRM3_Hu, RNA recognition motif 3 in the H | 2e-09 | |
| cd12383 | 83 | cd12383, RRM_RBM42, RNA recognition motif in RNA-b | 2e-09 | |
| cd12674 | 79 | cd12674, RRM1_Nop4p, RNA recognition motif 1 in ye | 2e-09 | |
| cd12774 | 81 | cd12774, RRM2_HuD, RNA recognition motif 2 in vert | 2e-09 | |
| cd12283 | 73 | cd12283, RRM1_RBM39_like, RNA recognition motif 1 | 3e-09 | |
| cd12631 | 84 | cd12631, RRM1_CELF1_2_Bruno, RNA recognition motif | 4e-09 | |
| cd12393 | 78 | cd12393, RRM_ZCRB1, RNA recognition motif in Zinc | 4e-09 | |
| cd12564 | 76 | cd12564, RRM1_RBM19, RNA recognition motif 1 in RN | 4e-09 | |
| cd12407 | 76 | cd12407, RRM_FOX1_like, RNA recognition motif in v | 4e-09 | |
| cd12773 | 84 | cd12773, RRM2_HuR, RNA recognition motif 2 in vert | 6e-09 | |
| cd12776 | 81 | cd12776, RRM2_HuC, RNA recognition motif 2 in vert | 6e-09 | |
| cd12378 | 80 | cd12378, RRM1_I_PABPs, RNA recognition motif 1 in | 8e-09 | |
| TIGR01661 | 352 | TIGR01661, ELAV_HUD_SF, ELAV/HuD family splicing f | 8e-09 | |
| cd12397 | 73 | cd12397, RRM2_Nop13p_fungi, RNA recognition motif | 8e-09 | |
| pfam12796 | 91 | pfam12796, Ank_2, Ankyrin repeats (3 copies) | 1e-08 | |
| cd12411 | 89 | cd12411, RRM_ist3_like, RNA recognition motif in i | 1e-08 | |
| pfam13857 | 56 | pfam13857, Ank_5, Ankyrin repeats (many copies) | 1e-08 | |
| cd12231 | 77 | cd12231, RRM2_U2AF65, RNA recognition motif 2 foun | 1e-08 | |
| cd12375 | 77 | cd12375, RRM1_Hu_like, RNA recognition motif 1 in | 1e-08 | |
| cd12249 | 78 | cd12249, RRM1_hnRNPR_like, RNA recognition motif 1 | 1e-08 | |
| cd12335 | 83 | cd12335, RRM2_SF3B4, RNA recognition motif 2 in sp | 1e-08 | |
| cd12463 | 80 | cd12463, RRM_G3BP1, RNA recognition motif found in | 2e-08 | |
| cd12584 | 80 | cd12584, RRM2_hnRNPAB, RNA recognition motif 2 in | 2e-08 | |
| cd12585 | 75 | cd12585, RRM2_hnRPDL, RNA recognition motif 2 in h | 2e-08 | |
| cd12633 | 80 | cd12633, RRM1_FCA, RNA recognition motif 1 in plan | 2e-08 | |
| cd12379 | 77 | cd12379, RRM2_I_PABPs, RNA recognition motif 2 fou | 2e-08 | |
| cd12279 | 74 | cd12279, RRM_TUT1, RNA recognition motif in speckl | 3e-08 | |
| cd12464 | 83 | cd12464, RRM_G3BP2, RNA recognition motif in ras G | 3e-08 | |
| cd12343 | 66 | cd12343, RRM1_2_CoAA_like, RNA recognition motif 1 | 4e-08 | |
| cd12312 | 84 | cd12312, RRM_SRSF10_SRSF12, RNA recognition motif | 5e-08 | |
| cd12551 | 77 | cd12551, RRM_II_PABPN1L, RNA recognition motif in | 5e-08 | |
| cd12337 | 70 | cd12337, RRM1_SRSF4_like, RNA recognition motif 1 | 5e-08 | |
| cd12608 | 69 | cd12608, RRM1_CoAA, RNA recognition motif 1 in ver | 6e-08 | |
| cd12318 | 82 | cd12318, RRM5_RBM19_like, RNA recognition motif 5 | 7e-08 | |
| TIGR01659 | 346 | TIGR01659, sex-lethal, sex-lethal family splicing | 7e-08 | |
| TIGR01622 | 457 | TIGR01622, SF-CC1, splicing factor, CC1-like famil | 7e-08 | |
| cd12617 | 80 | cd12617, RRM2_TIAR, RNA recognition motif 2 in nuc | 8e-08 | |
| cd12565 | 76 | cd12565, RRM1_MRD1, RNA recognition motif 1 in yea | 8e-08 | |
| cd12237 | 93 | cd12237, RRM_snRNP35, RNA recognition motif found | 9e-08 | |
| TIGR01622 | 457 | TIGR01622, SF-CC1, splicing factor, CC1-like famil | 1e-07 | |
| cd12354 | 73 | cd12354, RRM3_TIA1_like, RNA recognition motif 2 i | 1e-07 | |
| cd12338 | 72 | cd12338, RRM1_SRSF1_like, RNA recognition motif 1 | 1e-07 | |
| cd12550 | 76 | cd12550, RRM_II_PABPN1, RNA recognition motif in t | 1e-07 | |
| cd12483 | 79 | cd12483, RRM1_hnRNPQ, RNA recognition motif 1 in v | 2e-07 | |
| pfam00023 | 33 | pfam00023, Ank, Ankyrin repeat | 2e-07 | |
| cd12392 | 81 | cd12392, RRM2_SART3, RNA recognition motif 2 in sq | 2e-07 | |
| cd12640 | 79 | cd12640, RRM3_Bruno_like, RNA recognition motif 3 | 2e-07 | |
| cd12371 | 77 | cd12371, RRM2_PUF60, RNA recognition motif 2 in (U | 2e-07 | |
| cd12414 | 76 | cd12414, RRM2_RBM28_like, RNA recognition motif 2 | 3e-07 | |
| cd12618 | 80 | cd12618, RRM2_TIA1, RNA recognition motif 2 in nuc | 4e-07 | |
| cd12636 | 81 | cd12636, RRM2_Bruno_like, RNA recognition motif 2 | 4e-07 | |
| cd12390 | 92 | cd12390, RRM3_RAVER, RNA recognition motif 3 in ri | 4e-07 | |
| cd12394 | 91 | cd12394, RRM1_RBM34, RNA recognition motif 1 in RN | 4e-07 | |
| cd12271 | 72 | cd12271, RRM1_PHIP1, RNA recognition motif 1 in Ar | 4e-07 | |
| cd12236 | 91 | cd12236, RRM_snRNP70, RNA recognition motif in U1 | 5e-07 | |
| cd12367 | 74 | cd12367, RRM2_RBM45, RNA recognition motif 2 in RN | 5e-07 | |
| cd12639 | 79 | cd12639, RRM3_CELF3_4_5_6, RNA recognition motif 2 | 6e-07 | |
| cd12650 | 78 | cd12650, RRM1_Hu, RNA recognition motif 1 in the H | 7e-07 | |
| TIGR01628 | 562 | TIGR01628, PABP-1234, polyadenylate binding protei | 1e-06 | |
| cd12373 | 73 | cd12373, RRM_SRSF3_like, RNA recognition motif in | 1e-06 | |
| cd12571 | 79 | cd12571, RRM6_RBM19, RNA recognition motif 6 in RN | 1e-06 | |
| cd12649 | 81 | cd12649, RRM1_SXL, RNA recognition motif 1 in Dros | 1e-06 | |
| cd12570 | 76 | cd12570, RRM5_MRD1, RNA recognition motif 5 in yea | 1e-06 | |
| cd12598 | 72 | cd12598, RRM1_SRSF9, RNA recognition motif 1 in ve | 1e-06 | |
| cd12482 | 79 | cd12482, RRM1_hnRNPR, RNA recognition motif 1 in v | 1e-06 | |
| cd12646 | 77 | cd12646, RRM_SRSF7, RNA recognition motif in verte | 2e-06 | |
| cd12365 | 73 | cd12365, RRM_RNPS1, RNA recognition motif in RNA-b | 2e-06 | |
| cd12642 | 79 | cd12642, RRM_TRA2A, RNA recognition motif in trans | 2e-06 | |
| cd12341 | 68 | cd12341, RRM_hnRNPC_like, RNA recognition motif in | 2e-06 | |
| cd12680 | 75 | cd12680, RRM_THOC4, RNA recognition motif in THO c | 2e-06 | |
| cd12226 | 78 | cd12226, RRM_NOL8, RNA recognition motif in nucleo | 2e-06 | |
| cd12583 | 75 | cd12583, RRM2_hnRNPD, RNA recognition motif 2 in h | 3e-06 | |
| cd12613 | 80 | cd12613, RRM2_NGR1_NAM8_like, RNA recognition moti | 3e-06 | |
| cd12599 | 72 | cd12599, RRM1_SF2_plant_like, RNA recognition moti | 3e-06 | |
| cd12454 | 80 | cd12454, RRM2_RIM4_like, RNA recognition motif 2 i | 3e-06 | |
| cd12769 | 81 | cd12769, RRM1_HuR, RNA recognition motif 1 in vert | 4e-06 | |
| cd12347 | 73 | cd12347, RRM_PPIE, RNA recognition motif in cyclop | 4e-06 | |
| cd12417 | 74 | cd12417, RRM_SAFB_like, RNA recognition motif in t | 5e-06 | |
| cd12344 | 81 | cd12344, RRM1_SECp43_like, RNA recognition motif 1 | 5e-06 | |
| cd12595 | 70 | cd12595, RRM1_SRSF5, RNA recognition motif 1 in ve | 5e-06 | |
| cd12451 | 79 | cd12451, RRM2_NUCLs, RNA recognition motif 2 in nu | 6e-06 | |
| cd12638 | 92 | cd12638, RRM3_CELF1_2, RNA recognition motif 3 in | 6e-06 | |
| cd12273 | 71 | cd12273, RRM1_NEFsp, RNA recognition motif 1 in ve | 7e-06 | |
| cd12332 | 71 | cd12332, RRM1_p54nrb_like, RNA recognition motif 1 | 7e-06 | |
| cd12612 | 82 | cd12612, RRM2_SECp43, RNA recognition motif 2 in t | 8e-06 | |
| cd12386 | 74 | cd12386, RRM2_hnRNPM_like, RNA recognition motif 2 | 8e-06 | |
| cd12587 | 71 | cd12587, RRM1_PSF, RNA recognition motif 1 in vert | 9e-06 | |
| cd12243 | 71 | cd12243, RRM1_MSSP, RNA recognition motif 1 in the | 9e-06 | |
| TIGR01642 | 509 | TIGR01642, U2AF_lg, U2 snRNP auxilliary factor, la | 1e-05 | |
| cd12472 | 80 | cd12472, RRM1_RBMS3, RNA recognition motif 1 found | 1e-05 | |
| COG0666 | 235 | COG0666, Arp, FOG: Ankyrin repeat [General functio | 1e-05 | |
| cd12606 | 67 | cd12606, RRM1_RBM4, RNA recognition motif 1 in ver | 1e-05 | |
| cd12588 | 71 | cd12588, RRM1_p54nrb, RNA recognition motif 1 in v | 1e-05 | |
| cd12593 | 75 | cd12593, RRM_RBM11, RNA recognition motif in verte | 1e-05 | |
| pfam12796 | 91 | pfam12796, Ank_2, Ankyrin repeats (3 copies) | 2e-05 | |
| cd12346 | 72 | cd12346, RRM3_NGR1_NAM8_like, RNA recognition moti | 2e-05 | |
| cd12418 | 75 | cd12418, RRM_Aly_REF_like, RNA recognition motif i | 2e-05 | |
| cd12596 | 70 | cd12596, RRM1_SRSF6, RNA recognition motif 1 in ve | 2e-05 | |
| cd12670 | 79 | cd12670, RRM2_Nop12p_like, RNA recognition motif 2 | 2e-05 | |
| cd12225 | 77 | cd12225, RRM1_2_CID8_like, RNA recognition motif 1 | 2e-05 | |
| cd12771 | 83 | cd12771, RRM1_HuB, RNA recognition motif 1 in vert | 2e-05 | |
| PHA03100 | 422 | PHA03100, PHA03100, ankyrin repeat protein; Provis | 2e-05 | |
| cd12486 | 78 | cd12486, RRM1_ACF, RNA recognition motif 1 found i | 3e-05 | |
| smart00248 | 30 | smart00248, ANK, ankyrin repeats | 3e-05 | |
| cd12641 | 89 | cd12641, RRM_TRA2B, RNA recognition motif in Trans | 3e-05 | |
| cd12675 | 83 | cd12675, RRM2_Nop4p, RNA recognition motif 2 in ye | 3e-05 | |
| pfam13606 | 30 | pfam13606, Ank_3, Ankyrin repeat | 3e-05 | |
| cd12370 | 76 | cd12370, RRM1_PUF60, RNA recognition motif 1 in (U | 3e-05 | |
| cd12402 | 77 | cd12402, RRM_eIF4B, RNA recognition motif in eukar | 3e-05 | |
| cd12594 | 74 | cd12594, RRM1_SRSF4, RNA recognition motif 1 in ve | 4e-05 | |
| cd12561 | 81 | cd12561, RRM1_RBM5_like, RNA recognition motif 1 i | 5e-05 | |
| cd12645 | 81 | cd12645, RRM_SRSF3, RNA recognition motif in verte | 5e-05 | |
| cd12235 | 83 | cd12235, RRM_PPIL4, RNA recognition motif in pepti | 5e-05 | |
| cd12662 | 77 | cd12662, RRM3_MYEF2, RNA recognition motif 3 in ve | 5e-05 | |
| TIGR01661 | 352 | TIGR01661, ELAV_HUD_SF, ELAV/HuD family splicing f | 7e-05 | |
| cd12372 | 76 | cd12372, RRM_CFIm68_CFIm59, RNA recognition motif | 7e-05 | |
| cd12315 | 77 | cd12315, RRM1_RBM19_MRD1, RNA recognition motif 1 | 7e-05 | |
| cd12654 | 86 | cd12654, RRM3_HuB, RNA recognition motif 3 in vert | 7e-05 | |
| TIGR01661 | 352 | TIGR01661, ELAV_HUD_SF, ELAV/HuD family splicing f | 8e-05 | |
| cd12659 | 76 | cd12659, RRM2_hnRNPM, RNA recognition motif 2 in v | 9e-05 | |
| cd12452 | 88 | cd12452, RRM_ARP_like, RNA recognition motif in ye | 9e-05 | |
| cd12470 | 86 | cd12470, RRM1_MSSP1, RNA recognition motif 1 in ve | 9e-05 | |
| cd12473 | 85 | cd12473, RRM2_MSSP1, RNA recognition motif 2 found | 9e-05 | |
| cd12772 | 84 | cd12772, RRM1_HuC, RNA recognition motif 1 in vert | 9e-05 | |
| pfam13637 | 54 | pfam13637, Ank_4, Ankyrin repeats (many copies) | 1e-04 | |
| COG0666 | 235 | COG0666, Arp, FOG: Ankyrin repeat [General functio | 1e-04 | |
| cd12591 | 80 | cd12591, RRM2_p54nrb, RNA recognition motif 2 in v | 1e-04 | |
| TIGR01648 | 578 | TIGR01648, hnRNP-R-Q, heterogeneous nuclear ribonu | 1e-04 | |
| cd12666 | 77 | cd12666, RRM2_RAVER2, RNA recognition motif 2 in v | 1e-04 | |
| cd12324 | 88 | cd12324, RRM_RBM8, RNA recognition motif in RNA-bi | 1e-04 | |
| cd12416 | 98 | cd12416, RRM4_RBM28_like, RNA recognition motif 4 | 1e-04 | |
| pfam13893 | 56 | pfam13893, RRM_5, RNA recognition motif | 1e-04 | |
| cd12536 | 85 | cd12536, RRM1_RBM39, RNA recognition motif 1 in ve | 2e-04 | |
| cd12770 | 83 | cd12770, RRM1_HuD, RNA recognition motif 1 in vert | 2e-04 | |
| cd12319 | 84 | cd12319, RRM4_MRD1, RNA recognition motif 4 in yea | 2e-04 | |
| TIGR01645 | 612 | TIGR01645, half-pint, poly-U binding splicing fact | 2e-04 | |
| cd12475 | 88 | cd12475, RRM2_RBMS3, RNA recognition motif 2 found | 2e-04 | |
| cd12586 | 71 | cd12586, RRM1_PSP1, RNA recognition motif 1 in ver | 2e-04 | |
| cd12653 | 84 | cd12653, RRM3_HuR, RNA recognition motif 3 in vert | 2e-04 | |
| cd12336 | 75 | cd12336, RRM_RBM7_like, RNA recognition motif in R | 2e-04 | |
| cd12597 | 73 | cd12597, RRM1_SRSF1, RNA recognition motif 1 in se | 2e-04 | |
| cd12333 | 80 | cd12333, RRM2_p54nrb_like, RNA recognition motif 2 | 2e-04 | |
| cd12357 | 89 | cd12357, RRM_PPARGC1A_like, RNA recognition motif | 2e-04 | |
| cd12474 | 86 | cd12474, RRM2_MSSP2, RNA recognition motif 2 found | 3e-04 | |
| PTZ00322 | 664 | PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fruct | 3e-04 | |
| cd12401 | 76 | cd12401, RRM_eIF4H, RNA recognition motif in eukar | 3e-04 | |
| cd12537 | 85 | cd12537, RRM1_RBM23, RNA recognition motif 1 in ve | 3e-04 | |
| cd12609 | 68 | cd12609, RRM2_CoAA, RNA recognition motif 2 in ver | 4e-04 | |
| cd12241 | 77 | cd12241, RRM_SF3B14, RNA recognition motif found i | 4e-04 | |
| cd12634 | 81 | cd12634, RRM2_CELF1_2, RNA recognition motif 2 in | 4e-04 | |
| cd12244 | 79 | cd12244, RRM2_MSSP, RNA recognition motif 2 in the | 4e-04 | |
| cd12251 | 72 | cd12251, RRM3_hnRNPR_like, RNA recognition motif 3 | 4e-04 | |
| cd12254 | 73 | cd12254, RRM_hnRNPH_ESRPs_RBM12_like, RNA recognit | 5e-04 | |
| cd12334 | 74 | cd12334, RRM1_SF3B4, RNA recognition motif 1 in sp | 5e-04 | |
| cd12305 | 75 | cd12305, RRM_NELFE, RNA recognition motif in negat | 5e-04 | |
| cd12421 | 74 | cd12421, RRM1_PTBP1_hnRNPL_like, RNA recognition m | 5e-04 | |
| cd12603 | 71 | cd12603, RRM_hnRNPC, RNA recognition motif in vert | 5e-04 | |
| cd12655 | 85 | cd12655, RRM3_HuC, RNA recognition motif 3 in vert | 5e-04 | |
| cd12753 | 85 | cd12753, RRM1_RBM10, RNA recognition motif 1 in ve | 6e-04 | |
| cd12485 | 78 | cd12485, RRM1_RBM47, RNA recognition motif 1 found | 6e-04 | |
| cd12656 | 86 | cd12656, RRM3_HuD, RNA recognition motif 3 in vert | 6e-04 | |
| cd12637 | 80 | cd12637, RRM2_FCA, RNA recognition motif 2 in plan | 7e-04 | |
| cd12604 | 76 | cd12604, RRM_RALY, RNA recognition motif in verteb | 8e-04 | |
| cd12660 | 76 | cd12660, RRM2_MYEF2, RNA recognition motif 2 in ve | 9e-04 | |
| cd12446 | 84 | cd12446, RRM_RBM25, RNA recognition motif in eukar | 0.001 | |
| cd12224 | 74 | cd12224, RRM_RBM22, RNA recognition motif (RRM) fo | 0.001 | |
| cd12246 | 78 | cd12246, RRM1_U1A_like, RNA recognition motif 1 in | 0.002 | |
| cd12403 | 75 | cd12403, RRM1_NCL, RNA recognition motif 1 in vert | 0.002 | |
| cd12366 | 81 | cd12366, RRM1_RBM45, RNA recognition motif 1 in RN | 0.002 | |
| cd12661 | 77 | cd12661, RRM3_hnRNPM, RNA recognition motif 3 in v | 0.002 | |
| cd12484 | 78 | cd12484, RRM1_RBM46, RNA recognition motif 1 found | 0.002 | |
| cd12444 | 112 | cd12444, RRM1_CPEBs, RNA recognition motif 1 in cy | 0.002 | |
| cd12559 | 84 | cd12559, RRM_SRSF10, RNA recognition motif in seri | 0.002 | |
| cd12309 | 79 | cd12309, RRM2_Spen, RNA recognition motif 2 in the | 0.002 | |
| cd12679 | 76 | cd12679, RRM_SAFB1_SAFB2, RNA recognition motif in | 0.002 | |
| cd12471 | 75 | cd12471, RRM1_MSSP2, RNA recognition motif 1 in ve | 0.003 | |
| cd12665 | 77 | cd12665, RRM2_RAVER1, RNA recognition motif 2 foun | 0.003 | |
| cd12459 | 80 | cd12459, RRM1_CID8_like, RNA recognition motif 1 i | 0.003 | |
| cd12267 | 77 | cd12267, RRM_YRA1_MLO3, RNA recognition motif in y | 0.004 | |
| cd12523 | 78 | cd12523, RRM2_MRN1, RNA recognition motif 2 of RNA | 0.004 | |
| cd12607 | 67 | cd12607, RRM2_RBM4, RNA recognition motif 2 in ver | 0.004 | |
| cd12356 | 79 | cd12356, RRM_PPARGC1B, RNA recognition motif in pe | 0.004 |
| >gnl|CDD|240688 cd12242, RRM_SLIRP, RNA recognition motif found in SRA stem-loop-interacting RNA-binding protein (SLIRP) and similar proteins | Back alignment and domain information |
|---|
Score = 102 bits (256), Expect = 2e-27
Identities = 36/73 (49%), Positives = 56/73 (76%)
Query: 10 KIFVGNLPWTVSHNELKKFFSEYGQIMNASVMFDKNTGLSKGFGFVTFQNKEAVDKVFST 69
K+FVGNLPWTV ELK++FS++G++ + +V FDK TGLSKG+GFV+F +++ ++
Sbjct: 1 KLFVGNLPWTVGSKELKEYFSQFGKVKSCNVPFDKETGLSKGYGFVSFSSRDGLENALQK 60
Query: 70 DSHVLEGSRLSIQ 82
H+LEG++L +Q
Sbjct: 61 QKHILEGNKLQVQ 73
|
This subfamily corresponds to the RRM of SLIRP, a widely expressed small steroid receptor RNA activator (SRA) binding protein, which binds to STR7, a functional substructure of SRA. SLIRP is localized predominantly to the mitochondria and plays a key role in modulating several nuclear receptor (NR) pathways. It functions as a co-repressor to repress SRA-mediated nuclear receptor coactivation. It modulates SHARP- and SKIP-mediated co-regulation of NR activity. SLIRP contains an RNA recognition motif (RRM), also termed RBD (RNA binding domain) or RNP (ribonucleoprotein domain), which is required for SLIRP's corepression activities. . Length = 73 |
| >gnl|CDD|216174 pfam00887, ACBP, Acyl CoA binding protein | Back alignment and domain information |
|---|
| >gnl|CDD|240776 cd12330, RRM2_Hrp1p, RNA recognition motif 2 in yeast nuclear polyadenylated RNA-binding protein 4 (Hrp1p or Nab4p) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|238248 cd00435, ACBP, Acyl CoA binding protein (ACBP) binds thiol esters of long fatty acids and coenzyme A in a one-to-one binding mode with high specificity and affinity | Back alignment and domain information |
|---|
| >gnl|CDD|214636 smart00360, RRM, RNA recognition motif | Back alignment and domain information |
|---|
| >gnl|CDD|240771 cd12325, RRM1_hnRNPA_hnRNPD_like, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein hnRNP A and hnRNP D subfamilies and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240830 cd12384, RRM_RBM24_RBM38_like, RNA recognition motif in eukaryotic RNA-binding protein RBM24, RBM38 and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240773 cd12327, RRM2_DAZAP1, RNA recognition motif 2 in Deleted in azoospermia-associated protein 1 (DAZAP1) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240845 cd12399, RRM_HP0827_like, RNA recognition motif in Helicobacter pylori HP0827 protein and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|215696 pfam00076, RRM_1, RNA recognition motif | Back alignment and domain information |
|---|
| >gnl|CDD|240769 cd12323, RRM2_MSI, RNA recognition motif 2 in RNA-binding protein Musashi homologs Musashi-1, Musashi-2 and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|241018 cd12574, RRM1_DAZAP1, RNA recognition motif 1 in Deleted in azoospermia-associated protein 1 (DAZAP1) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240774 cd12328, RRM2_hnRNPA_like, RNA recognition motif 2 in heterogeneous nuclear ribonucleoprotein A subfamily | Back alignment and domain information |
|---|
| >gnl|CDD|240858 cd12412, RRM_DAZL_BOULE, RNA recognition motif in AZoospermia (DAZ) autosomal homologs, DAZL (DAZ-like) and BOULE | Back alignment and domain information |
|---|
| >gnl|CDD|240668 cd00590, RRM_SF, RNA recognition motif (RRM) superfamily | Back alignment and domain information |
|---|
| >gnl|CDD|240841 cd12395, RRM2_RBM34, RNA recognition motif 2 in RNA-binding protein 34 (RBM34) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|241020 cd12576, RRM1_MSI, RNA recognition motif 1 in RNA-binding protein Musashi homolog Musashi-1, Musashi-2 and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|241201 cd12757, RRM1_hnRNPAB, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein A/B (hnRNP A/B) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|226731 COG4281, ACB, Acyl-CoA-binding protein [Lipid metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|240772 cd12326, RRM1_hnRNPA0, RNA recognition motif 1 found in heterogeneous nuclear ribonucleoprotein A0 (hnRNP A0) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240775 cd12329, RRM2_hnRNPD_like, RNA recognition motif 2 in heterogeneous nuclear ribonucleoprotein hnRNP D0, hnRNP A/B, hnRNP DL and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|241019 cd12575, RRM1_hnRNPD_like, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein hnRNP D0, hnRNP A/B, hnRNP DL and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240828 cd12382, RRM_RBMX_like, RNA recognition motif in heterogeneous nuclear ribonucleoprotein G (hnRNP G), Y chromosome RNA recognition motif 1 (hRBMY), testis-specific heterogeneous nuclear ribonucleoprotein G-T (hnRNP G-T) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|185637 PTZ00458, PTZ00458, acyl CoA binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|241021 cd12577, RRM1_Hrp1p, RNA recognition motif 1 in yeast nuclear polyadenylated RNA-binding protein 4 (Hrp1p or Nab4p) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|241022 cd12578, RRM1_hnRNPA_like, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein A subfamily | Back alignment and domain information |
|---|
| >gnl|CDD|240767 cd12321, RRM1_TDP43, RNA recognition motif 1 in TAR DNA-binding protein 43 (TDP-43) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240861 cd12415, RRM3_RBM28_like, RNA recognition motif 3 in RNA-binding protein 28 (RBM28) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240844 cd12398, RRM_CSTF2_RNA15_like, RNA recognition motif in cleavage stimulation factor subunit 2 (CSTF2), yeast ortholog mRNA 3'-end-processing protein RNA15 and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|241204 cd12760, RRM1_MSI2, RNA recognition motif 1 in RNA-binding protein Musashi homolog 2 (Musashi-2 ) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240762 cd12316, RRM3_RBM19_RRM2_MRD1, RNA recognition motif 3 in RNA-binding protein 19 (RBM19) and RNA recognition motif 2 found in multiple RNA-binding domain-containing protein 1 (MRD1) | Back alignment and domain information |
|---|
| >gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240859 cd12413, RRM1_RBM28_like, RNA recognition motif 1 in RNA-binding protein 28 (RBM28) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240808 cd12362, RRM3_CELF1-6, RNA recognition motif 3 in CELF/Bruno-like family of RNA binding proteins CELF1, CELF2, CELF3, CELF4, CELF5, CELF6 and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins | Back alignment and domain information |
|---|
| >gnl|CDD|241200 cd12756, RRM1_hnRNPD, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein D0 (hnRNP D0) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|241202 cd12758, RRM1_hnRPDL, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein D-like (hnRNP D-like or hnRNP DL) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|241203 cd12759, RRM1_MSI1, RNA recognition motif 1 in RNA-binding protein Musashi homolog 1 (Musashi-1) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240893 cd12447, RRM1_gar2, RNA recognition motif 1 in yeast protein gar2 and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|241023 cd12579, RRM2_hnRNPA0, RNA recognition motif 2 in heterogeneous nuclear ribonucleoprotein A0 (hnRNP A0) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240826 cd12380, RRM3_I_PABPs, RNA recognition motif 3 found in type I polyadenylate-binding proteins | Back alignment and domain information |
|---|
| >gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins | Back alignment and domain information |
|---|
| >gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) | Back alignment and domain information |
|---|
| >gnl|CDD|241096 cd12652, RRM2_Hu, RNA recognition motif 2 in the Hu proteins family | Back alignment and domain information |
|---|
| >gnl|CDD|240807 cd12361, RRM1_2_CELF1-6_like, RNA recognition motif 1 and 2 in CELF/Bruno-like family of RNA binding proteins and plant flowering time control protein FCA | Back alignment and domain information |
|---|
| >gnl|CDD|241117 cd12673, RRM_BOULE, RNA recognition motif in protein BOULE | Back alignment and domain information |
|---|
| >gnl|CDD|241010 cd12566, RRM2_MRD1, RNA recognition motif 2 in yeast multiple RNA-binding domain-containing protein 1 (MRD1) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|178680 PLN03134, PLN03134, glycine-rich RNA-binding protein 4; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223796 COG0724, COG0724, RNA-binding proteins (RRM domain) [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|222631 pfam14259, RRM_6, RNA recognition motif (a | Back alignment and domain information |
|---|
| >gnl|CDD|240837 cd12391, RRM1_SART3, RNA recognition motif 1 in squamous cell carcinoma antigen recognized by T-cells 3 (SART3) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|241016 cd12572, RRM2_MSI1, RNA recognition motif 2 in RNA-binding protein Musashi homolog 1 (Musashi-1) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|241011 cd12567, RRM3_RBM19, RNA recognition motif 3 in RNA-binding protein 19 (RBM19) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|241205 cd12761, RRM1_hnRNPA1, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein A1 (hnRNP A1) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240896 cd12450, RRM1_NUCLs, RNA recognition motif 1 found in nucleolin-like proteins mainly from plants | Back alignment and domain information |
|---|
| >gnl|CDD|241076 cd12632, RRM1_CELF3_4_5_6, RNA recognition motif 1 in CUGBP Elav-like family member CELF-3, CELF-4, CELF-5, CELF-6 and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|241017 cd12573, RRM2_MSI2, RNA recognition motif 2 in RNA-binding protein Musashi homolog 2 (Musashi-2) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240894 cd12448, RRM2_gar2, RNA recognition motif 2 in yeast protein gar2 and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240791 cd12345, RRM2_SECp43_like, RNA recognition motif 2 in tRNA selenocysteine-associated protein 1 (SECp43) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|241206 cd12762, RRM1_hnRNPA2B1, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein A2/B1 (hnRNP A2/B1) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|241095 cd12651, RRM2_SXL, RNA recognition motif 2 in Drosophila sex-lethal (SXL) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240768 cd12322, RRM2_TDP43, RNA recognition motif 2 in TAR DNA-binding protein 43 (TDP-43) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240895 cd12449, RRM_CIRBP_RBM3, RNA recognition motif in cold inducible RNA binding protein (CIRBP), RNA binding motif protein 3 (RBM3) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|241120 cd12676, RRM3_Nop4p, RNA recognition motif 3 in yeast nucleolar protein 4 (Nop4p) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240752 cd12306, RRM_II_PABPs, RNA recognition motif in type II polyadenylate-binding proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240675 cd12229, RRM_G3BP, RNA recognition motif (RRM) in ras GTPase-activating protein-binding protein G3BP1, G3BP2 and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240766 cd12320, RRM6_RBM19_RRM5_MRD1, RNA recognition motif 6 in RNA-binding protein 19 (RBM19 or RBD-1) and RNA recognition motif 5 in multiple RNA-binding domain-containing protein 1 (MRD1) | Back alignment and domain information |
|---|
| >gnl|CDD|241207 cd12763, RRM1_hnRNPA3, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein A3 (hnRNP A3) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240827 cd12381, RRM4_I_PABPs, RNA recognition motif 4 in type I polyadenylate-binding proteins | Back alignment and domain information |
|---|
| >gnl|CDD|241024 cd12580, RRM2_hnRNPA1, RNA recognition motif 2 in heterogeneous nuclear ribonucleoprotein A1 (hnRNP A1) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240833 cd12387, RRM3_hnRNPM_like, RNA recognition motif 3 in heterogeneous nuclear ribonucleoprotein M (hnRNP M) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240822 cd12376, RRM2_Hu_like, RNA recognition motif 2 in the Hu proteins family, Drosophila sex-lethal (SXL), and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|241115 cd12671, RRM_CSTF2_CSTF2T, RNA recognition motif in cleavage stimulation factor subunit 2 (CSTF2), cleavage stimulation factor subunit 2 tau variant (CSTF2T) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|241219 cd12775, RRM2_HuB, RNA recognition motif 2 in vertebrate Hu-antigen B (HuB) | Back alignment and domain information |
|---|
| >gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) | Back alignment and domain information |
|---|
| >gnl|CDD|240753 cd12307, RRM_NIFK_like, RNA recognition motif in nucleolar protein interacting with the FHA domain of pKI-67 (NIFK) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|130689 TIGR01628, PABP-1234, polyadenylate binding protein, human types 1, 2, 3, 4 family | Back alignment and domain information |
|---|
| >gnl|CDD|240996 cd12552, RRM_Nop15p, RNA recognition motif in yeast ribosome biogenesis protein 15 (Nop15p) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240809 cd12363, RRM_TRA2, RNA recognition motif in transformer-2 protein homolog TRA2-alpha, TRA2-beta and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240799 cd12353, RRM2_TIA1_like, RNA recognition motif 2 in granule-associated RNA binding proteins p40-TIA-1 and TIAR | Back alignment and domain information |
|---|
| >gnl|CDD|240801 cd12355, RRM_RBM18, RNA recognition motif in eukaryotic RNA-binding protein 18 and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|130689 TIGR01628, PABP-1234, polyadenylate binding protein, human types 1, 2, 3, 4 family | Back alignment and domain information |
|---|
| >gnl|CDD|241116 cd12672, RRM_DAZL, RNA recognition motif in vertebrate deleted in azoospermia-like (DAZL) proteins | Back alignment and domain information |
|---|
| >gnl|CDD|241025 cd12581, RRM2_hnRNPA2B1, RNA recognition motif 2 in heterogeneous nuclear ribonucleoprotein A2/B1 (hnRNP A2/B1) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240730 cd12284, RRM2_RBM23_RBM39, RNA recognition motif 2 in vertebrate RNA-binding protein RBM23, RBM39 and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240835 cd12389, RRM2_RAVER, RNA recognition motif 2 in ribonucleoprotein PTB-binding raver-1, raver-2 and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|241063 cd12619, RRM2_PUB1, RNA recognition motif 2 in yeast nuclear and cytoplasmic polyadenylated RNA-binding protein PUB1 and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240854 cd12408, RRM_eIF3G_like, RNA recognition motif in eukaryotic translation initiation factor 3 subunit G (eIF-3G) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240846 cd12400, RRM_Nop6, RNA recognition motif in Saccharomyces cerevisiae nucleolar protein 6 (Nop6) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240718 cd12272, RRM2_PHIP1, RNA recognition motif 2 in Arabidopsis thaliana phragmoplastin interacting protein 1 (PHIP1) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240736 cd12290, RRM1_LARP7, RNA recognition motif 1 in La-related protein 7 (LARP7) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240744 cd12298, RRM3_Prp24, RNA recognition motif 3 in fungal pre-messenger RNA splicing protein 24 (Prp24) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240757 cd12311, RRM_SRSF2_SRSF8, RNA recognition motif in serine/arginine-rich splicing factor SRSF2, SRSF8 and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|241026 cd12582, RRM2_hnRNPA3, RNA recognition motif 2 in heterogeneous nuclear ribonucleoprotein A3 (hnRNP A3) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240823 cd12377, RRM3_Hu, RNA recognition motif 3 in the Hu proteins family | Back alignment and domain information |
|---|
| >gnl|CDD|240829 cd12383, RRM_RBM42, RNA recognition motif in RNA-binding protein 42 (RBM42) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|241118 cd12674, RRM1_Nop4p, RNA recognition motif 1 in yeast nucleolar protein 4 (Nop4p) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|241218 cd12774, RRM2_HuD, RNA recognition motif 2 in vertebrate Hu-antigen D (HuD) | Back alignment and domain information |
|---|
| >gnl|CDD|240729 cd12283, RRM1_RBM39_like, RNA recognition motif 1 in vertebrate RNA-binding protein 39 (RBM39) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|241075 cd12631, RRM1_CELF1_2_Bruno, RNA recognition motif 1 in CUGBP Elav-like family member CELF-1, CELF-2, Drosophila melanogaster Bruno protein and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240839 cd12393, RRM_ZCRB1, RNA recognition motif in Zinc finger CCHC-type and RNA-binding motif-containing protein 1 (ZCRB1) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|241008 cd12564, RRM1_RBM19, RNA recognition motif 1 in RNA-binding protein 19 (RBM19) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240853 cd12407, RRM_FOX1_like, RNA recognition motif in vertebrate RNA binding protein fox-1 homologs and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|241217 cd12773, RRM2_HuR, RNA recognition motif 2 in vertebrate Hu-antigen R (HuR) | Back alignment and domain information |
|---|
| >gnl|CDD|241220 cd12776, RRM2_HuC, RNA recognition motif 2 in vertebrate Hu-antigen C (HuC) | Back alignment and domain information |
|---|
| >gnl|CDD|240824 cd12378, RRM1_I_PABPs, RNA recognition motif 1 in type I polyadenylate-binding proteins | Back alignment and domain information |
|---|
| >gnl|CDD|233516 TIGR01661, ELAV_HUD_SF, ELAV/HuD family splicing factor | Back alignment and domain information |
|---|
| >gnl|CDD|240843 cd12397, RRM2_Nop13p_fungi, RNA recognition motif 2 in yeast nucleolar protein 13 (Nop13p) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) | Back alignment and domain information |
|---|
| >gnl|CDD|240857 cd12411, RRM_ist3_like, RNA recognition motif in ist3 family | Back alignment and domain information |
|---|
| >gnl|CDD|206028 pfam13857, Ank_5, Ankyrin repeats (many copies) | Back alignment and domain information |
|---|
| >gnl|CDD|240677 cd12231, RRM2_U2AF65, RNA recognition motif 2 found in U2 large nuclear ribonucleoprotein auxiliary factor U2AF 65 kDa subunit (U2AF65) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240821 cd12375, RRM1_Hu_like, RNA recognition motif 1 in the Hu proteins family, Drosophila sex-lethal (SXL), and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240695 cd12249, RRM1_hnRNPR_like, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein R (hnRNP R) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240781 cd12335, RRM2_SF3B4, RNA recognition motif 2 in splicing factor 3B subunit 4 (SF3B4) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240909 cd12463, RRM_G3BP1, RNA recognition motif found in ras GTPase-activating protein-binding protein 1 (G3BP1) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|241028 cd12584, RRM2_hnRNPAB, RNA recognition motif 2 in heterogeneous nuclear ribonucleoprotein A/B (hnRNP A/B) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|241029 cd12585, RRM2_hnRPDL, RNA recognition motif 2 in heterogeneous nuclear ribonucleoprotein D-like (hnRNP DL) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|241077 cd12633, RRM1_FCA, RNA recognition motif 1 in plant flowering time control protein FCA and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240825 cd12379, RRM2_I_PABPs, RNA recognition motif 2 found in type I polyadenylate-binding proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240725 cd12279, RRM_TUT1, RNA recognition motif in speckle targeted PIP5K1A-regulated poly(A) polymerase (Star-PAP) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240910 cd12464, RRM_G3BP2, RNA recognition motif in ras GTPase-activating protein-binding protein 2 (G3BP2) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240789 cd12343, RRM1_2_CoAA_like, RNA recognition motif 1 and 2 in RRM-containing coactivator activator/modulator (CoAA) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240758 cd12312, RRM_SRSF10_SRSF12, RNA recognition motif in serine/arginine-rich splicing factor SRSF10, SRSF12 and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240995 cd12551, RRM_II_PABPN1L, RNA recognition motif in vertebrate type II embryonic polyadenylate-binding protein 2 (ePABP-2) | Back alignment and domain information |
|---|
| >gnl|CDD|240783 cd12337, RRM1_SRSF4_like, RNA recognition motif 1 in serine/arginine-rich splicing factor 4 (SRSF4) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|241052 cd12608, RRM1_CoAA, RNA recognition motif 1 in vertebrate RRM-containing coactivator activator/modulator (CoAA) | Back alignment and domain information |
|---|
| >gnl|CDD|240764 cd12318, RRM5_RBM19_like, RNA recognition motif 5 in RNA-binding protein 19 (RBM19 or RBD-1) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|233515 TIGR01659, sex-lethal, sex-lethal family splicing factor | Back alignment and domain information |
|---|
| >gnl|CDD|233496 TIGR01622, SF-CC1, splicing factor, CC1-like family | Back alignment and domain information |
|---|
| >gnl|CDD|241061 cd12617, RRM2_TIAR, RNA recognition motif 2 in nucleolysin TIAR and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|241009 cd12565, RRM1_MRD1, RNA recognition motif 1 in yeast multiple RNA-binding domain-containing protein 1 (MRD1) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240683 cd12237, RRM_snRNP35, RNA recognition motif found in U11/U12 small nuclear ribonucleoprotein 35 kDa protein (U11/U12-35K) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|233496 TIGR01622, SF-CC1, splicing factor, CC1-like family | Back alignment and domain information |
|---|
| >gnl|CDD|240800 cd12354, RRM3_TIA1_like, RNA recognition motif 2 in granule-associated RNA binding proteins (p40-TIA-1 and TIAR), and yeast nuclear and cytoplasmic polyadenylated RNA-binding protein PUB1 | Back alignment and domain information |
|---|
| >gnl|CDD|240784 cd12338, RRM1_SRSF1_like, RNA recognition motif 1 in serine/arginine-rich splicing factor 1 (SRSF1) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240994 cd12550, RRM_II_PABPN1, RNA recognition motif in type II polyadenylate-binding protein 2 (PABP-2) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240927 cd12483, RRM1_hnRNPQ, RNA recognition motif 1 in vertebrate heterogeneous nuclear ribonucleoprotein Q (hnRNP Q) | Back alignment and domain information |
|---|
| >gnl|CDD|200936 pfam00023, Ank, Ankyrin repeat | Back alignment and domain information |
|---|
| >gnl|CDD|240838 cd12392, RRM2_SART3, RNA recognition motif 2 in squamous cell carcinoma antigen recognized by T-cells 3 (SART3) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|241084 cd12640, RRM3_Bruno_like, RNA recognition motif 3 in Drosophila melanogaster Bruno protein and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240817 cd12371, RRM2_PUF60, RNA recognition motif 2 in (U)-binding-splicing factor PUF60 and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240860 cd12414, RRM2_RBM28_like, RNA recognition motif 2 in RNA-binding protein 28 (RBM28) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|241062 cd12618, RRM2_TIA1, RNA recognition motif 2 in nucleolysin TIA-1 isoform p40 (p40-TIA-1) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|241080 cd12636, RRM2_Bruno_like, RNA recognition motif 2 in Drosophila melanogaster Bruno protein and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240836 cd12390, RRM3_RAVER, RNA recognition motif 3 in ribonucleoprotein PTB-binding raver-1, raver-2 and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240840 cd12394, RRM1_RBM34, RNA recognition motif 1 in RNA-binding protein 34 (RBM34) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240717 cd12271, RRM1_PHIP1, RNA recognition motif 1 in Arabidopsis thaliana phragmoplastin interacting protein 1 (PHIP1) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240682 cd12236, RRM_snRNP70, RNA recognition motif in U1 small nuclear ribonucleoprotein 70 kDa (U1-70K) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240813 cd12367, RRM2_RBM45, RNA recognition motif 2 in RNA-binding protein 45 (RBM45) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|241083 cd12639, RRM3_CELF3_4_5_6, RNA recognition motif 2 in CUGBP Elav-like family member CELF-3, CELF-4, CELF-5, CELF-6 and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|241094 cd12650, RRM1_Hu, RNA recognition motif 1 in the Hu proteins family | Back alignment and domain information |
|---|
| >gnl|CDD|130689 TIGR01628, PABP-1234, polyadenylate binding protein, human types 1, 2, 3, 4 family | Back alignment and domain information |
|---|
| >gnl|CDD|240819 cd12373, RRM_SRSF3_like, RNA recognition motif in serine/arginine-rich splicing factor 3 (SRSF3) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|241015 cd12571, RRM6_RBM19, RNA recognition motif 6 in RNA-binding protein 19 (RBM19) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|241093 cd12649, RRM1_SXL, RNA recognition motif 1 in Drosophila sex-lethal (SXL) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|241014 cd12570, RRM5_MRD1, RNA recognition motif 5 in yeast multiple RNA-binding domain-containing protein 1 (MRD1) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|241042 cd12598, RRM1_SRSF9, RNA recognition motif 1 in vertebrate serine/arginine-rich splicing factor 9 (SRSF9) | Back alignment and domain information |
|---|
| >gnl|CDD|240926 cd12482, RRM1_hnRNPR, RNA recognition motif 1 in vertebrate heterogeneous nuclear ribonucleoprotein R (hnRNP R) | Back alignment and domain information |
|---|
| >gnl|CDD|241090 cd12646, RRM_SRSF7, RNA recognition motif in vertebrate serine/arginine-rich splicing factor 7 (SRSF7) | Back alignment and domain information |
|---|
| >gnl|CDD|240811 cd12365, RRM_RNPS1, RNA recognition motif in RNA-binding protein with serine-rich domain 1 (RNPS1) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|241086 cd12642, RRM_TRA2A, RNA recognition motif in transformer-2 protein homolog alpha (TRA-2 alpha) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240787 cd12341, RRM_hnRNPC_like, RNA recognition motif in heterogeneous nuclear ribonucleoprotein C (hnRNP C)-related proteins | Back alignment and domain information |
|---|
| >gnl|CDD|241124 cd12680, RRM_THOC4, RNA recognition motif in THO complex subunit 4 (THOC4) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240672 cd12226, RRM_NOL8, RNA recognition motif in nucleolar protein 8 (NOL8) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|241027 cd12583, RRM2_hnRNPD, RNA recognition motif 2 in heterogeneous nuclear ribonucleoprotein D0 (hnRNP D0) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|241057 cd12613, RRM2_NGR1_NAM8_like, RNA recognition motif 2 in yeast negative growth regulatory protein NGR1, yeast protein NAM8 and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|241043 cd12599, RRM1_SF2_plant_like, RNA recognition motif 1 in plant pre-mRNA-splicing factor SF2 and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240900 cd12454, RRM2_RIM4_like, RNA recognition motif 2 in yeast meiotic activator RIM4 and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|241213 cd12769, RRM1_HuR, RNA recognition motif 1 in vertebrate Hu-antigen R (HuR) | Back alignment and domain information |
|---|
| >gnl|CDD|240793 cd12347, RRM_PPIE, RNA recognition motif in cyclophilin-33 (Cyp33) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240863 cd12417, RRM_SAFB_like, RNA recognition motif in the scaffold attachment factor (SAFB) family | Back alignment and domain information |
|---|
| >gnl|CDD|240790 cd12344, RRM1_SECp43_like, RNA recognition motif 1 in tRNA selenocysteine-associated protein 1 (SECp43) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|241039 cd12595, RRM1_SRSF5, RNA recognition motif 1 in vertebrate serine/arginine-rich splicing factor 5 (SRSF5) | Back alignment and domain information |
|---|
| >gnl|CDD|240897 cd12451, RRM2_NUCLs, RNA recognition motif 2 in nucleolin-like proteins mainly from plants | Back alignment and domain information |
|---|
| >gnl|CDD|241082 cd12638, RRM3_CELF1_2, RNA recognition motif 3 in CUGBP Elav-like family member CELF-1, CELF-2 and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240719 cd12273, RRM1_NEFsp, RNA recognition motif 1 in vertebrate putative RNA exonuclease NEF-sp | Back alignment and domain information |
|---|
| >gnl|CDD|240778 cd12332, RRM1_p54nrb_like, RNA recognition motif 1 in the p54nrb/PSF/PSP1 family | Back alignment and domain information |
|---|
| >gnl|CDD|241056 cd12612, RRM2_SECp43, RNA recognition motif 2 in tRNA selenocysteine-associated protein 1 (SECp43) | Back alignment and domain information |
|---|
| >gnl|CDD|240832 cd12386, RRM2_hnRNPM_like, RNA recognition motif 2 in heterogeneous nuclear ribonucleoprotein M (hnRNP M) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|241031 cd12587, RRM1_PSF, RNA recognition motif 1 in vertebrate polypyrimidine tract-binding protein (PTB)-associated-splicing factor (PSF) | Back alignment and domain information |
|---|
| >gnl|CDD|240689 cd12243, RRM1_MSSP, RNA recognition motif 1 in the c-myc gene single-strand binding proteins (MSSP) family | Back alignment and domain information |
|---|
| >gnl|CDD|233503 TIGR01642, U2AF_lg, U2 snRNP auxilliary factor, large subunit, splicing factor | Back alignment and domain information |
|---|
| >gnl|CDD|240916 cd12472, RRM1_RBMS3, RNA recognition motif 1 found in vertebrate RNA-binding motif, single-stranded-interacting protein 3 (RBMS3) | Back alignment and domain information |
|---|
| >gnl|CDD|223738 COG0666, Arp, FOG: Ankyrin repeat [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|241050 cd12606, RRM1_RBM4, RNA recognition motif 1 in vertebrate RNA-binding protein 4 (RBM4) | Back alignment and domain information |
|---|
| >gnl|CDD|241032 cd12588, RRM1_p54nrb, RNA recognition motif 1 in vertebrate 54 kDa nuclear RNA- and DNA-binding protein (p54nrb) | Back alignment and domain information |
|---|
| >gnl|CDD|241037 cd12593, RRM_RBM11, RNA recognition motif in vertebrate RNA-binding protein 11 (RBM11) | Back alignment and domain information |
|---|
| >gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) | Back alignment and domain information |
|---|
| >gnl|CDD|240792 cd12346, RRM3_NGR1_NAM8_like, RNA recognition motif 3 in yeast negative growth regulatory protein NGR1 (RBP1), yeast protein NAM8 and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240864 cd12418, RRM_Aly_REF_like, RNA recognition motif in the Aly/REF family | Back alignment and domain information |
|---|
| >gnl|CDD|241040 cd12596, RRM1_SRSF6, RNA recognition motif 1 in vertebrate serine/arginine-rich splicing factor 6 (SRSF6) | Back alignment and domain information |
|---|
| >gnl|CDD|241114 cd12670, RRM2_Nop12p_like, RNA recognition motif 2 in yeast nucleolar protein 12 (Nop12p) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240671 cd12225, RRM1_2_CID8_like, RNA recognition motif 1 and 2 (RRM1, RRM2) in Arabidopsis thaliana CTC-interacting domain protein CID8, CID9, CID10, CID11, CID12, CID 13 and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|241215 cd12771, RRM1_HuB, RNA recognition motif 1 in vertebrate Hu-antigen B (HuB) | Back alignment and domain information |
|---|
| >gnl|CDD|222984 PHA03100, PHA03100, ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240930 cd12486, RRM1_ACF, RNA recognition motif 1 found in vertebrate APOBEC-1 complementation factor (ACF) | Back alignment and domain information |
|---|
| >gnl|CDD|197603 smart00248, ANK, ankyrin repeats | Back alignment and domain information |
|---|
| >gnl|CDD|241085 cd12641, RRM_TRA2B, RNA recognition motif in Transformer-2 protein homolog beta (TRA-2 beta) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|241119 cd12675, RRM2_Nop4p, RNA recognition motif 2 in yeast nucleolar protein 4 (Nop4p) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|205784 pfam13606, Ank_3, Ankyrin repeat | Back alignment and domain information |
|---|
| >gnl|CDD|240816 cd12370, RRM1_PUF60, RNA recognition motif 1 in (U)-binding-splicing factor PUF60 and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240848 cd12402, RRM_eIF4B, RNA recognition motif in eukaryotic translation initiation factor 4B (eIF-4B) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|241038 cd12594, RRM1_SRSF4, RNA recognition motif 1 in vertebrate serine/arginine-rich splicing factor 4 (SRSF4) | Back alignment and domain information |
|---|
| >gnl|CDD|241005 cd12561, RRM1_RBM5_like, RNA recognition motif 1 in RNA-binding protein 5 (RBM5) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|241089 cd12645, RRM_SRSF3, RNA recognition motif in vertebrate serine/arginine-rich splicing factor 3 (SRSF3) | Back alignment and domain information |
|---|
| >gnl|CDD|240681 cd12235, RRM_PPIL4, RNA recognition motif in peptidyl-prolyl cis-trans isomerase-like 4 (PPIase) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|241106 cd12662, RRM3_MYEF2, RNA recognition motif 3 in vertebrate myelin expression factor 2 (MEF-2) | Back alignment and domain information |
|---|
| >gnl|CDD|233516 TIGR01661, ELAV_HUD_SF, ELAV/HuD family splicing factor | Back alignment and domain information |
|---|
| >gnl|CDD|240818 cd12372, RRM_CFIm68_CFIm59, RNA recognition motif of pre-mRNA cleavage factor Im 68 kDa subunit (CFIm68 or CPSF6), pre-mRNA cleavage factor Im 59 kDa subunit (CFIm59 or CPSF7), and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240761 cd12315, RRM1_RBM19_MRD1, RNA recognition motif 1 in RNA-binding protein 19 (RBM19), yeast multiple RNA-binding domain-containing protein 1 (MRD1) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|241098 cd12654, RRM3_HuB, RNA recognition motif 3 in vertebrate Hu-antigen B (HuB) | Back alignment and domain information |
|---|
| >gnl|CDD|233516 TIGR01661, ELAV_HUD_SF, ELAV/HuD family splicing factor | Back alignment and domain information |
|---|
| >gnl|CDD|241103 cd12659, RRM2_hnRNPM, RNA recognition motif 2 in vertebrate heterogeneous nuclear ribonucleoprotein M (hnRNP M) | Back alignment and domain information |
|---|
| >gnl|CDD|240898 cd12452, RRM_ARP_like, RNA recognition motif in yeast asparagine-rich protein (ARP) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240914 cd12470, RRM1_MSSP1, RNA recognition motif 1 in vertebrate single-stranded DNA-binding protein MSSP-1 | Back alignment and domain information |
|---|
| >gnl|CDD|240917 cd12473, RRM2_MSSP1, RNA recognition motif 2 found in vertebrate single-stranded DNA-binding protein MSSP-1 | Back alignment and domain information |
|---|
| >gnl|CDD|241216 cd12772, RRM1_HuC, RNA recognition motif 1 in vertebrate Hu-antigen C (HuC) | Back alignment and domain information |
|---|
| >gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) | Back alignment and domain information |
|---|
| >gnl|CDD|223738 COG0666, Arp, FOG: Ankyrin repeat [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|241035 cd12591, RRM2_p54nrb, RNA recognition motif 2 in vertebrate 54 kDa nuclear RNA- and DNA-binding protein (p54nrb) | Back alignment and domain information |
|---|
| >gnl|CDD|233507 TIGR01648, hnRNP-R-Q, heterogeneous nuclear ribonucleoprotein R, Q family | Back alignment and domain information |
|---|
| >gnl|CDD|241110 cd12666, RRM2_RAVER2, RNA recognition motif 2 in vertebrate ribonucleoprotein PTB-binding 2 (raver-2) | Back alignment and domain information |
|---|
| >gnl|CDD|240770 cd12324, RRM_RBM8, RNA recognition motif in RNA-binding protein RBM8A, RBM8B nd similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240862 cd12416, RRM4_RBM28_like, RNA recognition motif 4 in RNA-binding protein 28 (RBM28) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|206064 pfam13893, RRM_5, RNA recognition motif | Back alignment and domain information |
|---|
| >gnl|CDD|240980 cd12536, RRM1_RBM39, RNA recognition motif 1 in vertebrate RNA-binding protein 39 (RBM39) | Back alignment and domain information |
|---|
| >gnl|CDD|241214 cd12770, RRM1_HuD, RNA recognition motif 1 in vertebrate Hu-antigen D (HuD) | Back alignment and domain information |
|---|
| >gnl|CDD|240765 cd12319, RRM4_MRD1, RNA recognition motif 4 in yeast multiple RNA-binding domain-containing protein 1 (MRD1) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|130706 TIGR01645, half-pint, poly-U binding splicing factor, half-pint family | Back alignment and domain information |
|---|
| >gnl|CDD|240919 cd12475, RRM2_RBMS3, RNA recognition motif 2 found in vertebrate RNA-binding motif, single-stranded-interacting protein 3 (RBMS3) | Back alignment and domain information |
|---|
| >gnl|CDD|241030 cd12586, RRM1_PSP1, RNA recognition motif 1 in vertebrate paraspeckle protein 1 (PSP1) | Back alignment and domain information |
|---|
| >gnl|CDD|241097 cd12653, RRM3_HuR, RNA recognition motif 3 in vertebrate Hu-antigen R (HuR) | Back alignment and domain information |
|---|
| >gnl|CDD|240782 cd12336, RRM_RBM7_like, RNA recognition motif in RNA-binding protein 7 (RBM7) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|241041 cd12597, RRM1_SRSF1, RNA recognition motif 1 in serine/arginine-rich splicing factor 1 (SRSF1) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240779 cd12333, RRM2_p54nrb_like, RNA recognition motif 2 in the p54nrb/PSF/PSP1 family | Back alignment and domain information |
|---|
| >gnl|CDD|240803 cd12357, RRM_PPARGC1A_like, RNA recognition motif in the peroxisome proliferator-activated receptor gamma coactivator 1A (PGC-1alpha) family of regulated coactivators | Back alignment and domain information |
|---|
| >gnl|CDD|240918 cd12474, RRM2_MSSP2, RNA recognition motif 2 found in vertebrate single-stranded DNA-binding protein MSSP-2 | Back alignment and domain information |
|---|
| >gnl|CDD|140343 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240847 cd12401, RRM_eIF4H, RNA recognition motif in eukaryotic translation initiation factor 4H (eIF-4H) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240981 cd12537, RRM1_RBM23, RNA recognition motif 1 in vertebrate probable RNA-binding protein 23 (RBM23) | Back alignment and domain information |
|---|
| >gnl|CDD|241053 cd12609, RRM2_CoAA, RNA recognition motif 2 in vertebrate RRM-containing coactivator activator/modulator (CoAA) | Back alignment and domain information |
|---|
| >gnl|CDD|240687 cd12241, RRM_SF3B14, RNA recognition motif found in pre-mRNA branch site protein p14 (SF3B14) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|241078 cd12634, RRM2_CELF1_2, RNA recognition motif 2 in CUGBP Elav-like family member CELF-1, CELF-2 and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240690 cd12244, RRM2_MSSP, RNA recognition motif 2 in the c-myc gene single-strand binding proteins (MSSP) family | Back alignment and domain information |
|---|
| >gnl|CDD|240697 cd12251, RRM3_hnRNPR_like, RNA recognition motif 3 in heterogeneous nuclear ribonucleoprotein R (hnRNP R) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240700 cd12254, RRM_hnRNPH_ESRPs_RBM12_like, RNA recognition motif found in heterogeneous nuclear ribonucleoprotein (hnRNP) H protein family, epithelial splicing regulatory proteins (ESRPs), Drosophila RNA-binding protein Fusilli, RNA-binding protein 12 (RBM12) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240780 cd12334, RRM1_SF3B4, RNA recognition motif 1 in splicing factor 3B subunit 4 (SF3B4) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240751 cd12305, RRM_NELFE, RNA recognition motif in negative elongation factor E (NELF-E) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240867 cd12421, RRM1_PTBP1_hnRNPL_like, RNA recognition motif in polypyrimidine tract-binding protein 1 (PTB or hnRNP I), heterogeneous nuclear ribonucleoprotein L (hnRNP-L), and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|241047 cd12603, RRM_hnRNPC, RNA recognition motif in vertebrate heterogeneous nuclear ribonucleoprotein C1/C2 (hnRNP C1/C2) | Back alignment and domain information |
|---|
| >gnl|CDD|241099 cd12655, RRM3_HuC, RNA recognition motif 3 in vertebrate Hu-antigen C (HuC) | Back alignment and domain information |
|---|
| >gnl|CDD|241197 cd12753, RRM1_RBM10, RNA recognition motif 1 in vertebrate RNA-binding protein 10 (RBM10) | Back alignment and domain information |
|---|
| >gnl|CDD|240929 cd12485, RRM1_RBM47, RNA recognition motif 1 found in vertebrate RNA-binding protein 47 (RBM47) | Back alignment and domain information |
|---|
| >gnl|CDD|241100 cd12656, RRM3_HuD, RNA recognition motif 3 in vertebrate Hu-antigen D (HuD) | Back alignment and domain information |
|---|
| >gnl|CDD|241081 cd12637, RRM2_FCA, RNA recognition motif 2 in plant flowering time control protein FCA and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|241048 cd12604, RRM_RALY, RNA recognition motif in vertebrate RNA-binding protein Raly | Back alignment and domain information |
|---|
| >gnl|CDD|241104 cd12660, RRM2_MYEF2, RNA recognition motif 2 in vertebrate myelin expression factor 2 (MEF-2) | Back alignment and domain information |
|---|
| >gnl|CDD|240892 cd12446, RRM_RBM25, RNA recognition motif in eukaryotic RNA-binding protein 25 and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240670 cd12224, RRM_RBM22, RNA recognition motif (RRM) found in Pre-mRNA-splicing factor RBM22 and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240692 cd12246, RRM1_U1A_like, RNA recognition motif 1 in the U1A/U2B"/SNF protein family | Back alignment and domain information |
|---|
| >gnl|CDD|240849 cd12403, RRM1_NCL, RNA recognition motif 1 in vertebrate nucleolin | Back alignment and domain information |
|---|
| >gnl|CDD|240812 cd12366, RRM1_RBM45, RNA recognition motif 1 in RNA-binding protein 45 (RBM45) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|241105 cd12661, RRM3_hnRNPM, RNA recognition motif 3 in vertebrate heterogeneous nuclear ribonucleoprotein M (hnRNP M) | Back alignment and domain information |
|---|
| >gnl|CDD|240928 cd12484, RRM1_RBM46, RNA recognition motif 1 found in vertebrate RNA-binding protein 46 (RBM46) | Back alignment and domain information |
|---|
| >gnl|CDD|240890 cd12444, RRM1_CPEBs, RNA recognition motif 1 in cytoplasmic polyadenylation element-binding protein CPEB-1, CPEB-2, CPEB-3, CPEB-4 and similar protiens | Back alignment and domain information |
|---|
| >gnl|CDD|241003 cd12559, RRM_SRSF10, RNA recognition motif in serine/arginine-rich splicing factor 10 (SRSF10) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240755 cd12309, RRM2_Spen, RNA recognition motif 2 in the Spen (split end) protein family | Back alignment and domain information |
|---|
| >gnl|CDD|241123 cd12679, RRM_SAFB1_SAFB2, RNA recognition motif in scaffold attachment factor B1 (SAFB1), scaffold attachment factor B2 (SAFB2), and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240915 cd12471, RRM1_MSSP2, RNA recognition motif 1 in vertebrate single-stranded DNA-binding protein MSSP-2 | Back alignment and domain information |
|---|
| >gnl|CDD|241109 cd12665, RRM2_RAVER1, RNA recognition motif 2 found in vertebrate ribonucleoprotein PTB-binding 1 (raver-1) | Back alignment and domain information |
|---|
| >gnl|CDD|240905 cd12459, RRM1_CID8_like, RNA recognition motif 1 in Arabidopsis thaliana CTC-interacting domain protein CID8, CID9, CID10, CID11, CID12, CID 13 and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240713 cd12267, RRM_YRA1_MLO3, RNA recognition motif in yeast RNA annealing protein YRA1 (Yra1p), yeast mRNA export protein mlo3 and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240967 cd12523, RRM2_MRN1, RNA recognition motif 2 of RNA-binding protein MRN1 and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|241051 cd12607, RRM2_RBM4, RNA recognition motif 2 in vertebrate RNA-binding protein 4 (RBM4) | Back alignment and domain information |
|---|
| >gnl|CDD|240802 cd12356, RRM_PPARGC1B, RNA recognition motif in peroxisome proliferator-activated receptor gamma coactivator 1-beta (PGC-1-beta) and similar proteins | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 347 | |||
| TIGR01659 | 346 | sex-lethal sex-lethal family splicing factor. This | 99.89 | |
| TIGR01645 | 612 | half-pint poly-U binding splicing factor, half-pin | 99.86 | |
| PTZ00458 | 90 | acyl CoA binding protein; Provisional | 99.86 | |
| TIGR01661 | 352 | ELAV_HUD_SF ELAV/HuD family splicing factor. These | 99.85 | |
| KOG4412|consensus | 226 | 99.84 | ||
| KOG4412|consensus | 226 | 99.83 | ||
| TIGR01622 | 457 | SF-CC1 splicing factor, CC1-like family. A homolog | 99.83 | |
| cd00435 | 85 | ACBP Acyl CoA binding protein (ACBP) binds thiol e | 99.82 | |
| TIGR01628 | 562 | PABP-1234 polyadenylate binding protein, human typ | 99.81 | |
| KOG0131|consensus | 203 | 99.8 | ||
| KOG0145|consensus | 360 | 99.79 | ||
| KOG0817|consensus | 142 | 99.79 | ||
| KOG0148|consensus | 321 | 99.78 | ||
| KOG0144|consensus | 510 | 99.77 | ||
| KOG0117|consensus | 506 | 99.76 | ||
| PF00887 | 87 | ACBP: Acyl CoA binding protein; InterPro: IPR00058 | 99.76 | |
| TIGR01661 | 352 | ELAV_HUD_SF ELAV/HuD family splicing factor. These | 99.75 | |
| TIGR01648 | 578 | hnRNP-R-Q heterogeneous nuclear ribonucleoprotein | 99.73 | |
| TIGR01628 | 562 | PABP-1234 polyadenylate binding protein, human typ | 99.73 | |
| COG4281 | 87 | ACB Acyl-CoA-binding protein [Lipid metabolism] | 99.73 | |
| PHA02743 | 166 | Viral ankyrin protein; Provisional | 99.72 | |
| PLN03134 | 144 | glycine-rich RNA-binding protein 4; Provisional | 99.71 | |
| PF12796 | 89 | Ank_2: Ankyrin repeats (3 copies); InterPro: IPR02 | 99.71 | |
| KOG0149|consensus | 247 | 99.7 | ||
| KOG0509|consensus | 600 | 99.69 | ||
| KOG0508|consensus | 615 | 99.68 | ||
| KOG0512|consensus | 228 | 99.68 | ||
| PHA02736 | 154 | Viral ankyrin protein; Provisional | 99.68 | |
| TIGR01649 | 481 | hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor | 99.68 | |
| PHA02791 | 284 | ankyrin-like protein; Provisional | 99.67 | |
| TIGR01642 | 509 | U2AF_lg U2 snRNP auxilliary factor, large subunit, | 99.67 | |
| TIGR01642 | 509 | U2AF_lg U2 snRNP auxilliary factor, large subunit, | 99.67 | |
| PHA02741 | 169 | hypothetical protein; Provisional | 99.67 | |
| KOG0195|consensus | 448 | 99.66 | ||
| PHA02741 | 169 | hypothetical protein; Provisional | 99.65 | |
| KOG0124|consensus | 544 | 99.65 | ||
| KOG0512|consensus | 228 | 99.65 | ||
| PHA02791 | 284 | ankyrin-like protein; Provisional | 99.64 | |
| KOG0127|consensus | 678 | 99.64 | ||
| KOG4214|consensus | 117 | 99.64 | ||
| TIGR01649 | 481 | hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor | 99.63 | |
| KOG0127|consensus | 678 | 99.63 | ||
| PHA02875 | 413 | ankyrin repeat protein; Provisional | 99.63 | |
| PHA02795 | 437 | ankyrin-like protein; Provisional | 99.62 | |
| PHA02878 | 477 | ankyrin repeat protein; Provisional | 99.62 | |
| PHA02874 | 434 | ankyrin repeat protein; Provisional | 99.61 | |
| PHA02859 | 209 | ankyrin repeat protein; Provisional | 99.61 | |
| PHA02884 | 300 | ankyrin repeat protein; Provisional | 99.61 | |
| PHA02859 | 209 | ankyrin repeat protein; Provisional | 99.61 | |
| KOG0117|consensus | 506 | 99.61 | ||
| PF00076 | 70 | RRM_1: RNA recognition motif. (a.k.a. RRM, RBD, or | 99.6 | |
| KOG0509|consensus | 600 | 99.6 | ||
| PLN03192 | 823 | Voltage-dependent potassium channel; Provisional | 99.6 | |
| PHA02743 | 166 | Viral ankyrin protein; Provisional | 99.59 | |
| TIGR01648 | 578 | hnRNP-R-Q heterogeneous nuclear ribonucleoprotein | 99.59 | |
| KOG4205|consensus | 311 | 99.59 | ||
| KOG0502|consensus | 296 | 99.59 | ||
| KOG0105|consensus | 241 | 99.58 | ||
| PF13637 | 54 | Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A | 99.58 | |
| PHA02875 | 413 | ankyrin repeat protein; Provisional | 99.58 | |
| PHA03095 | 471 | ankyrin-like protein; Provisional | 99.57 | |
| PHA02798 | 489 | ankyrin-like protein; Provisional | 99.57 | |
| TIGR01622 | 457 | SF-CC1 splicing factor, CC1-like family. A homolog | 99.56 | |
| KOG0515|consensus | 752 | 99.56 | ||
| PF13857 | 56 | Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A | 99.56 | |
| KOG0123|consensus | 369 | 99.56 | ||
| PHA03095 | 471 | ankyrin-like protein; Provisional | 99.56 | |
| KOG0110|consensus | 725 | 99.56 | ||
| PLN03120 | 260 | nucleic acid binding protein; Provisional | 99.55 | |
| KOG0145|consensus | 360 | 99.55 | ||
| KOG0121|consensus | 153 | 99.55 | ||
| PHA02946 | 446 | ankyin-like protein; Provisional | 99.55 | |
| KOG0125|consensus | 376 | 99.55 | ||
| KOG0109|consensus | 346 | 99.54 | ||
| PHA03100 | 480 | ankyrin repeat protein; Provisional | 99.54 | |
| PF14259 | 70 | RRM_6: RNA recognition motif (a.k.a. RRM, RBD, or | 99.54 | |
| PHA02946 | 446 | ankyin-like protein; Provisional | 99.54 | |
| PHA03100 | 480 | ankyrin repeat protein; Provisional | 99.53 | |
| KOG0123|consensus | 369 | 99.53 | ||
| PHA02878 | 477 | ankyrin repeat protein; Provisional | 99.52 | |
| KOG0122|consensus | 270 | 99.52 | ||
| PHA02884 | 300 | ankyrin repeat protein; Provisional | 99.52 | |
| KOG0510|consensus | 929 | 99.51 | ||
| PHA02874 | 434 | ankyrin repeat protein; Provisional | 99.51 | |
| KOG4177|consensus | 1143 | 99.51 | ||
| PHA02716 | 764 | CPXV016; CPX019; EVM010; Provisional | 99.5 | |
| KOG0113|consensus | 335 | 99.49 | ||
| PHA02736 | 154 | Viral ankyrin protein; Provisional | 99.49 | |
| PHA02989 | 494 | ankyrin repeat protein; Provisional | 99.49 | |
| KOG0126|consensus | 219 | 99.48 | ||
| TIGR01645 | 612 | half-pint poly-U binding splicing factor, half-pin | 99.48 | |
| PHA02716 | 764 | CPXV016; CPX019; EVM010; Provisional | 99.48 | |
| PLN03213 | 759 | repressor of silencing 3; Provisional | 99.48 | |
| KOG0510|consensus | 929 | 99.47 | ||
| KOG0514|consensus | 452 | 99.47 | ||
| PLN03121 | 243 | nucleic acid binding protein; Provisional | 99.47 | |
| PHA02876 | 682 | ankyrin repeat protein; Provisional | 99.46 | |
| PLN03192 | 823 | Voltage-dependent potassium channel; Provisional | 99.46 | |
| TIGR01659 | 346 | sex-lethal sex-lethal family splicing factor. This | 99.46 | |
| KOG0514|consensus | 452 | 99.45 | ||
| KOG4207|consensus | 256 | 99.45 | ||
| COG0724 | 306 | RNA-binding proteins (RRM domain) [General functio | 99.45 | |
| KOG4177|consensus | 1143 | 99.44 | ||
| PHA02917 | 661 | ankyrin-like protein; Provisional | 99.43 | |
| PHA02876 | 682 | ankyrin repeat protein; Provisional | 99.42 | |
| KOG0505|consensus | 527 | 99.42 | ||
| KOG0508|consensus | 615 | 99.42 | ||
| PHA02917 | 661 | ankyrin-like protein; Provisional | 99.41 | |
| PTZ00322 | 664 | 6-phosphofructo-2-kinase/fructose-2,6-biphosphatas | 99.41 | |
| PHA02798 | 489 | ankyrin-like protein; Provisional | 99.41 | |
| PHA02989 | 494 | ankyrin repeat protein; Provisional | 99.41 | |
| PHA02795 | 437 | ankyrin-like protein; Provisional | 99.41 | |
| KOG0107|consensus | 195 | 99.4 | ||
| KOG0147|consensus | 549 | 99.38 | ||
| PHA02730 | 672 | ankyrin-like protein; Provisional | 99.38 | |
| PHA02730 | 672 | ankyrin-like protein; Provisional | 99.38 | |
| smart00362 | 72 | RRM_2 RNA recognition motif. | 99.38 | |
| KOG4206|consensus | 221 | 99.37 | ||
| KOG0505|consensus | 527 | 99.36 | ||
| cd00204 | 126 | ANK ankyrin repeats; ankyrin repeats mediate prote | 99.36 | |
| KOG0111|consensus | 298 | 99.35 | ||
| KOG0114|consensus | 124 | 99.35 | ||
| smart00360 | 71 | RRM RNA recognition motif. | 99.34 | |
| KOG1710|consensus | 396 | 99.33 | ||
| KOG0507|consensus | 854 | 99.32 | ||
| KOG0148|consensus | 321 | 99.28 | ||
| PHA02792 | 631 | ankyrin-like protein; Provisional | 99.28 | |
| KOG0195|consensus | 448 | 99.28 | ||
| COG0666 | 235 | Arp FOG: Ankyrin repeat [General function predicti | 99.27 | |
| KOG1710|consensus | 396 | 99.27 | ||
| KOG0108|consensus | 435 | 99.27 | ||
| cd00590 | 74 | RRM RRM (RNA recognition motif), also known as RBD | 99.26 | |
| PF13637 | 54 | Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A | 99.26 | |
| KOG0130|consensus | 170 | 99.25 | ||
| PF12796 | 89 | Ank_2: Ankyrin repeats (3 copies); InterPro: IPR02 | 99.24 | |
| KOG4211|consensus | 510 | 99.24 | ||
| KOG0144|consensus | 510 | 99.23 | ||
| COG0666 | 235 | Arp FOG: Ankyrin repeat [General function predicti | 99.23 | |
| PHA02792 | 631 | ankyrin-like protein; Provisional | 99.22 | |
| TIGR00870 | 743 | trp transient-receptor-potential calcium channel p | 99.2 | |
| KOG0502|consensus | 296 | 99.2 | ||
| KOG0515|consensus | 752 | 99.18 | ||
| KOG4212|consensus | 608 | 99.17 | ||
| cd00204 | 126 | ANK ankyrin repeats; ankyrin repeats mediate prote | 99.16 | |
| KOG4214|consensus | 117 | 99.16 | ||
| TIGR00870 | 743 | trp transient-receptor-potential calcium channel p | 99.14 | |
| smart00361 | 70 | RRM_1 RNA recognition motif. | 99.09 | |
| KOG0506|consensus | 622 | 99.07 | ||
| KOG4205|consensus | 311 | 99.05 | ||
| KOG3676|consensus | 782 | 99.04 | ||
| KOG1457|consensus | 284 | 99.02 | ||
| KOG0131|consensus | 203 | 99.01 | ||
| KOG0147|consensus | 549 | 98.99 | ||
| KOG0705|consensus | 749 | 98.99 | ||
| KOG0507|consensus | 854 | 98.98 | ||
| KOG0153|consensus | 377 | 98.98 | ||
| KOG0146|consensus | 371 | 98.97 | ||
| PF13893 | 56 | RRM_5: RNA recognition motif. (a.k.a. RRM, RBD, or | 98.96 | |
| KOG0818|consensus | 669 | 98.95 | ||
| PF13606 | 30 | Ank_3: Ankyrin repeat | 98.93 | |
| PF00023 | 33 | Ank: Ankyrin repeat Hereditary spherocytosis; Inte | 98.9 | |
| KOG4208|consensus | 214 | 98.9 | ||
| PF13857 | 56 | Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A | 98.86 | |
| KOG3676|consensus | 782 | 98.86 | ||
| KOG0106|consensus | 216 | 98.85 | ||
| KOG0124|consensus | 544 | 98.85 | ||
| KOG0415|consensus | 479 | 98.84 | ||
| KOG0783|consensus | 1267 | 98.83 | ||
| KOG0146|consensus | 371 | 98.83 | ||
| KOG0109|consensus | 346 | 98.82 | ||
| PTZ00322 | 664 | 6-phosphofructo-2-kinase/fructose-2,6-biphosphatas | 98.8 | |
| KOG4661|consensus | 940 | 98.76 | ||
| KOG0116|consensus | 419 | 98.76 | ||
| PF13606 | 30 | Ank_3: Ankyrin repeat | 98.75 | |
| KOG0110|consensus | 725 | 98.72 | ||
| KOG4454|consensus | 267 | 98.71 | ||
| KOG0522|consensus | 560 | 98.71 | ||
| KOG4369|consensus | 2131 | 98.68 | ||
| KOG4212|consensus | 608 | 98.67 | ||
| KOG1548|consensus | 382 | 98.66 | ||
| KOG0783|consensus | 1267 | 98.61 | ||
| KOG4209|consensus | 231 | 98.59 | ||
| PF00023 | 33 | Ank: Ankyrin repeat Hereditary spherocytosis; Inte | 98.56 | |
| KOG0226|consensus | 290 | 98.56 | ||
| KOG0132|consensus | 894 | 98.55 | ||
| KOG0129|consensus | 520 | 98.53 | ||
| KOG0533|consensus | 243 | 98.52 | ||
| KOG4369|consensus | 2131 | 98.36 | ||
| KOG2384|consensus | 223 | 98.36 | ||
| KOG0511|consensus | 516 | 98.34 | ||
| PF04059 | 97 | RRM_2: RNA recognition motif 2; InterPro: IPR00720 | 98.34 | |
| KOG0782|consensus | 1004 | 98.32 | ||
| KOG0782|consensus | 1004 | 98.31 | ||
| KOG0520|consensus | 975 | 98.3 | ||
| KOG0151|consensus | 877 | 98.28 | ||
| KOG0120|consensus | 500 | 98.25 | ||
| KOG4660|consensus | 549 | 98.22 | ||
| KOG1190|consensus | 492 | 98.22 | ||
| KOG0521|consensus | 785 | 98.18 | ||
| KOG0128|consensus | 881 | 98.14 | ||
| KOG1365|consensus | 508 | 98.14 | ||
| KOG3609|consensus | 822 | 98.1 | ||
| KOG0520|consensus | 975 | 97.92 | ||
| KOG4210|consensus | 285 | 97.9 | ||
| KOG1190|consensus | 492 | 97.88 | ||
| KOG0129|consensus | 520 | 97.87 | ||
| KOG4211|consensus | 510 | 97.87 | ||
| KOG1995|consensus | 351 | 97.87 | ||
| KOG0521|consensus | 785 | 97.73 | ||
| KOG4210|consensus | 285 | 97.72 | ||
| KOG0511|consensus | 516 | 97.66 | ||
| PF11608 | 90 | Limkain-b1: Limkain b1; InterPro: IPR024582 This e | 97.59 | |
| KOG0112|consensus | 975 | 97.59 | ||
| KOG0705|consensus | 749 | 97.58 | ||
| COG5175 | 480 | MOT2 Transcriptional repressor [Transcription] | 97.54 | |
| KOG0120|consensus | 500 | 97.49 | ||
| KOG1365|consensus | 508 | 97.49 | ||
| PF08777 | 105 | RRM_3: RNA binding motif; InterPro: IPR014886 This | 97.45 | |
| KOG0506|consensus | 622 | 97.44 | ||
| PF14605 | 53 | Nup35_RRM_2: Nup53/35/40-type RNA recognition moti | 97.4 | |
| KOG2193|consensus | 584 | 97.35 | ||
| KOG1457|consensus | 284 | 97.3 | ||
| KOG3878|consensus | 469 | 97.29 | ||
| PF05172 | 100 | Nup35_RRM: Nup53/35/40-type RNA recognition motif; | 97.25 | |
| KOG4849|consensus | 498 | 97.22 | ||
| KOG0818|consensus | 669 | 97.2 | ||
| smart00248 | 30 | ANK ankyrin repeats. Ankyrin repeats are about 33 | 97.17 | |
| KOG4676|consensus | 479 | 97.12 | ||
| PLN03134 | 144 | glycine-rich RNA-binding protein 4; Provisional | 97.06 | |
| KOG0522|consensus | 560 | 97.05 | ||
| smart00248 | 30 | ANK ankyrin repeats. Ankyrin repeats are about 33 | 97.04 | |
| KOG3152|consensus | 278 | 97.02 | ||
| KOG4206|consensus | 221 | 96.9 | ||
| KOG0106|consensus | 216 | 96.87 | ||
| KOG0149|consensus | 247 | 96.81 | ||
| KOG2505|consensus | 591 | 96.73 | ||
| PF00076 | 70 | RRM_1: RNA recognition motif. (a.k.a. RRM, RBD, or | 96.72 | |
| KOG4307|consensus | 944 | 96.68 | ||
| KOG0121|consensus | 153 | 96.25 | ||
| PF08952 | 146 | DUF1866: Domain of unknown function (DUF1866) ; In | 96.19 | |
| KOG2384|consensus | 223 | 96.17 | ||
| KOG0126|consensus | 219 | 96.11 | ||
| KOG1456|consensus | 494 | 96.11 | ||
| KOG0122|consensus | 270 | 96.11 | ||
| KOG0105|consensus | 241 | 96.1 | ||
| KOG0128|consensus | 881 | 96.1 | ||
| KOG1855|consensus | 484 | 96.04 | ||
| KOG2314|consensus | 698 | 96.01 | ||
| PF08675 | 87 | RNA_bind: RNA binding domain; InterPro: IPR014789 | 95.89 | |
| KOG0114|consensus | 124 | 95.87 | ||
| KOG1456|consensus | 494 | 95.58 | ||
| KOG0115|consensus | 275 | 95.42 | ||
| KOG0112|consensus | 975 | 95.4 | ||
| KOG1548|consensus | 382 | 95.39 | ||
| KOG3609|consensus | 822 | 95.16 | ||
| PLN03213 | 759 | repressor of silencing 3; Provisional | 95.11 | |
| PLN03120 | 260 | nucleic acid binding protein; Provisional | 95.1 | |
| KOG2068|consensus | 327 | 95.09 | ||
| KOG0125|consensus | 376 | 95.01 | ||
| KOG4307|consensus | 944 | 94.93 | ||
| KOG1996|consensus | 378 | 94.8 | ||
| smart00362 | 72 | RRM_2 RNA recognition motif. | 94.69 | |
| KOG0113|consensus | 335 | 94.29 | ||
| KOG0107|consensus | 195 | 94.27 | ||
| PF03467 | 176 | Smg4_UPF3: Smg-4/UPF3 family; InterPro: IPR005120 | 94.19 | |
| PF06128 | 284 | Shigella_OspC: Shigella flexneri OspC protein; Int | 94.16 | |
| KOG0226|consensus | 290 | 94.14 | ||
| PLN03121 | 243 | nucleic acid binding protein; Provisional | 94.12 | |
| PF10309 | 62 | DUF2414: Protein of unknown function (DUF2414); In | 94.04 | |
| PF14259 | 70 | RRM_6: RNA recognition motif (a.k.a. RRM, RBD, or | 93.86 | |
| cd00590 | 74 | RRM RRM (RNA recognition motif), also known as RBD | 93.06 | |
| COG0724 | 306 | RNA-binding proteins (RRM domain) [General functio | 92.92 | |
| smart00360 | 71 | RRM RNA recognition motif. | 92.92 | |
| KOG2135|consensus | 526 | 92.65 | ||
| KOG0130|consensus | 170 | 92.6 | ||
| PF15023 | 166 | DUF4523: Protein of unknown function (DUF4523) | 92.0 | |
| KOG4285|consensus | 350 | 91.89 | ||
| KOG2202|consensus | 260 | 91.6 | ||
| KOG4207|consensus | 256 | 89.98 | ||
| PF11929 | 76 | DUF3447: Domain of unknown function (DUF3447); Int | 89.94 | |
| PF07576 | 110 | BRAP2: BRCA1-associated protein 2; InterPro: IPR01 | 89.78 | |
| KOG0108|consensus | 435 | 88.48 | ||
| PF07292 | 88 | NID: Nmi/IFP 35 domain (NID); InterPro: IPR009909 | 88.25 | |
| KOG0533|consensus | 243 | 88.2 | ||
| KOG0151|consensus | 877 | 87.75 | ||
| KOG2416|consensus | 718 | 87.21 | ||
| KOG2505|consensus | 591 | 85.83 | ||
| PF03158 | 192 | DUF249: Multigene family 530 protein; InterPro: IP | 82.4 | |
| KOG0116|consensus | 419 | 82.12 | ||
| KOG2591|consensus | 684 | 80.55 |
| >TIGR01659 sex-lethal sex-lethal family splicing factor | Back alignment and domain information |
|---|
Probab=99.89 E-value=3.7e-23 Score=187.66 Aligned_cols=148 Identities=20% Similarity=0.287 Sum_probs=124.1
Q ss_pred ccCCCeEEEeCCCCCCCHHHHHHHHhccCCeeEEEEeeeCCCCCceeEEEEEEcCHHHHHHHHh-cCCCccCCccccccC
Q psy630 5 IRQLNKIFVGNLPWTVSHNELKKFFSEYGQIMNASVMFDKNTGLSKGFGFVTFQNKEAVDKVFS-TDSHVLEGSRLSIQP 83 (347)
Q Consensus 5 ~~~~~~l~V~nLp~~~t~~~l~~~f~~~G~i~~~~i~~~~~t~~~~g~afV~f~~~~~a~~a~~-~~~~~~~g~~l~v~~ 83 (347)
....++|||+|||+++|+++|+++|++||.|.+|+|++|+.|++++|||||+|.+.++|.+|++ +++..+.+++|+|.+
T Consensus 104 ~~~~~~LfVgnLp~~~te~~L~~lF~~~G~V~~v~i~~d~~tg~srGyaFVeF~~~e~A~~Ai~~LnG~~l~gr~i~V~~ 183 (346)
T TIGR01659 104 NNSGTNLIVNYLPQDMTDRELYALFRTIGPINTCRIMRDYKTGYSFGYAFVDFGSEADSQRAIKNLNGITVRNKRLKVSY 183 (346)
T ss_pred CCCCcEEEEeCCCCCCCHHHHHHHHHhcCCEEEEEEEecCCCCccCcEEEEEEccHHHHHHHHHHcCCCccCCceeeeec
Confidence 3456899999999999999999999999999999999999999999999999999999999997 499999999999998
Q ss_pred CCcccccchhhhhhcccccccccCCcccccchhhHHHHhhccccceecccCCCCCccchhHHHHHHHHHHcCCCCHHHHH
Q psy630 84 SDSHNRMAENMEDRFNQACDYLPSLVKKLDSSTLLKFYALYKQATVGQCNIDKPSWYNMEAKSKYNAWNSLGQMAKSEAM 163 (347)
Q Consensus 84 ~~~~~~~~~~~~~~f~~~~~~v~~l~~~~~~e~l~~~f~~fg~v~~g~~~~~~p~~~~~~~~~K~~aw~~~~~~~~~eA~ 163 (347)
+.+... .....++||+|||..+++++|+++|+.||.|....+..++. .++.|..||.+ ..+.++|.
T Consensus 184 a~p~~~-------~~~~~~lfV~nLp~~vtee~L~~~F~~fG~V~~v~i~~d~~-----tg~~kG~aFV~--F~~~e~A~ 249 (346)
T TIGR01659 184 ARPGGE-------SIKDTNLYVTNLPRTITDDQLDTIFGKYGQIVQKNILRDKL-----TGTPRGVAFVR--FNKREEAQ 249 (346)
T ss_pred cccccc-------ccccceeEEeCCCCcccHHHHHHHHHhcCCEEEEEEeecCC-----CCccceEEEEE--ECCHHHHH
Confidence 865432 12346799999999999999999999999998777765542 34455555554 45577777
Q ss_pred HHH
Q psy630 164 SKY 166 (347)
Q Consensus 164 ~~y 166 (347)
++.
T Consensus 250 ~Ai 252 (346)
T TIGR01659 250 EAI 252 (346)
T ss_pred HHH
Confidence 663
|
This model describes the sex-lethal family of splicing factors found in Dipteran insects. The sex-lethal phenotype, however, may be limited to the Melanogasters and closely related species. In Drosophila the protein acts as an inhibitor of splicing. This subfamily is most closely related to the ELAV/HUD subfamily of splicing factors (TIGR01661). |
| >TIGR01645 half-pint poly-U binding splicing factor, half-pint family | Back alignment and domain information |
|---|
| >PTZ00458 acyl CoA binding protein; Provisional | Back alignment and domain information |
|---|
| >TIGR01661 ELAV_HUD_SF ELAV/HuD family splicing factor | Back alignment and domain information |
|---|
| >KOG4412|consensus | Back alignment and domain information |
|---|
| >KOG4412|consensus | Back alignment and domain information |
|---|
| >TIGR01622 SF-CC1 splicing factor, CC1-like family | Back alignment and domain information |
|---|
| >cd00435 ACBP Acyl CoA binding protein (ACBP) binds thiol esters of long fatty acids and coenzyme A in a one-to-one binding mode with high specificity and affinity | Back alignment and domain information |
|---|
| >TIGR01628 PABP-1234 polyadenylate binding protein, human types 1, 2, 3, 4 family | Back alignment and domain information |
|---|
| >KOG0131|consensus | Back alignment and domain information |
|---|
| >KOG0145|consensus | Back alignment and domain information |
|---|
| >KOG0817|consensus | Back alignment and domain information |
|---|
| >KOG0148|consensus | Back alignment and domain information |
|---|
| >KOG0144|consensus | Back alignment and domain information |
|---|
| >KOG0117|consensus | Back alignment and domain information |
|---|
| >PF00887 ACBP: Acyl CoA binding protein; InterPro: IPR000582 Acyl-CoA-binding protein (ACBP) is a small (10 Kd) protein that binds medium- and long-chain acyl-CoA esters with very high affinity and may function as an intracellular carrier of acyl-CoA esters [] | Back alignment and domain information |
|---|
| >TIGR01661 ELAV_HUD_SF ELAV/HuD family splicing factor | Back alignment and domain information |
|---|
| >TIGR01648 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein R, Q family | Back alignment and domain information |
|---|
| >TIGR01628 PABP-1234 polyadenylate binding protein, human types 1, 2, 3, 4 family | Back alignment and domain information |
|---|
| >COG4281 ACB Acyl-CoA-binding protein [Lipid metabolism] | Back alignment and domain information |
|---|
| >PHA02743 Viral ankyrin protein; Provisional | Back alignment and domain information |
|---|
| >PLN03134 glycine-rich RNA-binding protein 4; Provisional | Back alignment and domain information |
|---|
| >PF12796 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain | Back alignment and domain information |
|---|
| >KOG0149|consensus | Back alignment and domain information |
|---|
| >KOG0509|consensus | Back alignment and domain information |
|---|
| >KOG0508|consensus | Back alignment and domain information |
|---|
| >KOG0512|consensus | Back alignment and domain information |
|---|
| >PHA02736 Viral ankyrin protein; Provisional | Back alignment and domain information |
|---|
| >TIGR01649 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor family | Back alignment and domain information |
|---|
| >PHA02791 ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >TIGR01642 U2AF_lg U2 snRNP auxilliary factor, large subunit, splicing factor | Back alignment and domain information |
|---|
| >TIGR01642 U2AF_lg U2 snRNP auxilliary factor, large subunit, splicing factor | Back alignment and domain information |
|---|
| >PHA02741 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >KOG0195|consensus | Back alignment and domain information |
|---|
| >PHA02741 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >KOG0124|consensus | Back alignment and domain information |
|---|
| >KOG0512|consensus | Back alignment and domain information |
|---|
| >PHA02791 ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >KOG0127|consensus | Back alignment and domain information |
|---|
| >KOG4214|consensus | Back alignment and domain information |
|---|
| >TIGR01649 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor family | Back alignment and domain information |
|---|
| >KOG0127|consensus | Back alignment and domain information |
|---|
| >PHA02875 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >PHA02795 ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >PHA02878 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >PHA02874 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >PHA02859 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >PHA02884 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >PHA02859 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >KOG0117|consensus | Back alignment and domain information |
|---|
| >PF00076 RRM_1: RNA recognition motif | Back alignment and domain information |
|---|
| >KOG0509|consensus | Back alignment and domain information |
|---|
| >PLN03192 Voltage-dependent potassium channel; Provisional | Back alignment and domain information |
|---|
| >PHA02743 Viral ankyrin protein; Provisional | Back alignment and domain information |
|---|
| >TIGR01648 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein R, Q family | Back alignment and domain information |
|---|
| >KOG4205|consensus | Back alignment and domain information |
|---|
| >KOG0502|consensus | Back alignment and domain information |
|---|
| >KOG0105|consensus | Back alignment and domain information |
|---|
| >PF13637 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 3B7B_A 3F6Q_A 2KBX_A 3IXE_A 2DWZ_C 2DVW_A 3AJI_A 1S70_B 2HE0_A | Back alignment and domain information |
|---|
| >PHA02875 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >PHA03095 ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >PHA02798 ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >TIGR01622 SF-CC1 splicing factor, CC1-like family | Back alignment and domain information |
|---|
| >KOG0515|consensus | Back alignment and domain information |
|---|
| >PF13857 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 3EHR_B 3EHQ_A | Back alignment and domain information |
|---|
| >KOG0123|consensus | Back alignment and domain information |
|---|
| >PHA03095 ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >KOG0110|consensus | Back alignment and domain information |
|---|
| >PLN03120 nucleic acid binding protein; Provisional | Back alignment and domain information |
|---|
| >KOG0145|consensus | Back alignment and domain information |
|---|
| >KOG0121|consensus | Back alignment and domain information |
|---|
| >PHA02946 ankyin-like protein; Provisional | Back alignment and domain information |
|---|
| >KOG0125|consensus | Back alignment and domain information |
|---|
| >KOG0109|consensus | Back alignment and domain information |
|---|
| >PHA03100 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >PF14259 RRM_6: RNA recognition motif (a | Back alignment and domain information |
|---|
| >PHA02946 ankyin-like protein; Provisional | Back alignment and domain information |
|---|
| >PHA03100 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >KOG0123|consensus | Back alignment and domain information |
|---|
| >PHA02878 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >KOG0122|consensus | Back alignment and domain information |
|---|
| >PHA02884 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >KOG0510|consensus | Back alignment and domain information |
|---|
| >PHA02874 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >KOG4177|consensus | Back alignment and domain information |
|---|
| >PHA02716 CPXV016; CPX019; EVM010; Provisional | Back alignment and domain information |
|---|
| >KOG0113|consensus | Back alignment and domain information |
|---|
| >PHA02736 Viral ankyrin protein; Provisional | Back alignment and domain information |
|---|
| >PHA02989 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >KOG0126|consensus | Back alignment and domain information |
|---|
| >TIGR01645 half-pint poly-U binding splicing factor, half-pint family | Back alignment and domain information |
|---|
| >PHA02716 CPXV016; CPX019; EVM010; Provisional | Back alignment and domain information |
|---|
| >PLN03213 repressor of silencing 3; Provisional | Back alignment and domain information |
|---|
| >KOG0510|consensus | Back alignment and domain information |
|---|
| >KOG0514|consensus | Back alignment and domain information |
|---|
| >PLN03121 nucleic acid binding protein; Provisional | Back alignment and domain information |
|---|
| >PHA02876 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >PLN03192 Voltage-dependent potassium channel; Provisional | Back alignment and domain information |
|---|
| >TIGR01659 sex-lethal sex-lethal family splicing factor | Back alignment and domain information |
|---|
| >KOG0514|consensus | Back alignment and domain information |
|---|
| >KOG4207|consensus | Back alignment and domain information |
|---|
| >COG0724 RNA-binding proteins (RRM domain) [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4177|consensus | Back alignment and domain information |
|---|
| >PHA02917 ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >PHA02876 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >KOG0505|consensus | Back alignment and domain information |
|---|
| >KOG0508|consensus | Back alignment and domain information |
|---|
| >PHA02917 ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >PTZ00322 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional | Back alignment and domain information |
|---|
| >PHA02798 ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >PHA02989 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >PHA02795 ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >KOG0107|consensus | Back alignment and domain information |
|---|
| >KOG0147|consensus | Back alignment and domain information |
|---|
| >PHA02730 ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >PHA02730 ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >smart00362 RRM_2 RNA recognition motif | Back alignment and domain information |
|---|
| >KOG4206|consensus | Back alignment and domain information |
|---|
| >KOG0505|consensus | Back alignment and domain information |
|---|
| >cd00204 ANK ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins | Back alignment and domain information |
|---|
| >KOG0111|consensus | Back alignment and domain information |
|---|
| >KOG0114|consensus | Back alignment and domain information |
|---|
| >smart00360 RRM RNA recognition motif | Back alignment and domain information |
|---|
| >KOG1710|consensus | Back alignment and domain information |
|---|
| >KOG0507|consensus | Back alignment and domain information |
|---|
| >KOG0148|consensus | Back alignment and domain information |
|---|
| >PHA02792 ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >KOG0195|consensus | Back alignment and domain information |
|---|
| >COG0666 Arp FOG: Ankyrin repeat [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1710|consensus | Back alignment and domain information |
|---|
| >KOG0108|consensus | Back alignment and domain information |
|---|
| >cd00590 RRM RRM (RNA recognition motif), also known as RBD (RNA binding domain) or RNP (ribonucleoprotein domain), is a highly abundant domain in eukaryotes found in proteins involved in post-transcriptional gene expression processes including mRNA and rRNA processing, RNA export, and RNA stability | Back alignment and domain information |
|---|
| >PF13637 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 3B7B_A 3F6Q_A 2KBX_A 3IXE_A 2DWZ_C 2DVW_A 3AJI_A 1S70_B 2HE0_A | Back alignment and domain information |
|---|
| >KOG0130|consensus | Back alignment and domain information |
|---|
| >PF12796 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain | Back alignment and domain information |
|---|
| >KOG4211|consensus | Back alignment and domain information |
|---|
| >KOG0144|consensus | Back alignment and domain information |
|---|
| >COG0666 Arp FOG: Ankyrin repeat [General function prediction only] | Back alignment and domain information |
|---|
| >PHA02792 ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >TIGR00870 trp transient-receptor-potential calcium channel protein | Back alignment and domain information |
|---|
| >KOG0502|consensus | Back alignment and domain information |
|---|
| >KOG0515|consensus | Back alignment and domain information |
|---|
| >KOG4212|consensus | Back alignment and domain information |
|---|
| >cd00204 ANK ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins | Back alignment and domain information |
|---|
| >KOG4214|consensus | Back alignment and domain information |
|---|
| >TIGR00870 trp transient-receptor-potential calcium channel protein | Back alignment and domain information |
|---|
| >smart00361 RRM_1 RNA recognition motif | Back alignment and domain information |
|---|
| >KOG0506|consensus | Back alignment and domain information |
|---|
| >KOG4205|consensus | Back alignment and domain information |
|---|
| >KOG3676|consensus | Back alignment and domain information |
|---|
| >KOG1457|consensus | Back alignment and domain information |
|---|
| >KOG0131|consensus | Back alignment and domain information |
|---|
| >KOG0147|consensus | Back alignment and domain information |
|---|
| >KOG0705|consensus | Back alignment and domain information |
|---|
| >KOG0507|consensus | Back alignment and domain information |
|---|
| >KOG0153|consensus | Back alignment and domain information |
|---|
| >KOG0146|consensus | Back alignment and domain information |
|---|
| >PF13893 RRM_5: RNA recognition motif | Back alignment and domain information |
|---|
| >KOG0818|consensus | Back alignment and domain information |
|---|
| >PF13606 Ank_3: Ankyrin repeat | Back alignment and domain information |
|---|
| >PF00023 Ank: Ankyrin repeat Hereditary spherocytosis; InterPro: IPR002110 The ankyrin repeat is one of the most common protein-protein interaction motifs in nature | Back alignment and domain information |
|---|
| >KOG4208|consensus | Back alignment and domain information |
|---|
| >PF13857 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 3EHR_B 3EHQ_A | Back alignment and domain information |
|---|
| >KOG3676|consensus | Back alignment and domain information |
|---|
| >KOG0106|consensus | Back alignment and domain information |
|---|
| >KOG0124|consensus | Back alignment and domain information |
|---|
| >KOG0415|consensus | Back alignment and domain information |
|---|
| >KOG0783|consensus | Back alignment and domain information |
|---|
| >KOG0146|consensus | Back alignment and domain information |
|---|
| >KOG0109|consensus | Back alignment and domain information |
|---|
| >PTZ00322 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional | Back alignment and domain information |
|---|
| >KOG4661|consensus | Back alignment and domain information |
|---|
| >KOG0116|consensus | Back alignment and domain information |
|---|
| >PF13606 Ank_3: Ankyrin repeat | Back alignment and domain information |
|---|
| >KOG0110|consensus | Back alignment and domain information |
|---|
| >KOG4454|consensus | Back alignment and domain information |
|---|
| >KOG0522|consensus | Back alignment and domain information |
|---|
| >KOG4369|consensus | Back alignment and domain information |
|---|
| >KOG4212|consensus | Back alignment and domain information |
|---|
| >KOG1548|consensus | Back alignment and domain information |
|---|
| >KOG0783|consensus | Back alignment and domain information |
|---|
| >KOG4209|consensus | Back alignment and domain information |
|---|
| >PF00023 Ank: Ankyrin repeat Hereditary spherocytosis; InterPro: IPR002110 The ankyrin repeat is one of the most common protein-protein interaction motifs in nature | Back alignment and domain information |
|---|
| >KOG0226|consensus | Back alignment and domain information |
|---|
| >KOG0132|consensus | Back alignment and domain information |
|---|
| >KOG0129|consensus | Back alignment and domain information |
|---|
| >KOG0533|consensus | Back alignment and domain information |
|---|
| >KOG4369|consensus | Back alignment and domain information |
|---|
| >KOG2384|consensus | Back alignment and domain information |
|---|
| >KOG0511|consensus | Back alignment and domain information |
|---|
| >PF04059 RRM_2: RNA recognition motif 2; InterPro: IPR007201 This RNA recognition motif 2 is found in Meiosis protein mei2 | Back alignment and domain information |
|---|
| >KOG0782|consensus | Back alignment and domain information |
|---|
| >KOG0782|consensus | Back alignment and domain information |
|---|
| >KOG0520|consensus | Back alignment and domain information |
|---|
| >KOG0151|consensus | Back alignment and domain information |
|---|
| >KOG0120|consensus | Back alignment and domain information |
|---|
| >KOG4660|consensus | Back alignment and domain information |
|---|
| >KOG1190|consensus | Back alignment and domain information |
|---|
| >KOG0521|consensus | Back alignment and domain information |
|---|
| >KOG0128|consensus | Back alignment and domain information |
|---|
| >KOG1365|consensus | Back alignment and domain information |
|---|
| >KOG3609|consensus | Back alignment and domain information |
|---|
| >KOG0520|consensus | Back alignment and domain information |
|---|
| >KOG4210|consensus | Back alignment and domain information |
|---|
| >KOG1190|consensus | Back alignment and domain information |
|---|
| >KOG0129|consensus | Back alignment and domain information |
|---|
| >KOG4211|consensus | Back alignment and domain information |
|---|
| >KOG1995|consensus | Back alignment and domain information |
|---|
| >KOG0521|consensus | Back alignment and domain information |
|---|
| >KOG4210|consensus | Back alignment and domain information |
|---|
| >KOG0511|consensus | Back alignment and domain information |
|---|
| >PF11608 Limkain-b1: Limkain b1; InterPro: IPR024582 This entry represents a conserved domain found in limkain b1, which is a novel human autoantigen, localised to a subset of ABCD3 and PXF marked peroxisomes | Back alignment and domain information |
|---|
| >KOG0112|consensus | Back alignment and domain information |
|---|
| >KOG0705|consensus | Back alignment and domain information |
|---|
| >COG5175 MOT2 Transcriptional repressor [Transcription] | Back alignment and domain information |
|---|
| >KOG0120|consensus | Back alignment and domain information |
|---|
| >KOG1365|consensus | Back alignment and domain information |
|---|
| >PF08777 RRM_3: RNA binding motif; InterPro: IPR014886 This domain is found in protein La which functions as an RNA chaperone during RNA polymerase III transcription, and can also stimulate translation initiation | Back alignment and domain information |
|---|
| >KOG0506|consensus | Back alignment and domain information |
|---|
| >PF14605 Nup35_RRM_2: Nup53/35/40-type RNA recognition motif | Back alignment and domain information |
|---|
| >KOG2193|consensus | Back alignment and domain information |
|---|
| >KOG1457|consensus | Back alignment and domain information |
|---|
| >KOG3878|consensus | Back alignment and domain information |
|---|
| >PF05172 Nup35_RRM: Nup53/35/40-type RNA recognition motif; InterPro: IPR007846 The MPPN (Mitotic PhosphoProtein N end) family is uncharacterised however it probably plays a role in the cell cycle because the family includes mitotic phosphoproteins O13026 from SWISSPROT [] | Back alignment and domain information |
|---|
| >KOG4849|consensus | Back alignment and domain information |
|---|
| >KOG0818|consensus | Back alignment and domain information |
|---|
| >smart00248 ANK ankyrin repeats | Back alignment and domain information |
|---|
| >KOG4676|consensus | Back alignment and domain information |
|---|
| >PLN03134 glycine-rich RNA-binding protein 4; Provisional | Back alignment and domain information |
|---|
| >KOG0522|consensus | Back alignment and domain information |
|---|
| >smart00248 ANK ankyrin repeats | Back alignment and domain information |
|---|
| >KOG3152|consensus | Back alignment and domain information |
|---|
| >KOG4206|consensus | Back alignment and domain information |
|---|
| >KOG0106|consensus | Back alignment and domain information |
|---|
| >KOG0149|consensus | Back alignment and domain information |
|---|
| >KOG2505|consensus | Back alignment and domain information |
|---|
| >PF00076 RRM_1: RNA recognition motif | Back alignment and domain information |
|---|
| >KOG4307|consensus | Back alignment and domain information |
|---|
| >KOG0121|consensus | Back alignment and domain information |
|---|
| >PF08952 DUF1866: Domain of unknown function (DUF1866) ; InterPro: IPR015047 This domain, found in synaptojanin, has no known function | Back alignment and domain information |
|---|
| >KOG2384|consensus | Back alignment and domain information |
|---|
| >KOG0126|consensus | Back alignment and domain information |
|---|
| >KOG1456|consensus | Back alignment and domain information |
|---|
| >KOG0122|consensus | Back alignment and domain information |
|---|
| >KOG0105|consensus | Back alignment and domain information |
|---|
| >KOG0128|consensus | Back alignment and domain information |
|---|
| >KOG1855|consensus | Back alignment and domain information |
|---|
| >KOG2314|consensus | Back alignment and domain information |
|---|
| >PF08675 RNA_bind: RNA binding domain; InterPro: IPR014789 This domain corresponds to the RNA binding domain of Poly(A)-specific ribonuclease (PARN) | Back alignment and domain information |
|---|
| >KOG0114|consensus | Back alignment and domain information |
|---|
| >KOG1456|consensus | Back alignment and domain information |
|---|
| >KOG0115|consensus | Back alignment and domain information |
|---|
| >KOG0112|consensus | Back alignment and domain information |
|---|
| >KOG1548|consensus | Back alignment and domain information |
|---|
| >KOG3609|consensus | Back alignment and domain information |
|---|
| >PLN03213 repressor of silencing 3; Provisional | Back alignment and domain information |
|---|
| >PLN03120 nucleic acid binding protein; Provisional | Back alignment and domain information |
|---|
| >KOG2068|consensus | Back alignment and domain information |
|---|
| >KOG0125|consensus | Back alignment and domain information |
|---|
| >KOG4307|consensus | Back alignment and domain information |
|---|
| >KOG1996|consensus | Back alignment and domain information |
|---|
| >smart00362 RRM_2 RNA recognition motif | Back alignment and domain information |
|---|
| >KOG0113|consensus | Back alignment and domain information |
|---|
| >KOG0107|consensus | Back alignment and domain information |
|---|
| >PF03467 Smg4_UPF3: Smg-4/UPF3 family; InterPro: IPR005120 Nonsense-mediated mRNA decay (NMD) is a surveillance mechanism by which eukaryotic cells detect and degrade transcripts containing premature termination codons | Back alignment and domain information |
|---|
| >PF06128 Shigella_OspC: Shigella flexneri OspC protein; InterPro: IPR010366 This family consists of the Shigella flexneri specific protein OspC | Back alignment and domain information |
|---|
| >KOG0226|consensus | Back alignment and domain information |
|---|
| >PLN03121 nucleic acid binding protein; Provisional | Back alignment and domain information |
|---|
| >PF10309 DUF2414: Protein of unknown function (DUF2414); InterPro: IPR019416 This entry contains proteins that have no known function | Back alignment and domain information |
|---|
| >PF14259 RRM_6: RNA recognition motif (a | Back alignment and domain information |
|---|
| >cd00590 RRM RRM (RNA recognition motif), also known as RBD (RNA binding domain) or RNP (ribonucleoprotein domain), is a highly abundant domain in eukaryotes found in proteins involved in post-transcriptional gene expression processes including mRNA and rRNA processing, RNA export, and RNA stability | Back alignment and domain information |
|---|
| >COG0724 RNA-binding proteins (RRM domain) [General function prediction only] | Back alignment and domain information |
|---|
| >smart00360 RRM RNA recognition motif | Back alignment and domain information |
|---|
| >KOG2135|consensus | Back alignment and domain information |
|---|
| >KOG0130|consensus | Back alignment and domain information |
|---|
| >PF15023 DUF4523: Protein of unknown function (DUF4523) | Back alignment and domain information |
|---|
| >KOG4285|consensus | Back alignment and domain information |
|---|
| >KOG2202|consensus | Back alignment and domain information |
|---|
| >KOG4207|consensus | Back alignment and domain information |
|---|
| >PF11929 DUF3447: Domain of unknown function (DUF3447); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain | Back alignment and domain information |
|---|
| >PF07576 BRAP2: BRCA1-associated protein 2; InterPro: IPR011422 These proteins include BRCA1-associated protein 2 (BRAP2), which binds nuclear localisation signals (NLSs) in vitro and in yeast two-hybrid screening [] | Back alignment and domain information |
|---|
| >KOG0108|consensus | Back alignment and domain information |
|---|
| >PF07292 NID: Nmi/IFP 35 domain (NID); InterPro: IPR009909 This entry represents a domain of approximately 90 residues that is tandemly repeated within interferon-induced 35 kDa protein (IFP 35) and the homologous N-myc-interactor (Nmi) | Back alignment and domain information |
|---|
| >KOG0533|consensus | Back alignment and domain information |
|---|
| >KOG0151|consensus | Back alignment and domain information |
|---|
| >KOG2416|consensus | Back alignment and domain information |
|---|
| >KOG2505|consensus | Back alignment and domain information |
|---|
| >PF03158 DUF249: Multigene family 530 protein; InterPro: IPR004858 This entry represents multigene family 530 proteins from African swine fever virus (ASFV) viruses | Back alignment and domain information |
|---|
| >KOG0116|consensus | Back alignment and domain information |
|---|
| >KOG2591|consensus | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 347 | ||||
| 2cop_A | 109 | Solution Structure Of Rsgi Ruh-040, An Acbp Domain | 2e-15 | ||
| 2dh8_A | 105 | Solution Structure Of The N-Terminal Rna Binding Do | 2e-13 | ||
| 2cjk_A | 167 | Structure Of The Rna Binding Domain Of Hrp1 In Comp | 2e-11 | ||
| 3flv_A | 119 | The Crystal Structure Of Human Acyl-Coenzymea Bindi | 3e-11 | ||
| 2rs2_A | 109 | 1h, 13c, And 15n Chemical Shift Assignments For Mus | 6e-11 | ||
| 2wh5_A | 106 | Crystal Structure Of Human Acyl-Coa Binding Domain | 7e-11 | ||
| 1hd0_A | 75 | Heterogeneous Nuclear Ribonucleoprotein D0 (Hnrnp D | 7e-11 | ||
| 3s7r_A | 87 | Crystal Structure Of A Heterogeneous Nuclear Ribonu | 8e-11 | ||
| 1uaw_A | 77 | Solution Structure Of The N-Terminal Rna-Binding Do | 3e-10 | ||
| 2cqd_A | 116 | Solution Structure Of The Rna Recognition Motif In | 6e-10 | ||
| 2dgs_A | 99 | Solution Structure Of The Second Rna Binding Domain | 1e-09 | ||
| 2up1_A | 183 | Structure Of Up1-Telomeric Dna Complex Length = 183 | 2e-09 | ||
| 2cqu_A | 116 | Solution Structure Of Rsgi Ruh-045, A Human Acyl-Co | 2e-09 | ||
| 1pgz_A | 195 | Crystal Structure Of Up1 Complexed With D(Ttagggtta | 2e-09 | ||
| 2lyv_A | 197 | Solution Structure Of The Two Rrm Domains Of Hnrnp | 3e-09 | ||
| 1l3k_A | 196 | Up1, The Two Rna-Recognition Motif Domain Of Hnrnp | 3e-09 | ||
| 1ha1_A | 184 | Hnrnp A1 (Rbd1,2) From Homo Sapiens Length = 184 | 4e-09 | ||
| 1up1_A | 182 | Up1, The Two Rna-Recognition Motif Domain Of Hnrnp | 4e-09 | ||
| 1fnx_H | 174 | Solution Structure Of The Huc Rbd1-Rbd2 Complexed W | 5e-09 | ||
| 4hqd_A | 169 | Crystal Structure Of Engineered Protein. Northeast | 8e-09 | ||
| 1p1t_A | 104 | Nmr Structure Of The N-Terminal Rrm Domain Of Cleav | 9e-09 | ||
| 1fxl_A | 167 | Crystal Structure Of Hud And Au-Rich Element Of The | 1e-08 | ||
| 1hbk_A | 89 | Acyl-Coa Binding Protein From Plasmodium Falciparum | 2e-08 | ||
| 2mss_A | 75 | Musashi1 Rbd2, Nmr Length = 75 | 3e-08 | ||
| 1x4b_A | 116 | Solution Structure Of Rrm Domain In Heterogeneous N | 4e-08 | ||
| 2kn4_A | 158 | The Structure Of The Rrm Domain Of Sc35 Length = 15 | 5e-08 | ||
| 2fdq_A | 86 | Crystal Structure Of Acbp From Armadillo Harderian | 5e-08 | ||
| 1hb6_A | 86 | Structure Of Bovine Acyl-Coa Binding Protein In Ort | 5e-08 | ||
| 2lbb_A | 96 | Solution Structure Of Acyl Coa Binding Protein From | 5e-08 | ||
| 1st7_A | 86 | Solution Structure Of Acyl Coenzyme A Binding Prote | 6e-08 | ||
| 4ed5_A | 177 | Crystal Structure Of The Two N-Terminal Rrm Domains | 6e-08 | ||
| 4egl_A | 177 | Crystal Structure Of Two Tandem Rna Recognition Mot | 6e-08 | ||
| 2cqg_A | 103 | Solution Structure Of The Rna Binding Domain Of Tar | 8e-08 | ||
| 2xsf_A | 89 | Crystal Structure Of The Rrm Domain Of Mouse Delete | 9e-08 | ||
| 2xs5_A | 87 | Crystal Structure Of The Rrm Domain Of Mouse Delete | 9e-08 | ||
| 2xs2_A | 102 | Crystal Structure Of The Rrm Domain Of Mouse Delete | 9e-08 | ||
| 2fj9_A | 86 | High Resolution Crystal Structure Of The Unliganded | 1e-07 | ||
| 2xzt_G | 136 | Caspase-3 In Complex With Darpin-3.4_i78s Length = | 1e-07 | ||
| 2cb8_A | 87 | High Resolution Crystal Structure Of Liganded Human | 1e-07 | ||
| 2lea_A | 135 | Solution Structure Of Human Srsf2 (Sc35) Rrm Length | 1e-07 | ||
| 2e5h_A | 94 | Solution Structure Of Rna Binding Domain In Zinc Fi | 1e-07 | ||
| 1d9a_A | 85 | Solution Structure Of The Second Rna-Binding Domain | 2e-07 | ||
| 2ki2_A | 90 | Solution Structure Of Ss-Dna Binding Protein 12rnp2 | 2e-07 | ||
| 2xeh_A | 157 | Structural Determinants For Improved Thermal Stabil | 2e-07 | ||
| 1x5s_A | 102 | Solution Structure Of Rrm Domain In A18 Hnrnp Lengt | 3e-07 | ||
| 2xee_A | 157 | Structural Determinants For Improved Thermal Stabil | 3e-07 | ||
| 3zuv_B | 136 | Crystal Structure Of A Designed Selected Ankyrin Re | 3e-07 | ||
| 2qyj_A | 166 | Crystal Structure Of A Designed Full Consensus Anky | 3e-07 | ||
| 1whw_A | 99 | Solution Structure Of The N-Terminal Rna Binding Do | 3e-07 | ||
| 4dui_A | 169 | Darpin D1 Binding To Tubulin Beta Chain (not In Com | 3e-07 | ||
| 3nog_D | 169 | Designed Ankyrin Repeat Protein (Darpin) Binders To | 4e-07 | ||
| 4gpm_A | 169 | Crystal Structure Of Engineered Protein. Northeast | 4e-07 | ||
| 2jrs_A | 108 | Solution Nmr Structure Of Caper Rrm2 Domain. Northe | 4e-07 | ||
| 3sxl_A | 184 | Sex-Lethal Rna Recognition Domains 1 And 2 From Dro | 5e-07 | ||
| 4drx_E | 169 | Gtp-Tubulin In Complex With A Darpin Length = 169 | 5e-07 | ||
| 3epy_A | 89 | Crystal Structure Of Human Acyl-Coa Binding Domain | 6e-07 | ||
| 1sxl_A | 97 | Resonance Assignments And Solution Structure Of The | 6e-07 | ||
| 3fp5_A | 106 | Crystal Structure Of Acbp From Moniliophthora Perni | 7e-07 | ||
| 3b7b_A | 237 | Euhmt1 (Glp) Ankyrin Repeat Domain (Structure 1) Le | 8e-07 | ||
| 4hb5_A | 169 | Crystal Structure Of Engineered Protein. Northeast | 9e-07 | ||
| 2dnz_A | 95 | Solution Structure Of The Second Rna Binding Domain | 1e-06 | ||
| 2err_A | 109 | Nmr Structure Of The Rna Binding Domain Of Human Fo | 2e-06 | ||
| 1n0r_A | 126 | 4ank: A Designed Ankyrin Repeat Protein With Four I | 2e-06 | ||
| 3noc_D | 169 | Designed Ankyrin Repeat Protein (Darpin) Binders To | 2e-06 | ||
| 2dgq_A | 108 | Solution Structure Of The N-Terminal Rna Binding Do | 2e-06 | ||
| 2dgp_A | 106 | Solution Structure Of The N-Terminal Rna Binding Do | 2e-06 | ||
| 3ucg_A | 89 | Crystal Structure Of A Rna Binding Domain Of Hypoth | 2e-06 | ||
| 3b4d_A | 96 | Crystal Structure Of Human Pabpn1 Rrm Length = 96 | 2e-06 | ||
| 2cq3_A | 103 | Solution Structure Of Rna Binding Domain In Rna Bin | 2e-06 | ||
| 1b7f_A | 168 | Sxl-Lethal ProteinRNA COMPLEX Length = 168 | 3e-06 | ||
| 2v4h_C | 136 | Nemo Cc2-Lz Domain - 1d5 Darpin Complex Length = 13 | 3e-06 | ||
| 2jwn_A | 124 | Solution Nmr Structure Of The Protease-Resistent Do | 3e-06 | ||
| 2cph_A | 107 | Solution Structure Of The C-Terminal Rna Recognitio | 4e-06 | ||
| 1n0q_A | 93 | 3ank: A Designed Ankyrin Repeat Protein With Three | 4e-06 | ||
| 3q9u_C | 158 | In Silico And In Vitro Co-Evolution Of A High Affin | 4e-06 | ||
| 2dh7_A | 105 | Solution Structure Of The Second Rna Binding Domain | 6e-06 | ||
| 1mj0_A | 166 | Sank E3_5: An Artificial Ankyrin Repeat Protein Len | 7e-06 | ||
| 3nmr_A | 175 | Crystal Structure Of Cugbp1 Rrm12-Rna Complex Lengt | 1e-05 | ||
| 4atz_D | 154 | Ad5 Knob In Complex With A Designed Ankyrin Repeat | 1e-05 | ||
| 3f6q_A | 179 | Crystal Structure Of Integrin-Linked Kinase Ankyrin | 1e-05 | ||
| 2dhs_A | 187 | Solution Structure Of Nucleic Acid Binding Protein | 2e-05 | ||
| 3nnc_A | 175 | Crystal Structure Of Cugbp1 Rrm12-Rna Complex Lengt | 2e-05 | ||
| 2kbx_A | 171 | Solution Structure Of Ilk-Pinch Complex Length = 17 | 2e-05 | ||
| 2dgo_A | 115 | Solution Structure Of The Rna Binding Domain In Cyt | 3e-05 | ||
| 4gmr_A | 169 | Crystal Structure Of Engineered Protein. Northeast | 3e-05 | ||
| 3ehq_A | 222 | Crystal Structure Of Human Osteoclast Stimulating F | 3e-05 | ||
| 1u6f_A | 139 | Nmr Solution Structure Of Tcubp1, A Single Rbd-Unit | 3e-05 | ||
| 1wtb_A | 79 | Complex Structure Of The C-Terminal Rna-Binding Dom | 4e-05 | ||
| 3zu7_B | 169 | Crystal Structure Of A Designed Selected Ankyrin Re | 5e-05 | ||
| 2j8s_D | 169 | Drug Export Pathway Of Multidrug Exporter Acrb Reve | 5e-05 | ||
| 2khc_A | 118 | Bruno Rrm3+ Length = 118 | 6e-05 | ||
| 2p2c_P | 169 | Inhibition Of Caspase-2 By A Designed Ankyrin Repea | 6e-05 | ||
| 2xnr_A | 97 | Structural Insights Into Cis Element Recognition Of | 8e-05 | ||
| 2xnq_A | 97 | Structural Insights Into Cis Element Recognition Of | 9e-05 | ||
| 3nnh_A | 88 | Crystal Structure Of The Cugbp1 Rrm1 With Guuguuuug | 1e-04 | ||
| 3sde_B | 261 | Crystal Structure Of A Paraspeckle-Protein Heterodi | 1e-04 | ||
| 2km8_B | 84 | Interdomain Rrm Packing Contributes To Rna Recognit | 1e-04 | ||
| 1mx4_A | 168 | Structure Of P18ink4c (F82q) Length = 168 | 1e-04 | ||
| 2x1f_A | 96 | Structure Of Rna15 Rrm With Bound Rna (Gu) Length = | 1e-04 | ||
| 2x1a_A | 97 | Structure Of Rna15 Rrm With Rna Bound (G) Length = | 1e-04 | ||
| 1iqt_A | 75 | Solution Structure Of The C-Terminal Rna-Binding Do | 1e-04 | ||
| 2qfj_A | 216 | Crystal Structure Of First Two Rrm Domains Of Fir B | 1e-04 | ||
| 2d9p_A | 103 | Solution Structure Of Rna Binding Domain 4 In Polya | 1e-04 | ||
| 4f6r_D | 169 | Tubulin:stathmin-Like Domain Complex Length = 169 | 2e-04 | ||
| 2l41_A | 77 | Nab3 Rrm - Ucuu Complex Length = 77 | 2e-04 | ||
| 2kvi_A | 96 | Structure Of Nab3 Rrm Length = 96 | 2e-04 | ||
| 2cpz_A | 115 | Solution Structure Of Rna Binding Domain 3 In Cug T | 2e-04 | ||
| 1mx6_A | 168 | Structure Of P18ink4c (F92n) Length = 168 | 2e-04 | ||
| 1ycs_B | 239 | P53-53bp2 Complex Length = 239 | 2e-04 | ||
| 4a63_B | 239 | Crystal Structure Of The P73-Aspp2 Complex At 2.6a | 2e-04 | ||
| 2rrb_A | 96 | Refinement Of Rna Binding Domain In Human Tra2 Beta | 2e-04 | ||
| 2cpf_A | 98 | Solution Structure Of The Penultimate Rna Recogniti | 2e-04 | ||
| 2i38_A | 150 | Solution Structure Of The Rrm Of Srp20 Length = 150 | 2e-04 | ||
| 2e5g_A | 94 | Solution Structure Of Rna Binding Domain In Rna Bin | 2e-04 | ||
| 3uwt_A | 200 | Crystal Structure Of A Rna Binding Domain Of Poly-U | 2e-04 | ||
| 2i2y_A | 150 | Solution Structure Of The Rrm Of Srp20 Bound To The | 2e-04 | ||
| 4f25_A | 115 | Crystal Structure Of The Second Rrm Domain Of Human | 2e-04 | ||
| 2cqc_A | 95 | Solution Structure Of The Rna Recognition Motif In | 2e-04 | ||
| 2rra_A | 99 | Solution Structure Of Rna Binding Domain In Human T | 3e-04 | ||
| 2kxf_A | 199 | Solution Structure Of The First Two Rrm Domains Of | 3e-04 | ||
| 4f02_A | 213 | Crystal Structure Of The Pabp-Binding Site Of Eif4g | 3e-04 | ||
| 3v30_A | 172 | Crystal Structure Of The Peptide Bound Complex Of T | 3e-04 | ||
| 2kxn_B | 129 | Nmr Structure Of Human Tra2beta1 Rrm In Complex Wit | 3e-04 | ||
| 1cvj_A | 190 | X-Ray Crystal Structure Of The Poly(A)-Binding Prot | 3e-04 | ||
| 3hi9_A | 84 | The X-Ray Crystal Structure Of The First Rna Recogn | 3e-04 | ||
| 1ihb_A | 162 | Crystal Structure Of P18-Ink4c(Ink6) Length = 162 | 4e-04 | ||
| 1bu9_A | 168 | Solution Structure Of P18-Ink4c, 21 Structures Leng | 4e-04 | ||
| 1mx2_A | 168 | Structure Of F71n Mutant Of P18ink4c Length = 168 | 4e-04 | ||
| 3uxg_A | 172 | Crystal Structure Of Rfxank Length = 172 | 4e-04 | ||
| 3md3_A | 166 | Crystal Structure Of The First Two Rrm Domains Of Y | 4e-04 | ||
| 2k8g_A | 95 | Solution Structure Of Rrm2 Domain Of Pabp1 Length = | 4e-04 | ||
| 2cpj_A | 99 | Solution Structure Of The N-Terminal Rna Recognitio | 4e-04 | ||
| 2dnq_A | 90 | Solution Structure Of Rna Binding Domain 1 In Rna-B | 4e-04 | ||
| 1x4a_A | 109 | Solution Structure Of Rrm Domain In Splicing Factor | 5e-04 | ||
| 4grg_A | 135 | Crystal Structure Of Ige Complexed With E2_79, An A | 5e-04 | ||
| 3eu9_A | 240 | The Ankyrin Repeat Domain Of Huntingtin Interacting | 5e-04 | ||
| 1s70_B | 299 | Complex Between Protein Ser/thr Phosphatase-1 (delt | 5e-04 | ||
| 1d8z_A | 89 | Solution Structure Of The First Rna-Binding Domain | 5e-04 | ||
| 3md1_A | 83 | Crystal Structure Of The Second Rrm Domain Of Yeast | 6e-04 | ||
| 2do0_A | 114 | Solution Structure Of The Rna Binding Domain Of Het | 6e-04 | ||
| 2hvz_A | 101 | Solution Structure Of The Rrm Domain Of Sr Rich Fac | 6e-04 | ||
| 2dnm_A | 103 | Solution Structure Of Rna Binding Domain In Srp46 S | 6e-04 | ||
| 2dgt_A | 92 | Solution Structure Of The Second Rna Binding Domain | 8e-04 | ||
| 3v2o_A | 183 | Crystal Structure Of The Peptide Bound Complex Of T | 8e-04 |
| >pdb|2COP|A Chain A, Solution Structure Of Rsgi Ruh-040, An Acbp Domain From Human Cdna Length = 109 | Back alignment and structure |
|
| >pdb|2DH8|A Chain A, Solution Structure Of The N-Terminal Rna Binding Domain In Daz-Associated Protein 1 Length = 105 | Back alignment and structure |
| >pdb|2CJK|A Chain A, Structure Of The Rna Binding Domain Of Hrp1 In Complex With Rna Length = 167 | Back alignment and structure |
| >pdb|3FLV|A Chain A, The Crystal Structure Of Human Acyl-Coenzymea Binding Domain Containing 5 Length = 119 | Back alignment and structure |
| >pdb|2RS2|A Chain A, 1h, 13c, And 15n Chemical Shift Assignments For Musashi1 Rbd1:r(Guagu) Complex Length = 109 | Back alignment and structure |
| >pdb|2WH5|A Chain A, Crystal Structure Of Human Acyl-Coa Binding Domain 4 Complexed With Stearoyl-Coa Length = 106 | Back alignment and structure |
| >pdb|1HD0|A Chain A, Heterogeneous Nuclear Ribonucleoprotein D0 (Hnrnp D0 Rbd1), Nmr Length = 75 | Back alignment and structure |
| >pdb|3S7R|A Chain A, Crystal Structure Of A Heterogeneous Nuclear Ribonucleoprotein AB (Hnrpab) From Homo Sapiens At 2.15 A Resolution Length = 87 | Back alignment and structure |
| >pdb|1UAW|A Chain A, Solution Structure Of The N-Terminal Rna-Binding Domain Of Mouse Musashi1 Length = 77 | Back alignment and structure |
| >pdb|2CQD|A Chain A, Solution Structure Of The Rna Recognition Motif In Rna- Binding Region Containing Protein 1 Length = 116 | Back alignment and structure |
| >pdb|2DGS|A Chain A, Solution Structure Of The Second Rna Binding Domain In Daz- Associated Protein 1 Length = 99 | Back alignment and structure |
| >pdb|2UP1|A Chain A, Structure Of Up1-Telomeric Dna Complex Length = 183 | Back alignment and structure |
| >pdb|2CQU|A Chain A, Solution Structure Of Rsgi Ruh-045, A Human Acyl-Coa Binding Protein Length = 116 | Back alignment and structure |
| >pdb|1PGZ|A Chain A, Crystal Structure Of Up1 Complexed With D(Ttagggttag(6-Mi) G); A Human Telomeric Repeat Containing 6-Methyl-8-(2- Deoxy-Beta-Ribofuranosyl)isoxanthopteridine (6-Mi) Length = 195 | Back alignment and structure |
| >pdb|2LYV|A Chain A, Solution Structure Of The Two Rrm Domains Of Hnrnp A1 (up1) Using Segmental Isotope Labeling Length = 197 | Back alignment and structure |
| >pdb|1L3K|A Chain A, Up1, The Two Rna-Recognition Motif Domain Of Hnrnp A1 Length = 196 | Back alignment and structure |
| >pdb|1HA1|A Chain A, Hnrnp A1 (Rbd1,2) From Homo Sapiens Length = 184 | Back alignment and structure |
| >pdb|1UP1|A Chain A, Up1, The Two Rna-Recognition Motif Domain Of Hnrnp A1 Length = 182 | Back alignment and structure |
| >pdb|1FNX|H Chain H, Solution Structure Of The Huc Rbd1-Rbd2 Complexed With The Au-Rich Element Length = 174 | Back alignment and structure |
| >pdb|4HQD|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or265. Length = 169 | Back alignment and structure |
| >pdb|1P1T|A Chain A, Nmr Structure Of The N-Terminal Rrm Domain Of Cleavage Stimulation Factor 64 Kda Subunit Length = 104 | Back alignment and structure |
| >pdb|1FXL|A Chain A, Crystal Structure Of Hud And Au-Rich Element Of The C-Fos Rna Length = 167 | Back alignment and structure |
| >pdb|1HBK|A Chain A, Acyl-Coa Binding Protein From Plasmodium Falciparum Length = 89 | Back alignment and structure |
| >pdb|2MSS|A Chain A, Musashi1 Rbd2, Nmr Length = 75 | Back alignment and structure |
| >pdb|1X4B|A Chain A, Solution Structure Of Rrm Domain In Heterogeneous Nuclear Ribonucleaoproteins A2B1 Length = 116 | Back alignment and structure |
| >pdb|2KN4|A Chain A, The Structure Of The Rrm Domain Of Sc35 Length = 158 | Back alignment and structure |
| >pdb|2FDQ|A Chain A, Crystal Structure Of Acbp From Armadillo Harderian Gland Length = 86 | Back alignment and structure |
| >pdb|1HB6|A Chain A, Structure Of Bovine Acyl-Coa Binding Protein In Orthorhombic Crystal Form Length = 86 | Back alignment and structure |
| >pdb|2LBB|A Chain A, Solution Structure Of Acyl Coa Binding Protein From Babesia Bovis T2bo Length = 96 | Back alignment and structure |
| >pdb|1ST7|A Chain A, Solution Structure Of Acyl Coenzyme A Binding Protein From Yeast Length = 86 | Back alignment and structure |
| >pdb|4ED5|A Chain A, Crystal Structure Of The Two N-Terminal Rrm Domains Of Hur Complexed With Rna Length = 177 | Back alignment and structure |
| >pdb|4EGL|A Chain A, Crystal Structure Of Two Tandem Rna Recognition Motifs Of Human Antigen R Length = 177 | Back alignment and structure |
| >pdb|2CQG|A Chain A, Solution Structure Of The Rna Binding Domain Of Tar Dna- Binding Protein-43 Length = 103 | Back alignment and structure |
| >pdb|2XSF|A Chain A, Crystal Structure Of The Rrm Domain Of Mouse Deleted In Azoospermia-Like Length = 89 | Back alignment and structure |
| >pdb|2XS5|A Chain A, Crystal Structure Of The Rrm Domain Of Mouse Deleted In Azoospermia-Like In Complex With Mvh Rna, Uguuc Length = 87 | Back alignment and structure |
| >pdb|2XS2|A Chain A, Crystal Structure Of The Rrm Domain Of Mouse Deleted In Azoospermia-Like In Complex With Rna, Uuguucuu Length = 102 | Back alignment and structure |
| >pdb|2FJ9|A Chain A, High Resolution Crystal Structure Of The Unliganded Human Acbp Length = 86 | Back alignment and structure |
| >pdb|2XZT|G Chain G, Caspase-3 In Complex With Darpin-3.4_i78s Length = 136 | Back alignment and structure |
| >pdb|2CB8|A Chain A, High Resolution Crystal Structure Of Liganded Human L-Acbp Length = 87 | Back alignment and structure |
| >pdb|2LEA|A Chain A, Solution Structure Of Human Srsf2 (Sc35) Rrm Length = 135 | Back alignment and structure |
| >pdb|2E5H|A Chain A, Solution Structure Of Rna Binding Domain In Zinc Finger Cchc-Type And Rna Binding Motif 1 Length = 94 | Back alignment and structure |
| >pdb|1D9A|A Chain A, Solution Structure Of The Second Rna-Binding Domain (Rbd2) Of Hu Antigen C (Huc) Length = 85 | Back alignment and structure |
| >pdb|2KI2|A Chain A, Solution Structure Of Ss-Dna Binding Protein 12rnp2 Precursor, Hp0827(O25501_helpy) Form Helicobacter Pylori Length = 90 | Back alignment and structure |
| >pdb|2XEH|A Chain A, Structural Determinants For Improved Thermal Stability Of Designed Ankyrin Repeat Proteins With A Redesigned C- Capping Module. Length = 157 | Back alignment and structure |
| >pdb|1X5S|A Chain A, Solution Structure Of Rrm Domain In A18 Hnrnp Length = 102 | Back alignment and structure |
| >pdb|2XEE|A Chain A, Structural Determinants For Improved Thermal Stability Of Designed Ankyrin Repeat Proteins With A Redesigned C- Capping Module. Length = 157 | Back alignment and structure |
| >pdb|3ZUV|B Chain B, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Phosphorylated Map Kinase Erk2 Length = 136 | Back alignment and structure |
| >pdb|2QYJ|A Chain A, Crystal Structure Of A Designed Full Consensus Ankyrin Length = 166 | Back alignment and structure |
| >pdb|1WHW|A Chain A, Solution Structure Of The N-Terminal Rna Binding Domain From Hypothetical Protein Bab23448 Length = 99 | Back alignment and structure |
| >pdb|4DUI|A Chain A, Darpin D1 Binding To Tubulin Beta Chain (not In Complex) Length = 169 | Back alignment and structure |
| >pdb|3NOG|D Chain D, Designed Ankyrin Repeat Protein (Darpin) Binders To Acrb: Plasticity Of The Interface Length = 169 | Back alignment and structure |
| >pdb|4GPM|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or264. Length = 169 | Back alignment and structure |
| >pdb|2JRS|A Chain A, Solution Nmr Structure Of Caper Rrm2 Domain. Northeast Structural Genomics Target Hr4730a Length = 108 | Back alignment and structure |
| >pdb|3SXL|A Chain A, Sex-Lethal Rna Recognition Domains 1 And 2 From Drosophila Melanogaster Length = 184 | Back alignment and structure |
| >pdb|4DRX|E Chain E, Gtp-Tubulin In Complex With A Darpin Length = 169 | Back alignment and structure |
| >pdb|3EPY|A Chain A, Crystal Structure Of Human Acyl-Coa Binding Domain 7 Complexed With Palmitoyl-Coa Length = 89 | Back alignment and structure |
| >pdb|1SXL|A Chain A, Resonance Assignments And Solution Structure Of The Second Rna-Binding Domain Of Sex-Lethal Determined By Multidimensional Heteronuclear Magnetic Resonance Spectroscopy Length = 97 | Back alignment and structure |
| >pdb|3FP5|A Chain A, Crystal Structure Of Acbp From Moniliophthora Perniciosa Length = 106 | Back alignment and structure |
| >pdb|3B7B|A Chain A, Euhmt1 (Glp) Ankyrin Repeat Domain (Structure 1) Length = 237 | Back alignment and structure |
| >pdb|4HB5|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or267. Length = 169 | Back alignment and structure |
| >pdb|2DNZ|A Chain A, Solution Structure Of The Second Rna Binding Domain Of Rna Binding Motif Protein 23 Length = 95 | Back alignment and structure |
| >pdb|2ERR|A Chain A, Nmr Structure Of The Rna Binding Domain Of Human Fox-1 In Complex With Ugcaugu Length = 109 | Back alignment and structure |
| >pdb|1N0R|A Chain A, 4ank: A Designed Ankyrin Repeat Protein With Four Identical Consensus Repeats Length = 126 | Back alignment and structure |
| >pdb|3NOC|D Chain D, Designed Ankyrin Repeat Protein (Darpin) Binders To Acrb: Plasticity Of The Interface Length = 169 | Back alignment and structure |
| >pdb|2DGQ|A Chain A, Solution Structure Of The N-Terminal Rna Binding Domain In Bruno-Like 6 Rna-Binding Protein Length = 108 | Back alignment and structure |
| >pdb|2DGP|A Chain A, Solution Structure Of The N-Terminal Rna Binding Domain In Bruno-Like 4 Rna-Binding Protein Length = 106 | Back alignment and structure |
| >pdb|3UCG|A Chain A, Crystal Structure Of A Rna Binding Domain Of Hypothetical Polyadenylate-Binding Protein (Pabpn1) From Homo Sapiens At 1.95 A Resolution Length = 89 | Back alignment and structure |
| >pdb|3B4D|A Chain A, Crystal Structure Of Human Pabpn1 Rrm Length = 96 | Back alignment and structure |
| >pdb|2CQ3|A Chain A, Solution Structure Of Rna Binding Domain In Rna Binding Motif Protein 9 Length = 103 | Back alignment and structure |
| >pdb|1B7F|A Chain A, Sxl-Lethal ProteinRNA COMPLEX Length = 168 | Back alignment and structure |
| >pdb|2V4H|C Chain C, Nemo Cc2-Lz Domain - 1d5 Darpin Complex Length = 136 | Back alignment and structure |
| >pdb|2JWN|A Chain A, Solution Nmr Structure Of The Protease-Resistent Domain Of Xenopus Laevis Epabp2 Length = 124 | Back alignment and structure |
| >pdb|2CPH|A Chain A, Solution Structure Of The C-Terminal Rna Recognition Motif Of Hypothetical Rna-Binding Protein Rbm19 Length = 107 | Back alignment and structure |
| >pdb|1N0Q|A Chain A, 3ank: A Designed Ankyrin Repeat Protein With Three Identical Consensus Repeats Length = 93 | Back alignment and structure |
| >pdb|3Q9U|C Chain C, In Silico And In Vitro Co-Evolution Of A High Affinity Complementary Protein-Protein Interface Length = 158 | Back alignment and structure |
| >pdb|2DH7|A Chain A, Solution Structure Of The Second Rna Binding Domain In Nucleolysin Tiar Length = 105 | Back alignment and structure |
| >pdb|1MJ0|A Chain A, Sank E3_5: An Artificial Ankyrin Repeat Protein Length = 166 | Back alignment and structure |
| >pdb|3NMR|A Chain A, Crystal Structure Of Cugbp1 Rrm12-Rna Complex Length = 175 | Back alignment and structure |
| >pdb|4ATZ|D Chain D, Ad5 Knob In Complex With A Designed Ankyrin Repeat Protein Length = 154 | Back alignment and structure |
| >pdb|3F6Q|A Chain A, Crystal Structure Of Integrin-Linked Kinase Ankyrin Repeat Domain In Complex With Pinch1 Lim1 Domain Length = 179 | Back alignment and structure |
| >pdb|2DHS|A Chain A, Solution Structure Of Nucleic Acid Binding Protein Cugbp1ab And Its Binding Study With Dna And Rna Length = 187 | Back alignment and structure |
| >pdb|3NNC|A Chain A, Crystal Structure Of Cugbp1 Rrm12-Rna Complex Length = 175 | Back alignment and structure |
| >pdb|2KBX|A Chain A, Solution Structure Of Ilk-Pinch Complex Length = 171 | Back alignment and structure |
| >pdb|2DGO|A Chain A, Solution Structure Of The Rna Binding Domain In Cytotoxic Granule-Associated Rna Binding Protein 1 Length = 115 | Back alignment and structure |
| >pdb|4GMR|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or266. Length = 169 | Back alignment and structure |
| >pdb|3EHQ|A Chain A, Crystal Structure Of Human Osteoclast Stimulating Factor Length = 222 | Back alignment and structure |
| >pdb|1U6F|A Chain A, Nmr Solution Structure Of Tcubp1, A Single Rbd-Unit From Trypanosoma Cruzi Length = 139 | Back alignment and structure |
| >pdb|1WTB|A Chain A, Complex Structure Of The C-Terminal Rna-Binding Domain Of Hnrnp D (Auf1) With Telomere Dna Length = 79 | Back alignment and structure |
| >pdb|3ZU7|B Chain B, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Map Kinase Erk2 Length = 169 | Back alignment and structure |
| >pdb|2J8S|D Chain D, Drug Export Pathway Of Multidrug Exporter Acrb Revealed By Darpin Inhibitors Length = 169 | Back alignment and structure |
| >pdb|2KHC|A Chain A, Bruno Rrm3+ Length = 118 | Back alignment and structure |
| >pdb|2P2C|P Chain P, Inhibition Of Caspase-2 By A Designed Ankyrin Repeat Protein (Darpin) Length = 169 | Back alignment and structure |
| >pdb|2XNR|A Chain A, Structural Insights Into Cis Element Recognition Of Non- Polyadenylated Rnas By The Nab3-Rrm Length = 97 | Back alignment and structure |
| >pdb|2XNQ|A Chain A, Structural Insights Into Cis Element Recognition Of Non- Polyadenylated Rnas By The Nab3-Rrm Length = 97 | Back alignment and structure |
| >pdb|3NNH|A Chain A, Crystal Structure Of The Cugbp1 Rrm1 With Guuguuuuguuu Rna Length = 88 | Back alignment and structure |
| >pdb|3SDE|B Chain B, Crystal Structure Of A Paraspeckle-Protein Heterodimer, Pspc1NONO Length = 261 | Back alignment and structure |
| >pdb|2KM8|B Chain B, Interdomain Rrm Packing Contributes To Rna Recognition In The Rna15, Hrp1, Anchor Rna 3' Processing Ternary Complex Length = 84 | Back alignment and structure |
| >pdb|1MX4|A Chain A, Structure Of P18ink4c (F82q) Length = 168 | Back alignment and structure |
| >pdb|2X1F|A Chain A, Structure Of Rna15 Rrm With Bound Rna (Gu) Length = 96 | Back alignment and structure |
| >pdb|2X1A|A Chain A, Structure Of Rna15 Rrm With Rna Bound (G) Length = 97 | Back alignment and structure |
| >pdb|1IQT|A Chain A, Solution Structure Of The C-Terminal Rna-Binding Domain Of Heterogeneous Nuclear Ribonucleoprotein D0 (Auf1) Length = 75 | Back alignment and structure |
| >pdb|2QFJ|A Chain A, Crystal Structure Of First Two Rrm Domains Of Fir Bound To Ssdna From A Portion Of Fuse Length = 216 | Back alignment and structure |
| >pdb|2D9P|A Chain A, Solution Structure Of Rna Binding Domain 4 In Polyadenylation Binding Protein 3 Length = 103 | Back alignment and structure |
| >pdb|4F6R|D Chain D, Tubulin:stathmin-Like Domain Complex Length = 169 | Back alignment and structure |
| >pdb|2L41|A Chain A, Nab3 Rrm - Ucuu Complex Length = 77 | Back alignment and structure |
| >pdb|2KVI|A Chain A, Structure Of Nab3 Rrm Length = 96 | Back alignment and structure |
| >pdb|2CPZ|A Chain A, Solution Structure Of Rna Binding Domain 3 In Cug Triplet Repeat Rna-Binding Protein 1 Length = 115 | Back alignment and structure |
| >pdb|1MX6|A Chain A, Structure Of P18ink4c (F92n) Length = 168 | Back alignment and structure |
| >pdb|1YCS|B Chain B, P53-53bp2 Complex Length = 239 | Back alignment and structure |
| >pdb|4A63|B Chain B, Crystal Structure Of The P73-Aspp2 Complex At 2.6a Resolution Length = 239 | Back alignment and structure |
| >pdb|2RRB|A Chain A, Refinement Of Rna Binding Domain In Human Tra2 Beta Protein Length = 96 | Back alignment and structure |
| >pdb|2CPF|A Chain A, Solution Structure Of The Penultimate Rna Recognition Motif Of Hypothetical Rna-Binding Protein Rbm19 Length = 98 | Back alignment and structure |
| >pdb|2I38|A Chain A, Solution Structure Of The Rrm Of Srp20 Length = 150 | Back alignment and structure |
| >pdb|2E5G|A Chain A, Solution Structure Of Rna Binding Domain In Rna Binding Motif Protein 21 Length = 94 | Back alignment and structure |
| >pdb|3UWT|A Chain A, Crystal Structure Of A Rna Binding Domain Of Poly-U Binding Splicing Factor 60kda (Puf60) From Homo Sapiens At 2.50 A Resolution Length = 200 | Back alignment and structure |
| >pdb|2I2Y|A Chain A, Solution Structure Of The Rrm Of Srp20 Bound To The Rna Cauc Length = 150 | Back alignment and structure |
| >pdb|4F25|A Chain A, Crystal Structure Of The Second Rrm Domain Of Human Pabpc1 At Ph 6.0 Length = 115 | Back alignment and structure |
| >pdb|2CQC|A Chain A, Solution Structure Of The Rna Recognition Motif In ArginineSERINE-Rich Splicing Factor 10 Length = 95 | Back alignment and structure |
| >pdb|2RRA|A Chain A, Solution Structure Of Rna Binding Domain In Human Tra2 Beta Protein In Complex With Rna (Gaagaa) Length = 99 | Back alignment and structure |
| >pdb|2KXF|A Chain A, Solution Structure Of The First Two Rrm Domains Of Fbp-Interacting Repressor (Fir) Length = 199 | Back alignment and structure |
| >pdb|4F02|A Chain A, Crystal Structure Of The Pabp-Binding Site Of Eif4g In Complex With Rrm1-2 Of Pabp And Poly(A) Length = 213 | Back alignment and structure |
| >pdb|3V30|A Chain A, Crystal Structure Of The Peptide Bound Complex Of The Ankyrin Repeat Domains Of Human Rfxank Length = 172 | Back alignment and structure |
| >pdb|2KXN|B Chain B, Nmr Structure Of Human Tra2beta1 Rrm In Complex With Aagaac Rna Length = 129 | Back alignment and structure |
| >pdb|1CVJ|A Chain A, X-Ray Crystal Structure Of The Poly(A)-Binding Protein In Complex With Polyadenylate Rna Length = 190 | Back alignment and structure |
| >pdb|3HI9|A Chain A, The X-Ray Crystal Structure Of The First Rna Recognition Motif (Rrm1) Of The Au-Rich Element (Are) Binding Protein Hur At 2.0 Angstrom Resolution Length = 84 | Back alignment and structure |
| >pdb|1IHB|A Chain A, Crystal Structure Of P18-Ink4c(Ink6) Length = 162 | Back alignment and structure |
| >pdb|1BU9|A Chain A, Solution Structure Of P18-Ink4c, 21 Structures Length = 168 | Back alignment and structure |
| >pdb|1MX2|A Chain A, Structure Of F71n Mutant Of P18ink4c Length = 168 | Back alignment and structure |
| >pdb|3UXG|A Chain A, Crystal Structure Of Rfxank Length = 172 | Back alignment and structure |
| >pdb|3MD3|A Chain A, Crystal Structure Of The First Two Rrm Domains Of Yeast Poly Binding Protein (Pub1) Length = 166 | Back alignment and structure |
| >pdb|2K8G|A Chain A, Solution Structure Of Rrm2 Domain Of Pabp1 Length = 95 | Back alignment and structure |
| >pdb|2CPJ|A Chain A, Solution Structure Of The N-Terminal Rna Recognition Motif Of Nono Length = 99 | Back alignment and structure |
| >pdb|2DNQ|A Chain A, Solution Structure Of Rna Binding Domain 1 In Rna-Binding Protein 30 Length = 90 | Back alignment and structure |
| >pdb|1X4A|A Chain A, Solution Structure Of Rrm Domain In Splicing Factor Sf2 Length = 109 | Back alignment and structure |
| >pdb|4GRG|A Chain A, Crystal Structure Of Ige Complexed With E2_79, An Anti-Ige Inhibitor Length = 135 | Back alignment and structure |
| >pdb|3EU9|A Chain A, The Ankyrin Repeat Domain Of Huntingtin Interacting Protein 14 Length = 240 | Back alignment and structure |
| >pdb|1S70|B Chain B, Complex Between Protein Ser/thr Phosphatase-1 (delta) And The Myosin Phosphatase Targeting Subunit 1 (mypt1) Length = 299 | Back alignment and structure |
| >pdb|1D8Z|A Chain A, Solution Structure Of The First Rna-Binding Domain (Rbd1) Of Hu Antigen C (Huc) Length = 89 | Back alignment and structure |
| >pdb|3MD1|A Chain A, Crystal Structure Of The Second Rrm Domain Of Yeast Poly(U)-Binding Protein (Pub1) Length = 83 | Back alignment and structure |
| >pdb|2DO0|A Chain A, Solution Structure Of The Rna Binding Domain Of Heterogeneous Nuclear Ribonucleoprotein M Length = 114 | Back alignment and structure |
| >pdb|2HVZ|A Chain A, Solution Structure Of The Rrm Domain Of Sr Rich Factor 9g8 Length = 101 | Back alignment and structure |
| >pdb|2DNM|A Chain A, Solution Structure Of Rna Binding Domain In Srp46 Splicing Factor Length = 103 | Back alignment and structure |
| >pdb|2DGT|A Chain A, Solution Structure Of The Second Rna Binding Domain In Rna- Binding Protein 30 Length = 92 | Back alignment and structure |
| >pdb|3V2O|A Chain A, Crystal Structure Of The Peptide Bound Complex Of The Ankyrin Repeat Domains Of Human Ankra2 Length = 183 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 347 | |||
| 2dgs_A | 99 | DAZ-associated protein 1; RRM domain, structural g | 8e-29 | |
| 2cqd_A | 116 | RNA-binding region containing protein 1; RNA recog | 2e-28 | |
| 2mss_A | 75 | Protein (musashi1); RNA-binding domain, RNA bindin | 5e-28 | |
| 2cjk_A | 167 | Nuclear polyadenylated RNA-binding protein 4; HRP1 | 6e-28 | |
| 2cjk_A | 167 | Nuclear polyadenylated RNA-binding protein 4; HRP1 | 5e-25 | |
| 1l3k_A | 196 | Heterogeneous nuclear ribonucleoprotein A1; nuclea | 6e-28 | |
| 1l3k_A | 196 | Heterogeneous nuclear ribonucleoprotein A1; nuclea | 3e-26 | |
| 2cqu_A | 116 | Peroxisomal D3,D2-enoyl-COA isomerase; acyl-COA bi | 9e-28 | |
| 1x4b_A | 116 | Heterogeneous nuclear ribonucleoproteins A2/B1; st | 3e-27 | |
| 1iqt_A | 75 | AUF1, heterogeneous nuclear ribonucleoprotein D0; | 3e-27 | |
| 2rs2_A | 109 | Musashi-1, RNA-binding protein musashi homolog 1; | 7e-27 | |
| 2cop_A | 109 | Acyl-coenzyme A binding domain containing 6; acyl | 1e-26 | |
| 1uaw_A | 77 | Mouse-musashi-1; RNP-type structure, RNA binding p | 2e-26 | |
| 2dh8_A | 105 | DAZ-associated protein 1; RRM domain, structural g | 2e-26 | |
| 1hbk_A | 89 | ACBP, acyl-COA binding protein; fatty acid metabol | 3e-26 | |
| 2cqg_A | 103 | TDP-43, TAR DNA-binding protein-43; RNA recognitio | 3e-26 | |
| 3s7r_A | 87 | Heterogeneous nuclear ribonucleoprotein A/B; ferre | 9e-26 | |
| 2lbb_A | 96 | Acyl COA binding protein; protein binding, structu | 1e-25 | |
| 2cb8_A | 87 | Acyl-COA-binding protein; acyl-coenzyme A binding | 1e-25 | |
| 2cq4_A | 114 | RNA binding motif protein 23; RRM domain, structur | 1e-25 | |
| 1st7_A | 86 | ACBP, acyl-COA-binding protein; four helix bundle, | 2e-25 | |
| 2xs2_A | 102 | Deleted in azoospermia-like; RNA binding protein-R | 3e-24 | |
| 3epy_A | 89 | Acyl-COA-binding domain-containing protein 7; acyl | 3e-24 | |
| 1x4h_A | 111 | RNA-binding protein 28; structural genomics, RRM d | 1e-23 | |
| 3fp5_A | 106 | Acyl-COA binding protein; ACBP, cacao disease, fat | 2e-23 | |
| 3flv_A | 119 | Acyl-COA-binding domain-containing protein 5; lipi | 3e-23 | |
| 3ucg_A | 89 | Polyadenylate-binding protein 2; ferredoxin-like, | 3e-23 | |
| 2e5g_A | 94 | U6 snRNA-specific terminal uridylyltransferase 1; | 4e-23 | |
| 1x5s_A | 102 | Cold-inducible RNA-binding protein; structure geno | 6e-23 | |
| 2g4b_A | 172 | Splicing factor U2AF 65 kDa subunit; protein-RNA c | 6e-23 | |
| 2g4b_A | 172 | Splicing factor U2AF 65 kDa subunit; protein-RNA c | 3e-18 | |
| 2jwn_A | 124 | Embryonic polyadenylate-binding protein 2-B; epabp | 9e-23 | |
| 2qfj_A | 216 | FBP-interacting repressor; protein-DNA complex; HE | 2e-22 | |
| 2qfj_A | 216 | FBP-interacting repressor; protein-DNA complex; HE | 3e-21 | |
| 2wh5_A | 106 | Acyl-COA-binding domain-containing protein 4; alte | 2e-22 | |
| 2dgp_A | 106 | Bruno-like 4, RNA binding protein; RRM domain, str | 3e-22 | |
| 1whw_A | 99 | Hypothetical protein riken cDNA 1200009A02; RNA re | 3e-22 | |
| 2e5h_A | 94 | Zinc finger CCHC-type and RNA-binding motif- conta | 4e-22 | |
| 3md1_A | 83 | Nuclear and cytoplasmic polyadenylated RNA-bindin | 4e-22 | |
| 1fxl_A | 167 | Paraneoplastic encephalomyelitis antigen HUD; prot | 5e-22 | |
| 1fxl_A | 167 | Paraneoplastic encephalomyelitis antigen HUD; prot | 2e-18 | |
| 2lea_A | 135 | Serine/arginine-rich splicing factor 2; SR protein | 5e-22 | |
| 1x4e_A | 85 | RNA binding motif, single-stranded interacting pro | 8e-22 | |
| 1wf0_A | 88 | TDP-43, TAR DNA-binding protein-43; structural gen | 1e-21 | |
| 2dnz_A | 95 | Probable RNA-binding protein 23; RNA recognition m | 2e-21 | |
| 1p1t_A | 104 | Cleavage stimulation factor, 64 kDa subunit; RNA r | 3e-21 | |
| 3bs9_A | 87 | Nucleolysin TIA-1 isoform P40; RNA recognition mot | 3e-21 | |
| 2cqc_A | 95 | Arginine/serine-rich splicing factor 10; RNA recog | 4e-21 | |
| 2do4_A | 100 | Squamous cell carcinoma antigen recognized by T- c | 4e-21 | |
| 2yh0_A | 198 | Splicing factor U2AF 65 kDa subunit; PRE-mRNA spli | 5e-21 | |
| 2yh0_A | 198 | Splicing factor U2AF 65 kDa subunit; PRE-mRNA spli | 2e-18 | |
| 1fje_B | 175 | Nucleolin RBD12, protein C23; RNP, RRM, RNA bindin | 5e-21 | |
| 1fje_B | 175 | Nucleolin RBD12, protein C23; RNP, RRM, RNA bindin | 1e-16 | |
| 2ki2_A | 90 | SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA | 6e-21 | |
| 1b7f_A | 168 | Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP | 6e-21 | |
| 1b7f_A | 168 | Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP | 2e-18 | |
| 2kxn_B | 129 | Transformer-2 protein homolog beta; SR protein, RR | 6e-21 | |
| 1u6f_A | 139 | Tcubp1, RNA-binding protein UBP1; trypanosome, mRN | 6e-21 | |
| 2fy1_A | 116 | RNA-binding motif protein, Y chromosome, family 1 | 7e-21 | |
| 2do0_A | 114 | HnRNP M, heterogeneous nuclear ribonucleoprotein M | 8e-21 | |
| 2dgo_A | 115 | Cytotoxic granule-associated RNA binding protein 1 | 9e-21 | |
| 2cqb_A | 102 | Peptidyl-prolyl CIS-trans isomerase E; RNA recogni | 1e-20 | |
| 2khc_A | 118 | Testis-specific RNP-type RNA binding protein; RRM, | 1e-20 | |
| 3mdf_A | 85 | Peptidyl-prolyl CIS-trans isomerase E; RRM domain, | 2e-20 | |
| 2dnm_A | 103 | SRP46 splicing factor; RRM domain, RBD, structural | 2e-20 | |
| 3d2w_A | 89 | TAR DNA-binding protein 43; DP-43 proteinopathy, T | 3e-20 | |
| 2cpz_A | 115 | CUG triplet repeat RNA-binding protein 1; RRM doma | 3e-20 | |
| 2cq0_A | 103 | Eukaryotic translation initiation factor 3 subunit | 3e-20 | |
| 3md3_A | 166 | Nuclear and cytoplasmic polyadenylated RNA-bindin | 3e-20 | |
| 3md3_A | 166 | Nuclear and cytoplasmic polyadenylated RNA-bindin | 2e-14 | |
| 3s8s_A | 110 | Histone-lysine N-methyltransferase SETD1A; chromat | 4e-20 | |
| 2kn4_A | 158 | Immunoglobulin G-binding protein G, splicing FACT | 5e-20 | |
| 2cpf_A | 98 | RNA binding motif protein 19; RNA recognition moti | 6e-20 | |
| 2jrs_A | 108 | RNA-binding protein 39; RNA binding motif of RBM39 | 6e-20 | |
| 3n9u_C | 156 | Cleavage and polyadenylation specificity factor S; | 7e-20 | |
| 2x1f_A | 96 | MRNA 3'-END-processing protein RNA15; transcriptio | 9e-20 | |
| 2ku7_A | 140 | MLL1 PHD3-CYP33 RRM chimeric protein; transcriptio | 1e-19 | |
| 2cq3_A | 103 | RNA-binding protein 9; RRM domain, structural geno | 2e-19 | |
| 2err_A | 109 | Ataxin-2-binding protein 1; protein-RNA complex, R | 3e-19 | |
| 4a8x_A | 88 | RNA-binding protein with serine-rich domain 1; tra | 3e-19 | |
| 3sde_A | 261 | Paraspeckle component 1; RRM, anti parallel right | 4e-19 | |
| 3sde_A | 261 | Paraspeckle component 1; RRM, anti parallel right | 6e-14 | |
| 1fj7_A | 101 | Nucleolin RBD1, protein C23; RNP, RRM, RNA binding | 5e-19 | |
| 3nmr_A | 175 | Cugbp ELAV-like family member 1; RRM, PRE-mRNA spl | 5e-19 | |
| 3nmr_A | 175 | Cugbp ELAV-like family member 1; RRM, PRE-mRNA spl | 2e-18 | |
| 2cph_A | 107 | RNA binding motif protein 19; RNA recognition moti | 7e-19 | |
| 2dng_A | 103 | Eukaryotic translation initiation factor 4H; RRM d | 7e-19 | |
| 3ulh_A | 107 | THO complex subunit 4; nuclear protein, RNA bindin | 7e-19 | |
| 3ex7_B | 126 | RNA-binding protein 8A; protein-RNA complex, mRNA | 1e-18 | |
| 1x5u_A | 105 | Splicing factor 3B subunit 4 (spliceosome associat | 1e-18 | |
| 2d9p_A | 103 | Polyadenylate-binding protein 3; RRM domain, struc | 2e-18 | |
| 1p27_B | 106 | RNA-binding protein 8A; nuclear protein, mRNA spli | 2e-18 | |
| 1x5o_A | 114 | RNA binding motif, single-stranded interacting pro | 2e-18 | |
| 2dgv_A | 92 | HnRNP M, heterogeneous nuclear ribonucleoprotein M | 2e-18 | |
| 2dgt_A | 92 | RNA-binding protein 30; RRM domain, structural gen | 2e-18 | |
| 2kt5_A | 124 | RNA and export factor-binding protein 2; chaperone | 2e-18 | |
| 2ywk_A | 95 | Putative RNA-binding protein 11; RRM-domain, struc | 3e-18 | |
| 1x5t_A | 96 | Splicing factor 3B subunit 4; structure genomics, | 3e-18 | |
| 3smz_A | 284 | Protein raver-1, ribonucleoprotein PTB-binding 1; | 4e-18 | |
| 3smz_A | 284 | Protein raver-1, ribonucleoprotein PTB-binding 1; | 8e-15 | |
| 3smz_A | 284 | Protein raver-1, ribonucleoprotein PTB-binding 1; | 2e-11 | |
| 2la6_A | 99 | RNA-binding protein FUS; structural genomics, nort | 5e-18 | |
| 3p5t_L | 90 | Cleavage and polyadenylation specificity factor S; | 5e-18 | |
| 3q2s_C | 229 | Cleavage and polyadenylation specificity factor S; | 6e-18 | |
| 2hvz_A | 101 | Splicing factor, arginine/serine-rich 7; RRM, RNA | 6e-18 | |
| 2f3j_A | 177 | RNA and export factor binding protein 2; RRM domai | 6e-18 | |
| 1oo0_B | 110 | CG8781-PA, drosophila Y14; RNA recognition motif, | 1e-17 | |
| 2dnq_A | 90 | RNA-binding protein 4B; RRM domain,RBD, structural | 1e-17 | |
| 4f25_A | 115 | Polyadenylate-binding protein 1; RRM fold, transla | 1e-17 | |
| 2dnp_A | 90 | RNA-binding protein 14; RRM domain, RBD, structura | 1e-17 | |
| 1x4a_A | 109 | Splicing factor, arginine/serine-rich 1 (splicing | 3e-17 | |
| 2cpx_A | 115 | Hypothetical protein FLJ11016; RRM domain, structu | 3e-17 | |
| 2dnl_A | 114 | Cytoplasmic polyadenylation element binding protei | 4e-17 | |
| 1fjc_A | 96 | Nucleolin RBD2, protein C23; RNP, RRM, RNA binding | 4e-17 | |
| 2dnh_A | 105 | Bruno-like 5, RNA binding protein; RRM domain, RBD | 4e-17 | |
| 2lkz_A | 95 | RNA-binding protein 5; RRM; NMR {Homo sapiens} Len | 5e-17 | |
| 2cpe_A | 113 | RNA-binding protein EWS; RNA recognition motif, RR | 5e-17 | |
| 2lcw_A | 116 | RNA-binding protein FUS; RRM, nucleic acid binding | 5e-17 | |
| 1wi8_A | 104 | EIF-4B, eukaryotic translation initiation factor 4 | 6e-17 | |
| 2j76_E | 100 | EIF-4B, EIF4B, eukaryotic translation initiation f | 7e-17 | |
| 2cpy_A | 114 | RNA-binding protein 12; RRM domain, structural gen | 7e-17 | |
| 1rk8_A | 165 | CG8781-PA, CG8781-PA protein; mRNA processing, RRM | 9e-17 | |
| 2fc9_A | 101 | NCL protein; structure genomics, RRM_1 domain, str | 1e-16 | |
| 3ehr_A | 222 | Osteoclast-stimulating factor 1; beta barrel, heli | 1e-16 | |
| 3ehr_A | 222 | Osteoclast-stimulating factor 1; beta barrel, heli | 4e-15 | |
| 3ehr_A | 222 | Osteoclast-stimulating factor 1; beta barrel, heli | 1e-11 | |
| 3ehr_A | 222 | Osteoclast-stimulating factor 1; beta barrel, heli | 1e-08 | |
| 3ehr_A | 222 | Osteoclast-stimulating factor 1; beta barrel, heli | 2e-07 | |
| 3ehr_A | 222 | Osteoclast-stimulating factor 1; beta barrel, heli | 3e-06 | |
| 2fc8_A | 102 | NCL protein; structure genomics, RRM_1 domain, str | 1e-16 | |
| 2ghp_A | 292 | U4/U6 snRNA-associated splicing factor PRP24; RNA | 3e-16 | |
| 2ghp_A | 292 | U4/U6 snRNA-associated splicing factor PRP24; RNA | 3e-16 | |
| 2ghp_A | 292 | U4/U6 snRNA-associated splicing factor PRP24; RNA | 9e-16 | |
| 1h2v_Z | 156 | 20 kDa nuclear CAP binding protein; CAP-binding-co | 3e-16 | |
| 4f02_A | 213 | Polyadenylate-binding protein 1; mRNA, eukaryotic | 3e-16 | |
| 4f02_A | 213 | Polyadenylate-binding protein 1; mRNA, eukaryotic | 1e-14 | |
| 1s79_A | 103 | Lupus LA protein; RRM, alpha/beta, RNA binding pro | 5e-16 | |
| 1wel_A | 124 | RNA-binding protein 12; structural genomics, NPPSF | 5e-16 | |
| 2ek1_A | 95 | RNA-binding protein 12; RNA recognition motif, dim | 7e-16 | |
| 2cqh_A | 93 | IGF-II mRNA-binding protein 2 isoform A; RNA recog | 8e-16 | |
| 2cpj_A | 99 | Non-POU domain-containing octamer-binding protein; | 1e-15 | |
| 1wg5_A | 104 | Heterogeneous nuclear ribonucleoprotein H; structu | 1e-15 | |
| 2jvo_A | 108 | Nucleolar protein 3; nucleus, phosphorylation, rib | 2e-15 | |
| 2hzc_A | 87 | Splicing factor U2AF 65 kDa subunit; RNA splicing, | 2e-15 | |
| 2kvi_A | 96 | Nuclear polyadenylated RNA-binding protein 3; RNA- | 2e-15 | |
| 2div_A | 99 | TRNA selenocysteine associated protein; structural | 2e-15 | |
| 3f6q_A | 179 | Integrin-linked protein kinase; ILK, integrin-link | 2e-15 | |
| 3f6q_A | 179 | Integrin-linked protein kinase; ILK, integrin-link | 1e-14 | |
| 3f6q_A | 179 | Integrin-linked protein kinase; ILK, integrin-link | 2e-13 | |
| 3f6q_A | 179 | Integrin-linked protein kinase; ILK, integrin-link | 5e-10 | |
| 3f6q_A | 179 | Integrin-linked protein kinase; ILK, integrin-link | 1e-07 | |
| 1n11_A | 437 | Ankyrin; clathrin, BAND 3, anion exchanger, struct | 3e-15 | |
| 1n11_A | 437 | Ankyrin; clathrin, BAND 3, anion exchanger, struct | 5e-14 | |
| 1n11_A | 437 | Ankyrin; clathrin, BAND 3, anion exchanger, struct | 1e-13 | |
| 1n11_A | 437 | Ankyrin; clathrin, BAND 3, anion exchanger, struct | 1e-13 | |
| 1n11_A | 437 | Ankyrin; clathrin, BAND 3, anion exchanger, struct | 1e-13 | |
| 1n11_A | 437 | Ankyrin; clathrin, BAND 3, anion exchanger, struct | 1e-12 | |
| 1n11_A | 437 | Ankyrin; clathrin, BAND 3, anion exchanger, struct | 1e-12 | |
| 1n11_A | 437 | Ankyrin; clathrin, BAND 3, anion exchanger, struct | 3e-12 | |
| 1n11_A | 437 | Ankyrin; clathrin, BAND 3, anion exchanger, struct | 9e-08 | |
| 2cqp_A | 98 | RNA-binding protein 12; RNA recognition motif, RRM | 3e-15 | |
| 2hgm_A | 126 | HNRPF protein, heterogeneous nuclear ribonucleopro | 3e-15 | |
| 3v30_A | 172 | DNA-binding protein rfxank; structural genomics co | 4e-15 | |
| 3v30_A | 172 | DNA-binding protein rfxank; structural genomics co | 3e-14 | |
| 3v30_A | 172 | DNA-binding protein rfxank; structural genomics co | 1e-11 | |
| 3v30_A | 172 | DNA-binding protein rfxank; structural genomics co | 1e-07 | |
| 2xnq_A | 97 | Nuclear polyadenylated RNA-binding protein 3; tran | 4e-15 | |
| 3v31_A | 167 | Ankyrin repeat family A protein 2; structural geno | 4e-15 | |
| 3v31_A | 167 | Ankyrin repeat family A protein 2; structural geno | 2e-14 | |
| 3v31_A | 167 | Ankyrin repeat family A protein 2; structural geno | 2e-09 | |
| 2fo1_E | 373 | LIN-12 protein; beta-barrel, protein-DNA complex, | 4e-15 | |
| 2fo1_E | 373 | LIN-12 protein; beta-barrel, protein-DNA complex, | 2e-10 | |
| 2fo1_E | 373 | LIN-12 protein; beta-barrel, protein-DNA complex, | 3e-10 | |
| 2fo1_E | 373 | LIN-12 protein; beta-barrel, protein-DNA complex, | 5e-10 | |
| 2fo1_E | 373 | LIN-12 protein; beta-barrel, protein-DNA complex, | 1e-09 | |
| 2fo1_E | 373 | LIN-12 protein; beta-barrel, protein-DNA complex, | 3e-08 | |
| 2fo1_E | 373 | LIN-12 protein; beta-barrel, protein-DNA complex, | 1e-05 | |
| 1n0r_A | 126 | 4ANK, 4 ankyrin repeats; structural protein; 1.50A | 6e-15 | |
| 1n0r_A | 126 | 4ANK, 4 ankyrin repeats; structural protein; 1.50A | 7e-13 | |
| 1n0r_A | 126 | 4ANK, 4 ankyrin repeats; structural protein; 1.50A | 3e-10 | |
| 1n0r_A | 126 | 4ANK, 4 ankyrin repeats; structural protein; 1.50A | 3e-07 | |
| 2i2y_A | 150 | Fusion protein consists of immunoglobin G- binding | 6e-15 | |
| 2dhx_A | 104 | Poly (ADP-ribose) polymerase family, member 10 var | 1e-14 | |
| 3aaa_C | 123 | Myotrophin, protein V-1; actin capping protein, ba | 1e-14 | |
| 3aaa_C | 123 | Myotrophin, protein V-1; actin capping protein, ba | 1e-13 | |
| 3aaa_C | 123 | Myotrophin, protein V-1; actin capping protein, ba | 9e-11 | |
| 3c5r_A | 137 | BARD-1, BRCA1-associated ring domain protein 1; an | 2e-14 | |
| 3c5r_A | 137 | BARD-1, BRCA1-associated ring domain protein 1; an | 3e-13 | |
| 3c5r_A | 137 | BARD-1, BRCA1-associated ring domain protein 1; an | 6e-12 | |
| 1wdy_A | 285 | 2-5A-dependent ribonuclease; hydrolase, RNA-bindin | 2e-14 | |
| 1wdy_A | 285 | 2-5A-dependent ribonuclease; hydrolase, RNA-bindin | 1e-11 | |
| 1wdy_A | 285 | 2-5A-dependent ribonuclease; hydrolase, RNA-bindin | 8e-11 | |
| 1wdy_A | 285 | 2-5A-dependent ribonuclease; hydrolase, RNA-bindin | 1e-09 | |
| 1wdy_A | 285 | 2-5A-dependent ribonuclease; hydrolase, RNA-bindin | 3e-08 | |
| 3hra_A | 201 | Ankyrin repeat family protein; structural protein; | 2e-14 | |
| 3hra_A | 201 | Ankyrin repeat family protein; structural protein; | 1e-12 | |
| 3hra_A | 201 | Ankyrin repeat family protein; structural protein; | 2e-12 | |
| 3hra_A | 201 | Ankyrin repeat family protein; structural protein; | 9e-12 | |
| 3hra_A | 201 | Ankyrin repeat family protein; structural protein; | 5e-04 | |
| 1d9s_A | 136 | Cyclin-dependent kinase 4 inhibitor B; helix-turn- | 2e-14 | |
| 1d9s_A | 136 | Cyclin-dependent kinase 4 inhibitor B; helix-turn- | 4e-13 | |
| 1d9s_A | 136 | Cyclin-dependent kinase 4 inhibitor B; helix-turn- | 9e-08 | |
| 1wf1_A | 110 | RNA-binding protein RALY; structural genomics, RRM | 3e-14 | |
| 2dhg_A | 104 | TRNA selenocysteine associated protein (SECP43); R | 3e-14 | |
| 2vge_A | 229 | RELA-associated inhibitor; iaspp, nucleus, apoptos | 3e-14 | |
| 2vge_A | 229 | RELA-associated inhibitor; iaspp, nucleus, apoptos | 6e-08 | |
| 3ljn_A | 364 | Hypothetical protein; ankyrin, structural genomics | 5e-14 | |
| 3ljn_A | 364 | Hypothetical protein; ankyrin, structural genomics | 2e-13 | |
| 3ljn_A | 364 | Hypothetical protein; ankyrin, structural genomics | 3e-12 | |
| 3ljn_A | 364 | Hypothetical protein; ankyrin, structural genomics | 9e-10 | |
| 3ljn_A | 364 | Hypothetical protein; ankyrin, structural genomics | 2e-09 | |
| 3ljn_A | 364 | Hypothetical protein; ankyrin, structural genomics | 7e-07 | |
| 2dzn_A | 228 | Probable 26S proteasome regulatory subunit P28; an | 7e-14 | |
| 2dzn_A | 228 | Probable 26S proteasome regulatory subunit P28; an | 7e-13 | |
| 2dzn_A | 228 | Probable 26S proteasome regulatory subunit P28; an | 5e-12 | |
| 2dzn_A | 228 | Probable 26S proteasome regulatory subunit P28; an | 3e-11 | |
| 2dzn_A | 228 | Probable 26S proteasome regulatory subunit P28; an | 6e-08 | |
| 3b7b_A | 237 | Euchromatic histone-lysine N-methyltransferase 1; | 9e-14 | |
| 3b7b_A | 237 | Euchromatic histone-lysine N-methyltransferase 1; | 7e-13 | |
| 3b7b_A | 237 | Euchromatic histone-lysine N-methyltransferase 1; | 2e-12 | |
| 3b7b_A | 237 | Euchromatic histone-lysine N-methyltransferase 1; | 1e-11 | |
| 3b7b_A | 237 | Euchromatic histone-lysine N-methyltransferase 1; | 1e-06 | |
| 2dha_A | 123 | FLJ20171 protein; RRM domain, structural genomics, | 1e-13 | |
| 2y1l_E | 169 | Darpin-8.4; hydrolase-inhibitor complex, DEVD darp | 1e-13 | |
| 2y1l_E | 169 | Darpin-8.4; hydrolase-inhibitor complex, DEVD darp | 5e-12 | |
| 2y1l_E | 169 | Darpin-8.4; hydrolase-inhibitor complex, DEVD darp | 4e-09 | |
| 2y1l_E | 169 | Darpin-8.4; hydrolase-inhibitor complex, DEVD darp | 3e-05 | |
| 1ihb_A | 162 | P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit | 2e-13 | |
| 1ihb_A | 162 | P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit | 2e-13 | |
| 1ihb_A | 162 | P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit | 5e-10 | |
| 1ihb_A | 162 | P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit | 6e-09 | |
| 1x4c_A | 108 | Splicing factor, arginine/serine-rich 1; structura | 2e-13 | |
| 2dis_A | 109 | Unnamed protein product; structural genomics, RRM | 2e-13 | |
| 1bi7_B | 156 | P16INK4A, MTS1, multiple tumor suppressor; cyclin | 2e-13 | |
| 1bi7_B | 156 | P16INK4A, MTS1, multiple tumor suppressor; cyclin | 7e-12 | |
| 1bi7_B | 156 | P16INK4A, MTS1, multiple tumor suppressor; cyclin | 1e-11 | |
| 1bi7_B | 156 | P16INK4A, MTS1, multiple tumor suppressor; cyclin | 3e-09 | |
| 3beg_B | 115 | Splicing factor, arginine/serine-rich 1; kinase, S | 2e-13 | |
| 1k1a_A | 241 | B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa | 2e-13 | |
| 1k1a_A | 241 | B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa | 6e-12 | |
| 1k1a_A | 241 | B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa | 8e-12 | |
| 1k1a_A | 241 | B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa | 3e-11 | |
| 1k1a_A | 241 | B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa | 2e-10 | |
| 1k1a_A | 241 | B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa | 2e-09 | |
| 1n0q_A | 93 | 3ANK, 3 ankyrin repeats; structural protein; 1.26A | 3e-13 | |
| 1n0q_A | 93 | 3ANK, 3 ankyrin repeats; structural protein; 1.26A | 2e-11 | |
| 1n0q_A | 93 | 3ANK, 3 ankyrin repeats; structural protein; 1.26A | 9e-08 | |
| 2dnn_A | 109 | RNA-binding protein 12; RRM domain, RBD, structura | 3e-13 | |
| 1awc_B | 153 | Protein (GA binding protein beta 1); complex (tran | 4e-13 | |
| 1awc_B | 153 | Protein (GA binding protein beta 1); complex (tran | 1e-10 | |
| 1awc_B | 153 | Protein (GA binding protein beta 1); complex (tran | 4e-09 | |
| 1awc_B | 153 | Protein (GA binding protein beta 1); complex (tran | 5e-06 | |
| 2dgu_A | 103 | Heterogeneous nuclear ribonucleoprotein Q; RRM dom | 4e-13 | |
| 3lqv_A | 115 | PRE-mRNA branch site protein P14; cysless mutant, | 5e-13 | |
| 2e5j_A | 97 | Methenyltetrahydrofolate synthetase domain contain | 6e-13 | |
| 1ycs_B | 239 | 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres | 6e-13 | |
| 1ycs_B | 239 | 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres | 1e-10 | |
| 1ycs_B | 239 | 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres | 1e-09 | |
| 1ycs_B | 239 | 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres | 4e-08 | |
| 2cqi_A | 103 | Nucleolysin TIAR; RNA recognition motif, RRM, RNA | 6e-13 | |
| 1wg1_A | 88 | KIAA1579 protein, homolog EXC-7; RBD, structural g | 6e-13 | |
| 2l6b_A | 115 | NR1C; ankyrin, consensus, repeat protein, ising mo | 8e-13 | |
| 2l6b_A | 115 | NR1C; ankyrin, consensus, repeat protein, ising mo | 4e-11 | |
| 2l6b_A | 115 | NR1C; ankyrin, consensus, repeat protein, ising mo | 8e-11 | |
| 2e44_A | 96 | Insulin-like growth factor 2 mRNA binding protein | 9e-13 | |
| 2dgw_A | 91 | Probable RNA-binding protein 19; RRM domain, struc | 9e-13 | |
| 3eu9_A | 240 | Huntingtin-interacting protein 14; epigenetics, an | 1e-12 | |
| 3eu9_A | 240 | Huntingtin-interacting protein 14; epigenetics, an | 4e-12 | |
| 3eu9_A | 240 | Huntingtin-interacting protein 14; epigenetics, an | 1e-11 | |
| 3eu9_A | 240 | Huntingtin-interacting protein 14; epigenetics, an | 3e-11 | |
| 3eu9_A | 240 | Huntingtin-interacting protein 14; epigenetics, an | 9e-10 | |
| 3eu9_A | 240 | Huntingtin-interacting protein 14; epigenetics, an | 8e-05 | |
| 2cpd_A | 99 | Apobec-1 stimulating protein; RNA recognition moti | 1e-12 | |
| 1bd8_A | 156 | P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr | 1e-12 | |
| 1bd8_A | 156 | P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr | 2e-12 | |
| 1bd8_A | 156 | P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr | 1e-11 | |
| 1bd8_A | 156 | P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr | 1e-10 | |
| 2rfm_A | 192 | Putative ankyrin repeat protein TV1425; ANK repeat | 1e-12 | |
| 2rfm_A | 192 | Putative ankyrin repeat protein TV1425; ANK repeat | 2e-11 | |
| 2rfm_A | 192 | Putative ankyrin repeat protein TV1425; ANK repeat | 5e-11 | |
| 2rfm_A | 192 | Putative ankyrin repeat protein TV1425; ANK repeat | 2e-04 | |
| 1yyh_A | 253 | HN1;, notch 1, ankyrin domain; ankyrin repeats, ce | 2e-12 | |
| 1yyh_A | 253 | HN1;, notch 1, ankyrin domain; ankyrin repeats, ce | 3e-11 | |
| 1yyh_A | 253 | HN1;, notch 1, ankyrin domain; ankyrin repeats, ce | 1e-10 | |
| 1yyh_A | 253 | HN1;, notch 1, ankyrin domain; ankyrin repeats, ce | 3e-06 | |
| 1yyh_A | 253 | HN1;, notch 1, ankyrin domain; ankyrin repeats, ce | 9e-06 | |
| 3twr_A | 165 | Tankyrase-2; ankyrin repeat, protein-protein inter | 2e-12 | |
| 3twr_A | 165 | Tankyrase-2; ankyrin repeat, protein-protein inter | 3e-12 | |
| 3twr_A | 165 | Tankyrase-2; ankyrin repeat, protein-protein inter | 4e-12 | |
| 3twr_A | 165 | Tankyrase-2; ankyrin repeat, protein-protein inter | 3e-08 | |
| 2jvr_A | 111 | Nucleolar protein 3; RNA recognition motif, nucleu | 3e-12 | |
| 2f8y_A | 223 | Notch homolog 1, translocation-associated (drosoph | 3e-12 | |
| 2f8y_A | 223 | Notch homolog 1, translocation-associated (drosoph | 3e-11 | |
| 2f8y_A | 223 | Notch homolog 1, translocation-associated (drosoph | 6e-11 | |
| 2f8y_A | 223 | Notch homolog 1, translocation-associated (drosoph | 8e-06 | |
| 2jab_A | 136 | H10-2-G3; HER2, darpin, ankyrin repeat protein, me | 4e-12 | |
| 2jab_A | 136 | H10-2-G3; HER2, darpin, ankyrin repeat protein, me | 5e-11 | |
| 2jab_A | 136 | H10-2-G3; HER2, darpin, ankyrin repeat protein, me | 4e-08 | |
| 2jab_A | 136 | H10-2-G3; HER2, darpin, ankyrin repeat protein, me | 2e-04 | |
| 2zgd_A | 110 | 3 repeat synthetic ankyrin; ankyrin repeat, hydrox | 5e-12 | |
| 2zgd_A | 110 | 3 repeat synthetic ankyrin; ankyrin repeat, hydrox | 3e-10 | |
| 2zgd_A | 110 | 3 repeat synthetic ankyrin; ankyrin repeat, hydrox | 4e-05 | |
| 2la4_A | 101 | Nuclear and cytoplasmic polyadenylated RNA-bindin | 5e-12 | |
| 2xai_A | 261 | ASB-9, ankyrin repeat and SOCS box protein 9; tran | 6e-12 | |
| 2xai_A | 261 | ASB-9, ankyrin repeat and SOCS box protein 9; tran | 1e-11 | |
| 2xai_A | 261 | ASB-9, ankyrin repeat and SOCS box protein 9; tran | 4e-11 | |
| 2xai_A | 261 | ASB-9, ankyrin repeat and SOCS box protein 9; tran | 1e-10 | |
| 2xai_A | 261 | ASB-9, ankyrin repeat and SOCS box protein 9; tran | 9e-09 | |
| 2xai_A | 261 | ASB-9, ankyrin repeat and SOCS box protein 9; tran | 2e-08 | |
| 2xai_A | 261 | ASB-9, ankyrin repeat and SOCS box protein 9; tran | 4e-04 | |
| 1x4g_A | 109 | Nucleolysin TIAR; structural genomics, RRM domain, | 6e-12 | |
| 3deo_A | 183 | Signal recognition particle 43 kDa protein; chloro | 8e-12 | |
| 3deo_A | 183 | Signal recognition particle 43 kDa protein; chloro | 2e-11 | |
| 3deo_A | 183 | Signal recognition particle 43 kDa protein; chloro | 6e-08 | |
| 3deo_A | 183 | Signal recognition particle 43 kDa protein; chloro | 2e-05 | |
| 1ikn_D | 236 | Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 | 1e-11 | |
| 1ikn_D | 236 | Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 | 7e-11 | |
| 1ikn_D | 236 | Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 | 4e-09 | |
| 1ikn_D | 236 | Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 | 5e-09 | |
| 1ikn_D | 236 | Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 | 8e-09 | |
| 1ikn_D | 236 | Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 | 9e-06 | |
| 1wez_A | 102 | HnRNP H', FTP-3, heterogeneous nuclear ribonucleop | 1e-11 | |
| 1s70_B | 299 | 130 kDa myosin-binding subunit of smooth muscle my | 2e-11 | |
| 1s70_B | 299 | 130 kDa myosin-binding subunit of smooth muscle my | 8e-11 | |
| 1s70_B | 299 | 130 kDa myosin-binding subunit of smooth muscle my | 3e-10 | |
| 1s70_B | 299 | 130 kDa myosin-binding subunit of smooth muscle my | 2e-08 | |
| 1s70_B | 299 | 130 kDa myosin-binding subunit of smooth muscle my | 8e-06 | |
| 3utm_A | 351 | Tankyrase-1; tankyrase, TNKS, ankryin repeat clust | 2e-11 | |
| 3utm_A | 351 | Tankyrase-1; tankyrase, TNKS, ankryin repeat clust | 1e-10 | |
| 3utm_A | 351 | Tankyrase-1; tankyrase, TNKS, ankryin repeat clust | 1e-10 | |
| 3utm_A | 351 | Tankyrase-1; tankyrase, TNKS, ankryin repeat clust | 2e-08 | |
| 3utm_A | 351 | Tankyrase-1; tankyrase, TNKS, ankryin repeat clust | 6e-08 | |
| 3utm_A | 351 | Tankyrase-1; tankyrase, TNKS, ankryin repeat clust | 3e-06 | |
| 2hgn_A | 139 | Heterogeneous nuclear ribonucleoprotein F; RNA rec | 2e-11 | |
| 3t8k_A | 186 | Uncharacterized protein; structural genomics, PSI- | 2e-11 | |
| 3t8k_A | 186 | Uncharacterized protein; structural genomics, PSI- | 3e-08 | |
| 3t8k_A | 186 | Uncharacterized protein; structural genomics, PSI- | 3e-08 | |
| 3t8k_A | 186 | Uncharacterized protein; structural genomics, PSI- | 1e-07 | |
| 2cpi_A | 111 | CCR4-NOT transcription complex subunit 4; RNA reco | 2e-11 | |
| 2aja_A | 376 | Ankyrin repeat family protein; NESG, Q5ZSV0, struc | 2e-11 | |
| 2aja_A | 376 | Ankyrin repeat family protein; NESG, Q5ZSV0, struc | 5e-10 | |
| 2aja_A | 376 | Ankyrin repeat family protein; NESG, Q5ZSV0, struc | 2e-06 | |
| 2aja_A | 376 | Ankyrin repeat family protein; NESG, Q5ZSV0, struc | 3e-04 | |
| 3pgw_S | 437 | U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM | 2e-11 | |
| 3d9h_A | 285 | CDNA FLJ77766, highly similar to HOMO sapiens anky | 2e-11 | |
| 3d9h_A | 285 | CDNA FLJ77766, highly similar to HOMO sapiens anky | 5e-11 | |
| 3d9h_A | 285 | CDNA FLJ77766, highly similar to HOMO sapiens anky | 3e-10 | |
| 3d9h_A | 285 | CDNA FLJ77766, highly similar to HOMO sapiens anky | 1e-09 | |
| 3d9h_A | 285 | CDNA FLJ77766, highly similar to HOMO sapiens anky | 5e-09 | |
| 3d9h_A | 285 | CDNA FLJ77766, highly similar to HOMO sapiens anky | 2e-04 | |
| 2db1_A | 118 | Heterogeneous nuclear ribonucleoprotein F; RRM dom | 2e-11 | |
| 3tyt_A | 205 | Heterogeneous nuclear ribonucleoprotein L; ferredo | 2e-11 | |
| 3tyt_A | 205 | Heterogeneous nuclear ribonucleoprotein L; ferredo | 4e-07 | |
| 1nu4_A | 97 | U1A RNA binding domain; RNA recognition motif, U1 | 3e-11 | |
| 3egn_A | 143 | RNA-binding protein 40; RNA recognition motif (RRM | 4e-11 | |
| 3kea_A | 285 | K1L; tropism, ANK repeat, viral protein; 2.30A {Va | 4e-11 | |
| 3kea_A | 285 | K1L; tropism, ANK repeat, viral protein; 2.30A {Va | 4e-11 | |
| 3kea_A | 285 | K1L; tropism, ANK repeat, viral protein; 2.30A {Va | 5e-10 | |
| 3kea_A | 285 | K1L; tropism, ANK repeat, viral protein; 2.30A {Va | 2e-06 | |
| 3pgw_A | 282 | U1-A; protein-RNA complex, U1 snRNA, SM fold, SM c | 5e-11 | |
| 3pgw_A | 282 | U1-A; protein-RNA complex, U1 snRNA, SM fold, SM c | 9e-06 | |
| 3ns6_A | 100 | Eukaryotic translation initiation factor 3 subuni; | 5e-11 | |
| 1why_A | 97 | Hypothetical protein riken cDNA 1810017N16; RNA re | 6e-11 | |
| 3ui2_A | 244 | Signal recognition particle 43 kDa protein, chlor; | 7e-11 | |
| 3ui2_A | 244 | Signal recognition particle 43 kDa protein, chlor; | 8e-11 | |
| 3ui2_A | 244 | Signal recognition particle 43 kDa protein, chlor; | 2e-07 | |
| 3ui2_A | 244 | Signal recognition particle 43 kDa protein, chlor; | 1e-06 | |
| 2ytc_A | 85 | PRE-mRNA-splicing factor RBM22; RRM domain, RBD, s | 8e-11 | |
| 2nlw_A | 105 | Eukaryotic translation initiation factor 3 subunit | 2e-10 | |
| 1oy3_D | 282 | Transcription factor inhibitor I-kappa-B-beta; pro | 2e-10 | |
| 1oy3_D | 282 | Transcription factor inhibitor I-kappa-B-beta; pro | 2e-10 | |
| 1oy3_D | 282 | Transcription factor inhibitor I-kappa-B-beta; pro | 1e-09 | |
| 1oy3_D | 282 | Transcription factor inhibitor I-kappa-B-beta; pro | 3e-09 | |
| 1oy3_D | 282 | Transcription factor inhibitor I-kappa-B-beta; pro | 5e-08 | |
| 1oy3_D | 282 | Transcription factor inhibitor I-kappa-B-beta; pro | 4e-07 | |
| 2hgl_A | 136 | HNRPF protein, heterogeneous nuclear ribonucleopro | 2e-10 | |
| 2lmi_A | 107 | GRSF-1, G-rich sequence factor 1; G-rich RNA seque | 2e-10 | |
| 2bz2_A | 121 | Negative elongation factor E; NELF E, RNA recognit | 3e-10 | |
| 1x5p_A | 97 | Negative elongation factor E; structure genomics, | 5e-10 | |
| 2adc_A | 229 | Polypyrimidine tract-binding protein 1; RBD, RRM, | 9e-10 | |
| 2adc_A | 229 | Polypyrimidine tract-binding protein 1; RBD, RRM, | 2e-09 | |
| 1wex_A | 104 | Hypothetical protein (riken cDNA 2810036L13); stru | 9e-10 | |
| 2voo_A | 193 | Lupus LA protein; RNA-binding protein, RNA recogni | 9e-10 | |
| 2etb_A | 256 | Transient receptor potential cation channel subfam | 1e-09 | |
| 2etb_A | 256 | Transient receptor potential cation channel subfam | 2e-07 | |
| 2etb_A | 256 | Transient receptor potential cation channel subfam | 1e-06 | |
| 2etb_A | 256 | Transient receptor potential cation channel subfam | 1e-06 | |
| 2etb_A | 256 | Transient receptor potential cation channel subfam | 2e-05 | |
| 3r27_A | 100 | HnRNP L, heterogeneous nuclear ribonucleoprotein L | 1e-09 | |
| 1sw6_A | 327 | Regulatory protein SWI6; transcription regulation, | 1e-09 | |
| 1sw6_A | 327 | Regulatory protein SWI6; transcription regulation, | 4e-09 | |
| 1sw6_A | 327 | Regulatory protein SWI6; transcription regulation, | 6e-05 | |
| 3aji_A | 231 | 26S proteasome non-ATPase regulatory subunit 10; g | 1e-09 | |
| 3aji_A | 231 | 26S proteasome non-ATPase regulatory subunit 10; g | 4e-08 | |
| 3aji_A | 231 | 26S proteasome non-ATPase regulatory subunit 10; g | 3e-07 | |
| 2a3j_A | 127 | U1 small nuclear ribonucleoprotein A; computationa | 1e-09 | |
| 1qm9_A | 198 | Polypyrimidine tract-binding protein; ribonucleopr | 2e-09 | |
| 1qm9_A | 198 | Polypyrimidine tract-binding protein; ribonucleopr | 5e-09 | |
| 2pnn_A | 273 | Transient receptor potential cation channel subfa | 2e-09 | |
| 2pnn_A | 273 | Transient receptor potential cation channel subfa | 3e-05 | |
| 2pnn_A | 273 | Transient receptor potential cation channel subfa | 3e-05 | |
| 2ad9_A | 119 | Polypyrimidine tract-binding protein 1; RBD, RRM, | 4e-09 | |
| 1sjq_A | 105 | Polypyrimidine tract-binding protein 1; babbab mot | 6e-09 | |
| 1whx_A | 111 | Hypothetical protein riken cDNA 1200009A02; RNA re | 7e-09 | |
| 2krb_A | 81 | Eukaryotic translation initiation factor 3 subunit | 1e-08 | |
| 2cq1_A | 101 | PTB-like protein L; RRM domain, structural genomic | 2e-08 | |
| 2rfa_A | 232 | Transient receptor potential cation channel subfa | 3e-08 | |
| 2rfa_A | 232 | Transient receptor potential cation channel subfa | 4e-07 | |
| 2rfa_A | 232 | Transient receptor potential cation channel subfa | 1e-05 | |
| 2rfa_A | 232 | Transient receptor potential cation channel subfa | 1e-05 | |
| 2rfa_A | 232 | Transient receptor potential cation channel subfa | 2e-05 | |
| 2b0o_E | 301 | UPLC1; arfgap, structural genomics, structural gen | 5e-08 | |
| 1dcq_A | 278 | PYK2-associated protein beta; zinc-binding module, | 1e-07 | |
| 1dcq_A | 278 | PYK2-associated protein beta; zinc-binding module, | 1e-04 | |
| 3jxi_A | 260 | Vanilloid receptor-related osmotically activated p | 2e-07 | |
| 3jxi_A | 260 | Vanilloid receptor-related osmotically activated p | 6e-05 | |
| 3jxi_A | 260 | Vanilloid receptor-related osmotically activated p | 9e-05 | |
| 3jue_A | 368 | Arfgap with coiled-coil, ANK repeat and PH domain | 2e-07 | |
| 3jue_A | 368 | Arfgap with coiled-coil, ANK repeat and PH domain | 2e-05 | |
| 1x4f_A | 112 | Matrin 3; structural genomics, RRM domain, NPPSFA, | 3e-07 | |
| 2cq2_A | 114 | Hypothetical protein LOC91801; RRM domain, structu | 5e-07 | |
| 1qzv_F | 154 | Plant photosystem I: subunit PSAF; photosynthesis, | 5e-05 | |
| 3lvq_E | 497 | ARF-GAP with SH3 domain, ANK repeat and PH domain | 2e-04 | |
| 1sjr_A | 164 | Polypyrimidine tract-binding protein 1; extended b | 3e-04 | |
| 3zzy_A | 130 | Polypyrimidine tract-binding protein 1; protein bi | 5e-04 |
| >2dgs_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 99 | Back alignment and structure |
|---|
Score = 106 bits (266), Expect = 8e-29
Identities = 23/75 (30%), Positives = 45/75 (60%)
Query: 2 SNSIRQLNKIFVGNLPWTVSHNELKKFFSEYGQIMNASVMFDKNTGLSKGFGFVTFQNKE 61
+S + NKIFVG +P EL+++F ++G + +++D +GFGF+TF++++
Sbjct: 4 GSSGSKSNKIFVGGIPHNCGETELREYFKKFGVVTEVVMIYDAEKQRPRGFGFITFEDEQ 63
Query: 62 AVDKVFSTDSHVLEG 76
+VD+ + H + G
Sbjct: 64 SVDQAVNMHFHDIMG 78
|
| >2cqd_A RNA-binding region containing protein 1; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 116 | Back alignment and structure |
|---|
| >2mss_A Protein (musashi1); RNA-binding domain, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 PDB: 2mst_A Length = 75 | Back alignment and structure |
|---|
| >2cjk_A Nuclear polyadenylated RNA-binding protein 4; HRP1, RNA-binding, RNA processing, mRNA processing, nonsense-mediated mRNA decay, cleavage; NMR {Saccharomyces cerevisiae} PDB: 2km8_C Length = 167 | Back alignment and structure |
|---|
| >2cjk_A Nuclear polyadenylated RNA-binding protein 4; HRP1, RNA-binding, RNA processing, mRNA processing, nonsense-mediated mRNA decay, cleavage; NMR {Saccharomyces cerevisiae} PDB: 2km8_C Length = 167 | Back alignment and structure |
|---|
| >1l3k_A Heterogeneous nuclear ribonucleoprotein A1; nuclear protein hnRNP A1, RNA-recognition motif, RNA- binding, UP1, RNA binding protein; 1.10A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1u1k_A* 1u1l_A* 1u1m_A* 1u1n_A* 1u1o_A 1u1p_A* 1u1q_A 1u1r_A* 1pgz_A* 1ha1_A 1po6_A* 2up1_A* 1up1_A Length = 196 | Back alignment and structure |
|---|
| >1l3k_A Heterogeneous nuclear ribonucleoprotein A1; nuclear protein hnRNP A1, RNA-recognition motif, RNA- binding, UP1, RNA binding protein; 1.10A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1u1k_A* 1u1l_A* 1u1m_A* 1u1n_A* 1u1o_A 1u1p_A* 1u1q_A 1u1r_A* 1pgz_A* 1ha1_A 1po6_A* 2up1_A* 1up1_A Length = 196 | Back alignment and structure |
|---|
| >2cqu_A Peroxisomal D3,D2-enoyl-COA isomerase; acyl-COA binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 116 | Back alignment and structure |
|---|
| >1x4b_A Heterogeneous nuclear ribonucleoproteins A2/B1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 116 | Back alignment and structure |
|---|
| >1iqt_A AUF1, heterogeneous nuclear ribonucleoprotein D0; RNA-binding protein, hnRNP, telomere, DNA-binding protein, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wtb_A 1x0f_A Length = 75 | Back alignment and structure |
|---|
| >2rs2_A Musashi-1, RNA-binding protein musashi homolog 1; protein-RNA complex, RRM, RBD, RNA binding protein- complex; NMR {Mus musculus} Length = 109 | Back alignment and structure |
|---|
| >2cop_A Acyl-coenzyme A binding domain containing 6; acyl COA binding protein, COA binding protein, lipid binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 109 | Back alignment and structure |
|---|
| >1uaw_A Mouse-musashi-1; RNP-type structure, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 Length = 77 | Back alignment and structure |
|---|
| >2dh8_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 105 | Back alignment and structure |
|---|
| >1hbk_A ACBP, acyl-COA binding protein; fatty acid metabolism; HET: COA MYR; 2.0A {Plasmodium falciparum} SCOP: a.11.1.1 Length = 89 | Back alignment and structure |
|---|
| >2cqg_A TDP-43, TAR DNA-binding protein-43; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 | Back alignment and structure |
|---|
| >3s7r_A Heterogeneous nuclear ribonucleoprotein A/B; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 2.15A {Homo sapiens} PDB: 1hd0_A 1hd1_A Length = 87 | Back alignment and structure |
|---|
| >2lbb_A Acyl COA binding protein; protein binding, structural genomi seattle structural genomics center for infectious disease,; NMR {Babesia bovis} Length = 96 | Back alignment and structure |
|---|
| >2cb8_A Acyl-COA-binding protein; acyl-coenzyme A binding protein, fatty acid, acetylation, alternative splicing, lipid-binding, transport; HET: MYA; 1.4A {Homo sapiens} PDB: 2fj9_A 1aca_A* 1hb6_A 1hb8_A 1nti_A 1nvl_A* 2abd_A 2fdq_A Length = 87 | Back alignment and structure |
|---|
| >2cq4_A RNA binding motif protein 23; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 114 | Back alignment and structure |
|---|
| >1st7_A ACBP, acyl-COA-binding protein; four helix bundle, transport protein; NMR {Saccharomyces cerevisiae} Length = 86 | Back alignment and structure |
|---|
| >2xs2_A Deleted in azoospermia-like; RNA binding protein-RNA complex; 1.35A {Mus musculus} PDB: 2xs7_A 2xs5_A 2xsf_A Length = 102 | Back alignment and structure |
|---|
| >3epy_A Acyl-COA-binding domain-containing protein 7; acyl-COA binding protein, fatty acid, lipid metabolism, structural genomics; HET: COA PLM; 2.00A {Homo sapiens} Length = 89 | Back alignment and structure |
|---|
| >1x4h_A RNA-binding protein 28; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Length = 111 | Back alignment and structure |
|---|
| >3fp5_A Acyl-COA binding protein; ACBP, cacao disease, fatty acid metabolism, lipid binding protein; HET: MES; 1.61A {Moniliophthora perniciosa} Length = 106 | Back alignment and structure |
|---|
| >3flv_A Acyl-COA-binding domain-containing protein 5; lipid binding, structural genomics, struct genomics consortium, SGC, lipid-binding, membrane; HET: STE COA; 1.70A {Homo sapiens} Length = 119 | Back alignment and structure |
|---|
| >3ucg_A Polyadenylate-binding protein 2; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative; HET: PGE; 1.95A {Homo sapiens} PDB: 3b4d_A 3b4m_A Length = 89 | Back alignment and structure |
|---|
| >2e5g_A U6 snRNA-specific terminal uridylyltransferase 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 94 | Back alignment and structure |
|---|
| >1x5s_A Cold-inducible RNA-binding protein; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 102 | Back alignment and structure |
|---|
| >2g4b_A Splicing factor U2AF 65 kDa subunit; protein-RNA complex, RNA splicing factor, RNA recognition motif, RNA binding protein/RNA complex; 2.50A {Homo sapiens} PDB: 2u2f_A Length = 172 | Back alignment and structure |
|---|
| >2g4b_A Splicing factor U2AF 65 kDa subunit; protein-RNA complex, RNA splicing factor, RNA recognition motif, RNA binding protein/RNA complex; 2.50A {Homo sapiens} PDB: 2u2f_A Length = 172 | Back alignment and structure |
|---|
| >2jwn_A Embryonic polyadenylate-binding protein 2-B; epabp2, poly(A) binding, structural genomics, protein structure initiative, PSI-2; NMR {Xenopus laevis} Length = 124 | Back alignment and structure |
|---|
| >2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A Length = 216 | Back alignment and structure |
|---|
| >2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A Length = 216 | Back alignment and structure |
|---|
| >2wh5_A Acyl-COA-binding domain-containing protein 4; alternative splicing, fatty acid metabolism, lipid transport, lipid binding protein; HET: STE ST9 COA; 2.60A {Homo sapiens} Length = 106 | Back alignment and structure |
|---|
| >2dgp_A Bruno-like 4, RNA binding protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dgq_A Length = 106 | Back alignment and structure |
|---|
| >1whw_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Length = 99 | Back alignment and structure |
|---|
| >2e5h_A Zinc finger CCHC-type and RNA-binding motif- containing protein 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 94 | Back alignment and structure |
|---|
| >3md1_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RBD, RNP, poly(U) binding, nucleus, RNA-binding, binding protein; 1.60A {Saccharomyces cerevisiae} Length = 83 | Back alignment and structure |
|---|
| >1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A Length = 167 | Back alignment and structure |
|---|
| >1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A Length = 167 | Back alignment and structure |
|---|
| >2lea_A Serine/arginine-rich splicing factor 2; SR protein, RNA binding protein; NMR {Homo sapiens} PDB: 2leb_A 2lec_A Length = 135 | Back alignment and structure |
|---|
| >1x4e_A RNA binding motif, single-stranded interacting protein 2; structural genomics, RRM domain, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 85 | Back alignment and structure |
|---|
| >1wf0_A TDP-43, TAR DNA-binding protein-43; structural genomics, RRM domain, riken structural genomics/proteomics initiative RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 88 | Back alignment and structure |
|---|
| >2dnz_A Probable RNA-binding protein 23; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 95 | Back alignment and structure |
|---|
| >1p1t_A Cleavage stimulation factor, 64 kDa subunit; RNA recognition motif, C-terminal helix, N-terminal helix, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 104 | Back alignment and structure |
|---|
| >3bs9_A Nucleolysin TIA-1 isoform P40; RNA recognition motif, RRM, RNA binding domain, RBD, RNA splicing, apoptosis, phosphoprotein, RNA-binding; 1.95A {Homo sapiens} Length = 87 | Back alignment and structure |
|---|
| >2cqc_A Arginine/serine-rich splicing factor 10; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 95 | Back alignment and structure |
|---|
| >2do4_A Squamous cell carcinoma antigen recognized by T- cells 3; RRM domaim, RDB, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 100 | Back alignment and structure |
|---|
| >2yh0_A Splicing factor U2AF 65 kDa subunit; PRE-mRNA splicing, transcription, RNA binding protein, mRNA processing; NMR {Homo sapiens} PDB: 2yh1_A Length = 198 | Back alignment and structure |
|---|
| >2yh0_A Splicing factor U2AF 65 kDa subunit; PRE-mRNA splicing, transcription, RNA binding protein, mRNA processing; NMR {Homo sapiens} PDB: 2yh1_A Length = 198 | Back alignment and structure |
|---|
| >1fje_B Nucleolin RBD12, protein C23; RNP, RRM, RNA binding domain, RNA-protein complex, nucleolus, structural protein/RNA complex; NMR {Mesocricetus auratus} SCOP: d.58.7.1 d.58.7.1 PDB: 1rkj_A 2krr_A Length = 175 | Back alignment and structure |
|---|
| >1fje_B Nucleolin RBD12, protein C23; RNP, RRM, RNA binding domain, RNA-protein complex, nucleolus, structural protein/RNA complex; NMR {Mesocricetus auratus} SCOP: d.58.7.1 d.58.7.1 PDB: 1rkj_A 2krr_A Length = 175 | Back alignment and structure |
|---|
| >2ki2_A SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA binding proteins, RNA binding protein/SS-DNA binding protein complex; NMR {Helicobacter pylori} Length = 90 | Back alignment and structure |
|---|
| >1b7f_A Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP*GP*UP*UP*UP*UP*UP*UP*UP*U)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A Length = 168 | Back alignment and structure |
|---|
| >1b7f_A Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP*GP*UP*UP*UP*UP*UP*UP*UP*U)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A Length = 168 | Back alignment and structure |
|---|
| >2kxn_B Transformer-2 protein homolog beta; SR protein, RRM, splicing factor, RNA protein complex, SMN, binding protein-RNA complex; NMR {Homo sapiens} PDB: 2rra_A 2rrb_A Length = 129 | Back alignment and structure |
|---|
| >1u6f_A Tcubp1, RNA-binding protein UBP1; trypanosome, mRNA-binding protein, GU-rich RNA, structure; NMR {Trypanosoma cruzi} SCOP: d.58.7.1 Length = 139 | Back alignment and structure |
|---|
| >2fy1_A RNA-binding motif protein, Y chromosome, family 1 member A1; RNA binding protein, structure, protein-RNA complex, RNA stem-loop, structural protein/RNA complex; NMR {Homo sapiens} Length = 116 | Back alignment and structure |
|---|
| >2do0_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RNA recognition motif, RRM, RNA binding domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 114 | Back alignment and structure |
|---|
| >2dgo_A Cytotoxic granule-associated RNA binding protein 1; RRM domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2rne_A 2dh7_A Length = 115 | Back alignment and structure |
|---|
| >2cqb_A Peptidyl-prolyl CIS-trans isomerase E; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 102 | Back alignment and structure |
|---|
| >2khc_A Testis-specific RNP-type RNA binding protein; RRM, RNA recognition motif, bruno; NMR {Drosophila melanogaster} Length = 118 | Back alignment and structure |
|---|
| >3mdf_A Peptidyl-prolyl CIS-trans isomerase E; RRM domain, PHD finger, CYP33, MLL, RNA binding protein, ALT splicing, mRNA processing, mRNA splicing; 1.85A {Homo sapiens} PDB: 2kyx_A 3lpy_A* Length = 85 | Back alignment and structure |
|---|
| >2dnm_A SRP46 splicing factor; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 103 | Back alignment and structure |
|---|
| >3d2w_A TAR DNA-binding protein 43; DP-43 proteinopathy, TDP-43 inclusions, RNA recognition MOTI U, ALS, RRM; HET: DNA; 1.65A {Mus musculus} Length = 89 | Back alignment and structure |
|---|
| >2cpz_A CUG triplet repeat RNA-binding protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2rq4_A 2rqc_A Length = 115 | Back alignment and structure |
|---|
| >2cq0_A Eukaryotic translation initiation factor 3 subunit 4; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 | Back alignment and structure |
|---|
| >3md3_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNP, RBD, poly(U) binding, tandem, acetylation, cytopla nucleus; 2.70A {Saccharomyces cerevisiae} Length = 166 | Back alignment and structure |
|---|
| >3md3_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNP, RBD, poly(U) binding, tandem, acetylation, cytopla nucleus; 2.70A {Saccharomyces cerevisiae} Length = 166 | Back alignment and structure |
|---|
| >3s8s_A Histone-lysine N-methyltransferase SETD1A; chromatin modification, transcription regulation, structural genomics, structural genomics consortium; 1.30A {Homo sapiens} Length = 110 | Back alignment and structure |
|---|
| >2kn4_A Immunoglobulin G-binding protein G, splicing FACT arginine/serine-rich 2, S35, splicing factor SC35,; RRM domain, cell WALL; NMR {Streptococcus SP} Length = 158 | Back alignment and structure |
|---|
| >2cpf_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 98 | Back alignment and structure |
|---|
| >2jrs_A RNA-binding protein 39; RNA binding motif of RBM39_human (caper), RRM2 domain, solution structure, structural genomics, PSI-2; NMR {Homo sapiens} Length = 108 | Back alignment and structure |
|---|
| >3n9u_C Cleavage and polyadenylation specificity factor S; protein-protein complex, coexpression, heterotetramer, mRNA maturation, mRNA cleavage; 1.92A {Homo sapiens} Length = 156 | Back alignment and structure |
|---|
| >2x1f_A MRNA 3'-END-processing protein RNA15; transcription-RNA complex, mRNA processing; 1.60A {Saccharomyces cerevisiae} PDB: 2x1b_A 2x1a_A 2km8_B Length = 96 | Back alignment and structure |
|---|
| >2ku7_A MLL1 PHD3-CYP33 RRM chimeric protein; transcriptional regulation, RRM domain, transcr; NMR {Homo sapiens} Length = 140 | Back alignment and structure |
|---|
| >2cq3_A RNA-binding protein 9; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 | Back alignment and structure |
|---|
| >2err_A Ataxin-2-binding protein 1; protein-RNA complex, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109 | Back alignment and structure |
|---|
| >4a8x_A RNA-binding protein with serine-rich domain 1; transcription, splicing, RNA processing, nonsense mediated D NMD, HDAC, histone deacetylation; 1.90A {Homo sapiens} Length = 88 | Back alignment and structure |
|---|
| >3sde_A Paraspeckle component 1; RRM, anti parallel right handed coiled-coil, NOPS, DBHS, RNA protein, RNA binding; 1.90A {Homo sapiens} PDB: 3sde_B Length = 261 | Back alignment and structure |
|---|
| >3sde_A Paraspeckle component 1; RRM, anti parallel right handed coiled-coil, NOPS, DBHS, RNA protein, RNA binding; 1.90A {Homo sapiens} PDB: 3sde_B Length = 261 | Back alignment and structure |
|---|
| >1fj7_A Nucleolin RBD1, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Length = 101 | Back alignment and structure |
|---|
| >3nmr_A Cugbp ELAV-like family member 1; RRM, PRE-mRNA splicing, RNA binding protein-RNA complex; 1.85A {Homo sapiens} PDB: 3nna_A 3nnc_A 2dhs_A 3nnh_A Length = 175 | Back alignment and structure |
|---|
| >3nmr_A Cugbp ELAV-like family member 1; RRM, PRE-mRNA splicing, RNA binding protein-RNA complex; 1.85A {Homo sapiens} PDB: 3nna_A 3nnc_A 2dhs_A 3nnh_A Length = 175 | Back alignment and structure |
|---|
| >2cph_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 107 | Back alignment and structure |
|---|
| >2dng_A Eukaryotic translation initiation factor 4H; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Length = 103 | Back alignment and structure |
|---|
| >3ulh_A THO complex subunit 4; nuclear protein, RNA binding, structural genomi center for structural genomics, JCSG, protein structure INI PSI-biology; 2.54A {Homo sapiens} PDB: 1no8_A Length = 107 | Back alignment and structure |
|---|
| >3ex7_B RNA-binding protein 8A; protein-RNA complex, mRNA processing, mRNA splicing, mRNA transport, nonsense-mediated mRNA decay, nucleus; HET: ADP; 2.30A {Homo sapiens} PDB: 2j0q_D* Length = 126 | Back alignment and structure |
|---|
| >1x5u_A Splicing factor 3B subunit 4 (spliceosome associated protein 49) (SAP 49) (SF3B50)...; structure genomics,RRM domain,splicing factor 3B; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 105 | Back alignment and structure |
|---|
| >2d9p_A Polyadenylate-binding protein 3; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 103 | Back alignment and structure |
|---|
| >1p27_B RNA-binding protein 8A; nuclear protein, mRNA splicing; 2.00A {Homo sapiens} SCOP: d.58.7.1 Length = 106 | Back alignment and structure |
|---|
| >1x5o_A RNA binding motif, single-stranded interacting protein 1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 114 | Back alignment and structure |
|---|
| >2dgv_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2dh9_A Length = 92 | Back alignment and structure |
|---|
| >2dgt_A RNA-binding protein 30; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 92 | Back alignment and structure |
|---|
| >2kt5_A RNA and export factor-binding protein 2; chaperone, mRNA processing, mRNA splicing, transport, nucleus, RNA-binding, spliceosome, transport; NMR {Mus musculus} Length = 124 | Back alignment and structure |
|---|
| >2ywk_A Putative RNA-binding protein 11; RRM-domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.54A {Homo sapiens} Length = 95 | Back alignment and structure |
|---|
| >1x5t_A Splicing factor 3B subunit 4; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 96 | Back alignment and structure |
|---|
| >3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3h2u_B 3h2v_E Length = 284 | Back alignment and structure |
|---|
| >3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3h2u_B 3h2v_E Length = 284 | Back alignment and structure |
|---|
| >3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3h2u_B 3h2v_E Length = 284 | Back alignment and structure |
|---|
| >2la6_A RNA-binding protein FUS; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, RNA recognition; NMR {Homo sapiens} Length = 99 | Back alignment and structure |
|---|
| >3p5t_L Cleavage and polyadenylation specificity factor S; RRM domain, poly(A) site recognition, RNA, nuclear, RNA BIND protein; 2.70A {Homo sapiens} PDB: 3p6y_C Length = 90 | Back alignment and structure |
|---|
| >3q2s_C Cleavage and polyadenylation specificity factor S; CFIM, CFIM25, CFIM68, CPSF5, CPSF6, CPSF, 3' END processing, processing, cleavage factor; 2.90A {Homo sapiens} PDB: 3q2t_C Length = 229 | Back alignment and structure |
|---|
| >2hvz_A Splicing factor, arginine/serine-rich 7; RRM, RNA binding protein; NMR {Homo sapiens} Length = 101 | Back alignment and structure |
|---|
| >2f3j_A RNA and export factor binding protein 2; RRM domain, RBD domain., transport protein; NMR {Mus musculus} Length = 177 | Back alignment and structure |
|---|
| >1oo0_B CG8781-PA, drosophila Y14; RNA recognition motif, splicing, protein complex, EXON junct complex, signaling protein; 1.85A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 2hyi_B* 2j0s_D* 2xb2_D* Length = 110 | Back alignment and structure |
|---|
| >2dnq_A RNA-binding protein 4B; RRM domain,RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 90 | Back alignment and structure |
|---|
| >4f25_A Polyadenylate-binding protein 1; RRM fold, translation initiation, RNA-binding, EIF4G-binding translation; 1.90A {Homo sapiens} PDB: 4f26_A 2k8g_A Length = 115 | Back alignment and structure |
|---|
| >2dnp_A RNA-binding protein 14; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 90 | Back alignment and structure |
|---|
| >1x4a_A Splicing factor, arginine/serine-rich 1 (splicing factor 2, alternate splicing factor)...; structure genomics, SURP domain, splicing factor SF2; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109 | Back alignment and structure |
|---|
| >2cpx_A Hypothetical protein FLJ11016; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 115 | Back alignment and structure |
|---|
| >2dnl_A Cytoplasmic polyadenylation element binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 114 | Back alignment and structure |
|---|
| >1fjc_A Nucleolin RBD2, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Length = 96 | Back alignment and structure |
|---|
| >2dnh_A Bruno-like 5, RNA binding protein; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dnk_A 2dno_A Length = 105 | Back alignment and structure |
|---|
| >2lkz_A RNA-binding protein 5; RRM; NMR {Homo sapiens} Length = 95 | Back alignment and structure |
|---|
| >2cpe_A RNA-binding protein EWS; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 113 | Back alignment and structure |
|---|
| >2lcw_A RNA-binding protein FUS; RRM, nucleic acid binding protein; NMR {Homo sapiens} Length = 116 | Back alignment and structure |
|---|
| >1wi8_A EIF-4B, eukaryotic translation initiation factor 4B; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 104 | Back alignment and structure |
|---|
| >2j76_E EIF-4B, EIF4B, eukaryotic translation initiation factor 4B; protein biosynthesis, RNA recognition motif, RNA binding domain, RRM, RBD, RNP; NMR {Homo sapiens} Length = 100 | Back alignment and structure |
|---|
| >2cpy_A RNA-binding protein 12; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 114 | Back alignment and structure |
|---|
| >1rk8_A CG8781-PA, CG8781-PA protein; mRNA processing, RRM, RBD, NMD, oskar mRNA localization, translation; 1.90A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 1hl6_A 2x1g_A Length = 165 | Back alignment and structure |
|---|
| >2fc9_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 101 | Back alignment and structure |
|---|
| >3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 | Back alignment and structure |
|---|
| >3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 | Back alignment and structure |
|---|
| >3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 | Back alignment and structure |
|---|
| >3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 | Back alignment and structure |
|---|
| >3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 | Back alignment and structure |
|---|
| >3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 | Back alignment and structure |
|---|
| >2fc8_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 102 | Back alignment and structure |
|---|
| >2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Length = 292 | Back alignment and structure |
|---|
| >2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Length = 292 | Back alignment and structure |
|---|
| >2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Length = 292 | Back alignment and structure |
|---|
| >1h2v_Z 20 kDa nuclear CAP binding protein; CAP-binding-complex, RNP domain, MIF4G domain, RNA maturation, RNA export, nuclear protein, RNA-binding; 2.0A {Homo sapiens} SCOP: d.58.7.1 PDB: 1h2u_X* 1h2t_Z 1n52_B* 1n54_B 3fex_B 3fey_B 1h6k_X Length = 156 | Back alignment and structure |
|---|
| >4f02_A Polyadenylate-binding protein 1; mRNA, eukaryotic initiation factors PAIP1 and PAIP2, translation-RNA complex; 2.00A {Homo sapiens} PDB: 1cvj_A* Length = 213 | Back alignment and structure |
|---|
| >4f02_A Polyadenylate-binding protein 1; mRNA, eukaryotic initiation factors PAIP1 and PAIP2, translation-RNA complex; 2.00A {Homo sapiens} PDB: 1cvj_A* Length = 213 | Back alignment and structure |
|---|
| >1s79_A Lupus LA protein; RRM, alpha/beta, RNA binding protein, translation; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 | Back alignment and structure |
|---|
| >1wel_A RNA-binding protein 12; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 124 | Back alignment and structure |
|---|
| >2ek1_A RNA-binding protein 12; RNA recognition motif, dimer, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.00A {Homo sapiens} PDB: 2ek6_A Length = 95 | Back alignment and structure |
|---|
| >2cqh_A IGF-II mRNA-binding protein 2 isoform A; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 93 | Back alignment and structure |
|---|
| >2cpj_A Non-POU domain-containing octamer-binding protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 99 | Back alignment and structure |
|---|
| >1wg5_A Heterogeneous nuclear ribonucleoprotein H; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 104 | Back alignment and structure |
|---|
| >2jvo_A Nucleolar protein 3; nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding, rRNA processing; NMR {Saccharomyces cerevisiae} PDB: 2osq_A Length = 108 | Back alignment and structure |
|---|
| >2hzc_A Splicing factor U2AF 65 kDa subunit; RNA splicing, RRM, RNA recognition, alternative conformation binding protein; HET: P6G; 1.47A {Homo sapiens} PDB: 1u2f_A Length = 87 | Back alignment and structure |
|---|
| >2kvi_A Nuclear polyadenylated RNA-binding protein 3; RNA-binding motif, RRM, transcription termination, NUC phosphoprotein; NMR {Saccharomyces cerevisiae} Length = 96 | Back alignment and structure |
|---|
| >2div_A TRNA selenocysteine associated protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 99 | Back alignment and structure |
|---|
| >3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 | Back alignment and structure |
|---|
| >3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 | Back alignment and structure |
|---|
| >3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 | Back alignment and structure |
|---|
| >3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 | Back alignment and structure |
|---|
| >3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 | Back alignment and structure |
|---|
| >1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 | Back alignment and structure |
|---|
| >1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 | Back alignment and structure |
|---|
| >1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 | Back alignment and structure |
|---|
| >1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 | Back alignment and structure |
|---|
| >1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 | Back alignment and structure |
|---|
| >1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 | Back alignment and structure |
|---|
| >1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 | Back alignment and structure |
|---|
| >1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 | Back alignment and structure |
|---|
| >1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 | Back alignment and structure |
|---|
| >2cqp_A RNA-binding protein 12; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 98 | Back alignment and structure |
|---|
| >2hgm_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg0_A Length = 126 | Back alignment and structure |
|---|
| >3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 | Back alignment and structure |
|---|
| >3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 | Back alignment and structure |
|---|
| >3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 | Back alignment and structure |
|---|
| >3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 | Back alignment and structure |
|---|
| >2xnq_A Nuclear polyadenylated RNA-binding protein 3; transcription termination, RNA processi recognition, RRM; HET: CAF; 1.30A {Saccharomyces cerevisiae} PDB: 2xnr_A 2l41_A Length = 97 | Back alignment and structure |
|---|
| >3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 | Back alignment and structure |
|---|
| >3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 | Back alignment and structure |
|---|
| >3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 | Back alignment and structure |
|---|
| >2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 | Back alignment and structure |
|---|
| >2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 | Back alignment and structure |
|---|
| >2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 | Back alignment and structure |
|---|
| >2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 | Back alignment and structure |
|---|
| >2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 | Back alignment and structure |
|---|
| >2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 | Back alignment and structure |
|---|
| >2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 | Back alignment and structure |
|---|
| >1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 | Back alignment and structure |
|---|
| >1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 | Back alignment and structure |
|---|
| >1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 | Back alignment and structure |
|---|
| >1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 | Back alignment and structure |
|---|
| >2i2y_A Fusion protein consists of immunoglobin G- binding protein G and splicing factor,...; protein-RNA complex RRM alpha-beta sandwich BETA1-alpha1- BETA2-BETA3-alpha2-BETA4; NMR {Streptococcus SP} PDB: 2i38_A Length = 150 | Back alignment and structure |
|---|
| >2dhx_A Poly (ADP-ribose) polymerase family, member 10 variant; RRM domain, RNA- binding, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 104 | Back alignment and structure |
|---|
| >3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 | Back alignment and structure |
|---|
| >3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 | Back alignment and structure |
|---|
| >3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 | Back alignment and structure |
|---|
| >3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 | Back alignment and structure |
|---|
| >3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 | Back alignment and structure |
|---|
| >3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 | Back alignment and structure |
|---|
| >1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 | Back alignment and structure |
|---|
| >1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 | Back alignment and structure |
|---|
| >1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 | Back alignment and structure |
|---|
| >1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 | Back alignment and structure |
|---|
| >1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 | Back alignment and structure |
|---|
| >3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 | Back alignment and structure |
|---|
| >3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 | Back alignment and structure |
|---|
| >3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 | Back alignment and structure |
|---|
| >3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 | Back alignment and structure |
|---|
| >3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 | Back alignment and structure |
|---|
| >1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 | Back alignment and structure |
|---|
| >1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 | Back alignment and structure |
|---|
| >1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 | Back alignment and structure |
|---|
| >1wf1_A RNA-binding protein RALY; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wf2_A Length = 110 | Back alignment and structure |
|---|
| >2dhg_A TRNA selenocysteine associated protein (SECP43); RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 104 | Back alignment and structure |
|---|
| >2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 | Back alignment and structure |
|---|
| >2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 | Back alignment and structure |
|---|
| >3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 | Back alignment and structure |
|---|
| >3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 | Back alignment and structure |
|---|
| >3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 | Back alignment and structure |
|---|
| >3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 | Back alignment and structure |
|---|
| >3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 | Back alignment and structure |
|---|
| >3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 | Back alignment and structure |
|---|
| >2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 | Back alignment and structure |
|---|
| >2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 | Back alignment and structure |
|---|
| >2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 | Back alignment and structure |
|---|
| >2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 | Back alignment and structure |
|---|
| >2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 | Back alignment and structure |
|---|
| >3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 | Back alignment and structure |
|---|
| >3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 | Back alignment and structure |
|---|
| >3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 | Back alignment and structure |
|---|
| >3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 | Back alignment and structure |
|---|
| >3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 | Back alignment and structure |
|---|
| >2dha_A FLJ20171 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 123 | Back alignment and structure |
|---|
| >2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 | Back alignment and structure |
|---|
| >2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 | Back alignment and structure |
|---|
| >2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 | Back alignment and structure |
|---|
| >2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 | Back alignment and structure |
|---|
| >1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 | Back alignment and structure |
|---|
| >1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 | Back alignment and structure |
|---|
| >1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 | Back alignment and structure |
|---|
| >1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 | Back alignment and structure |
|---|
| >1x4c_A Splicing factor, arginine/serine-rich 1; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Length = 108 | Back alignment and structure |
|---|
| >2dis_A Unnamed protein product; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109 | Back alignment and structure |
|---|
| >1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 | Back alignment and structure |
|---|
| >1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 | Back alignment and structure |
|---|
| >1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 | Back alignment and structure |
|---|
| >1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 | Back alignment and structure |
|---|
| >3beg_B Splicing factor, arginine/serine-rich 1; kinase, SR protein kinase, SR protein, PRE-mRNA splicing, at binding, chromosome partition; HET: SEP ANP; 2.90A {Homo sapiens} SCOP: d.58.7.1 PDB: 2o3d_A 1wg4_A Length = 115 | Back alignment and structure |
|---|
| >1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 | Back alignment and structure |
|---|
| >1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 | Back alignment and structure |
|---|
| >1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 | Back alignment and structure |
|---|
| >1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 | Back alignment and structure |
|---|
| >1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 | Back alignment and structure |
|---|
| >1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 | Back alignment and structure |
|---|
| >1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 | Back alignment and structure |
|---|
| >1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 | Back alignment and structure |
|---|
| >1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 | Back alignment and structure |
|---|
| >2dnn_A RNA-binding protein 12; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 109 | Back alignment and structure |
|---|
| >1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 | Back alignment and structure |
|---|
| >1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 | Back alignment and structure |
|---|
| >1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 | Back alignment and structure |
|---|
| >1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 | Back alignment and structure |
|---|
| >2dgu_A Heterogeneous nuclear ribonucleoprotein Q; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dk2_A Length = 103 | Back alignment and structure |
|---|
| >3lqv_A PRE-mRNA branch site protein P14; cysless mutant, PRE-mRNA splicing, adenine, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: ADE; 2.38A {Homo sapiens} PDB: 2f9d_A 2f9j_A 2fho_B Length = 115 | Back alignment and structure |
|---|
| >2e5j_A Methenyltetrahydrofolate synthetase domain containing; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 97 | Back alignment and structure |
|---|
| >1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 | Back alignment and structure |
|---|
| >1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 | Back alignment and structure |
|---|
| >1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 | Back alignment and structure |
|---|
| >1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 | Back alignment and structure |
|---|
| >2cqi_A Nucleolysin TIAR; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, ST genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 | Back alignment and structure |
|---|
| >1wg1_A KIAA1579 protein, homolog EXC-7; RBD, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wi6_A Length = 88 | Back alignment and structure |
|---|
| >2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 | Back alignment and structure |
|---|
| >2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 | Back alignment and structure |
|---|
| >2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 | Back alignment and structure |
|---|
| >2e44_A Insulin-like growth factor 2 mRNA binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 96 | Back alignment and structure |
|---|
| >2dgw_A Probable RNA-binding protein 19; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 91 | Back alignment and structure |
|---|
| >3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 | Back alignment and structure |
|---|
| >3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 | Back alignment and structure |
|---|
| >3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 | Back alignment and structure |
|---|
| >3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 | Back alignment and structure |
|---|
| >3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 | Back alignment and structure |
|---|
| >3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 | Back alignment and structure |
|---|
| >2cpd_A Apobec-1 stimulating protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 99 | Back alignment and structure |
|---|
| >1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 | Back alignment and structure |
|---|
| >1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 | Back alignment and structure |
|---|
| >1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 | Back alignment and structure |
|---|
| >1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 | Back alignment and structure |
|---|
| >2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 | Back alignment and structure |
|---|
| >2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 | Back alignment and structure |
|---|
| >2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 | Back alignment and structure |
|---|
| >2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 | Back alignment and structure |
|---|
| >1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 | Back alignment and structure |
|---|
| >1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 | Back alignment and structure |
|---|
| >1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 | Back alignment and structure |
|---|
| >1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 | Back alignment and structure |
|---|
| >1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 | Back alignment and structure |
|---|
| >3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 | Back alignment and structure |
|---|
| >3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 | Back alignment and structure |
|---|
| >3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 | Back alignment and structure |
|---|
| >3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 | Back alignment and structure |
|---|
| >2jvr_A Nucleolar protein 3; RNA recognition motif, nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding; NMR {Saccharomyces cerevisiae} PDB: 2osr_A Length = 111 | Back alignment and structure |
|---|
| >2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 | Back alignment and structure |
|---|
| >2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 | Back alignment and structure |
|---|
| >2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 | Back alignment and structure |
|---|
| >2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 | Back alignment and structure |
|---|
| >2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 | Back alignment and structure |
|---|
| >2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 | Back alignment and structure |
|---|
| >2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 | Back alignment and structure |
|---|
| >2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 | Back alignment and structure |
|---|
| >2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 | Back alignment and structure |
|---|
| >2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 | Back alignment and structure |
|---|
| >2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 | Back alignment and structure |
|---|
| >2la4_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNA recognition, stress granules, nucleus, RNA-binding, transcription; NMR {Saccharomyces cerevisiae} Length = 101 | Back alignment and structure |
|---|
| >1x4g_A Nucleolysin TIAR; structural genomics, RRM domain, TIA-1 related protein, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109 | Back alignment and structure |
|---|
| >3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 | Back alignment and structure |
|---|
| >3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 | Back alignment and structure |
|---|
| >3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 | Back alignment and structure |
|---|
| >3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 | Back alignment and structure |
|---|
| >1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 | Back alignment and structure |
|---|
| >1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 | Back alignment and structure |
|---|
| >1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 | Back alignment and structure |
|---|
| >1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 | Back alignment and structure |
|---|
| >1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 | Back alignment and structure |
|---|
| >1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 | Back alignment and structure |
|---|
| >1wez_A HnRNP H', FTP-3, heterogeneous nuclear ribonucleoprotein H'; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 102 | Back alignment and structure |
|---|
| >1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 | Back alignment and structure |
|---|
| >1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 | Back alignment and structure |
|---|
| >1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 | Back alignment and structure |
|---|
| >1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 | Back alignment and structure |
|---|
| >1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 | Back alignment and structure |
|---|
| >3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 | Back alignment and structure |
|---|
| >3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 | Back alignment and structure |
|---|
| >3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 | Back alignment and structure |
|---|
| >3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 | Back alignment and structure |
|---|
| >3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 | Back alignment and structure |
|---|
| >3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 | Back alignment and structure |
|---|
| >2hgn_A Heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg1_A Length = 139 | Back alignment and structure |
|---|
| >3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 | Back alignment and structure |
|---|
| >3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 | Back alignment and structure |
|---|
| >3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 | Back alignment and structure |
|---|
| >3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 | Back alignment and structure |
|---|
| >2cpi_A CCR4-NOT transcription complex subunit 4; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 111 | Back alignment and structure |
|---|
| >2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 | Back alignment and structure |
|---|
| >2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 | Back alignment and structure |
|---|
| >2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 | Back alignment and structure |
|---|
| >2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 | Back alignment and structure |
|---|
| >3pgw_S U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_K 2l5i_A 2l5j_A* Length = 437 | Back alignment and structure |
|---|
| >3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 | Back alignment and structure |
|---|
| >3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 | Back alignment and structure |
|---|
| >3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 | Back alignment and structure |
|---|
| >3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 | Back alignment and structure |
|---|
| >3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 | Back alignment and structure |
|---|
| >3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 | Back alignment and structure |
|---|
| >2db1_A Heterogeneous nuclear ribonucleoprotein F; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 118 | Back alignment and structure |
|---|
| >3tyt_A Heterogeneous nuclear ribonucleoprotein L; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 1.60A {Mus musculus} PDB: 3s01_A 3to8_A Length = 205 | Back alignment and structure |
|---|
| >3tyt_A Heterogeneous nuclear ribonucleoprotein L; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 1.60A {Mus musculus} PDB: 3s01_A 3to8_A Length = 205 | Back alignment and structure |
|---|
| >1nu4_A U1A RNA binding domain; RNA recognition motif, U1 small nuclear ribonucleoprotein, R binding domain, RNA binding protein; HET: MLA; 1.80A {Homo sapiens} SCOP: d.58.7.1 PDB: 1drz_A* 1urn_A 3hhn_B* 3egz_A* 1zzn_A* 1u6b_A* 3cun_A* 3cul_A* 3g8s_A* 3g8t_A* 3g96_A* 3g9c_A* 3irw_P* 3mum_P* 3mur_P* 3mut_P* 3muv_P* 3mxh_P* 3p49_B 3r1h_A* ... Length = 97 | Back alignment and structure |
|---|
| >3egn_A RNA-binding protein 40; RNA recognition motif (RRM), RNP motif, U11/U12-65K protein, DI-snRNP, U1A protein, U2B protein; 2.50A {Homo sapiens} Length = 143 | Back alignment and structure |
|---|
| >3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 | Back alignment and structure |
|---|
| >3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 | Back alignment and structure |
|---|
| >3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 | Back alignment and structure |
|---|
| >3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 | Back alignment and structure |
|---|
| >3pgw_A U1-A; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 1fht_A 2u1a_A 2aym_A 2b0g_A Length = 282 | Back alignment and structure |
|---|
| >3pgw_A U1-A; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 1fht_A 2u1a_A 2aym_A 2b0g_A Length = 282 | Back alignment and structure |
|---|
| >3ns6_A Eukaryotic translation initiation factor 3 subuni; 1.25A {Saccharomyces cerevisiae} PDB: 3ns5_A Length = 100 | Back alignment and structure |
|---|
| >1why_A Hypothetical protein riken cDNA 1810017N16; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Length = 97 | Back alignment and structure |
|---|
| >3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 | Back alignment and structure |
|---|
| >3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 | Back alignment and structure |
|---|
| >3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 | Back alignment and structure |
|---|
| >3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 | Back alignment and structure |
|---|
| >2ytc_A PRE-mRNA-splicing factor RBM22; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 85 | Back alignment and structure |
|---|
| >2nlw_A Eukaryotic translation initiation factor 3 subunit 9; eukaryotic initiation factor 3 complex, RNA recognition motif; NMR {Homo sapiens} Length = 105 | Back alignment and structure |
|---|
| >1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 | Back alignment and structure |
|---|
| >1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 | Back alignment and structure |
|---|
| >1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 | Back alignment and structure |
|---|
| >1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 | Back alignment and structure |
|---|
| >1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 | Back alignment and structure |
|---|
| >1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 | Back alignment and structure |
|---|
| >2hgl_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative, splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kfy_A Length = 136 | Back alignment and structure |
|---|
| >2lmi_A GRSF-1, G-rich sequence factor 1; G-rich RNA sequence binding factor, RNA binding domain, STRU genomics, joint center for structural genomics, JCSG; NMR {Homo sapiens} Length = 107 | Back alignment and structure |
|---|
| >1x5p_A Negative elongation factor E; structure genomics, RRM domain, PARP14, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 97 | Back alignment and structure |
|---|
| >2adc_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 2evz_A Length = 229 | Back alignment and structure |
|---|
| >2adc_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 2evz_A Length = 229 | Back alignment and structure |
|---|
| >1wex_A Hypothetical protein (riken cDNA 2810036L13); structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.58.7.1 Length = 104 | Back alignment and structure |
|---|
| >2voo_A Lupus LA protein; RNA-binding protein, RNA recognition motif, systemic lupus erythematosus, phosphoprotein, RNA maturation; 1.8A {Homo sapiens} SCOP: a.4.5.46 d.58.7.1 PDB: 2von_A 2vod_A 2vop_A 1zh5_A 1yty_A 1s7a_A Length = 193 | Back alignment and structure |
|---|
| >2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 | Back alignment and structure |
|---|
| >2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 | Back alignment and structure |
|---|
| >2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 | Back alignment and structure |
|---|
| >2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 | Back alignment and structure |
|---|
| >2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 | Back alignment and structure |
|---|
| >3r27_A HnRNP L, heterogeneous nuclear ribonucleoprotein L; RBD fold, protein binding, nucleus; 2.04A {Homo sapiens} Length = 100 | Back alignment and structure |
|---|
| >1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 | Back alignment and structure |
|---|
| >1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 | Back alignment and structure |
|---|
| >1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 | Back alignment and structure |
|---|
| >3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 | Back alignment and structure |
|---|
| >3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 | Back alignment and structure |
|---|
| >3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 | Back alignment and structure |
|---|
| >2a3j_A U1 small nuclear ribonucleoprotein A; computationally designed protein, RRM, U1A, RNA binding protein; NMR {Homo sapiens} Length = 127 | Back alignment and structure |
|---|
| >1qm9_A Polypyrimidine tract-binding protein; ribonucleoprotein, RNP, RNA, spicing, translation; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 Length = 198 | Back alignment and structure |
|---|
| >1qm9_A Polypyrimidine tract-binding protein; ribonucleoprotein, RNP, RNA, spicing, translation; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 Length = 198 | Back alignment and structure |
|---|
| >2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 | Back alignment and structure |
|---|
| >2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 | Back alignment and structure |
|---|
| >2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 | Back alignment and structure |
|---|
| >2ad9_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 119 | Back alignment and structure |
|---|
| >1sjq_A Polypyrimidine tract-binding protein 1; babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 105 | Back alignment and structure |
|---|
| >1whx_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Length = 111 | Back alignment and structure |
|---|
| >2krb_A Eukaryotic translation initiation factor 3 subunit B; EIF3, eukaryotic initiation factor, EIF3B, EIF3J; NMR {Homo sapiens} Length = 81 | Back alignment and structure |
|---|
| >2cq1_A PTB-like protein L; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 101 | Back alignment and structure |
|---|
| >2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 | Back alignment and structure |
|---|
| >2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 | Back alignment and structure |
|---|
| >2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 | Back alignment and structure |
|---|
| >2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 | Back alignment and structure |
|---|
| >2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Length = 301 | Back alignment and structure |
|---|
| >1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 | Back alignment and structure |
|---|
| >1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 | Back alignment and structure |
|---|
| >3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 | Back alignment and structure |
|---|
| >3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 | Back alignment and structure |
|---|
| >3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 | Back alignment and structure |
|---|
| >3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} Length = 368 | Back alignment and structure |
|---|
| >3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} Length = 368 | Back alignment and structure |
|---|
| >1x4f_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Length = 112 | Back alignment and structure |
|---|
| >2cq2_A Hypothetical protein LOC91801; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 114 | Back alignment and structure |
|---|
| >1qzv_F Plant photosystem I: subunit PSAF; photosynthesis,plant photosynthetic reaction center, peripheral antenna; HET: CL1 PQN; 4.44A {Pisum sativum} SCOP: i.5.1.1 Length = 154 | Back alignment and structure |
|---|
| >3lvq_E ARF-GAP with SH3 domain, ANK repeat and PH domain containing protein 3, ADP-ribosylation...; GDP, ASAP3, UPLC1, linkers, alternat splicing; HET: GDP; 3.38A {Homo sapiens} PDB: 3lvr_E* Length = 497 | Back alignment and structure |
|---|
| >1sjr_A Polypyrimidine tract-binding protein 1; extended babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2adb_A Length = 164 | Back alignment and structure |
|---|
| >3zzy_A Polypyrimidine tract-binding protein 1; protein binding, peptide binding, RNA recognition motif; 1.40A {Homo sapiens} PDB: 3zzz_A Length = 130 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 347 | |||
| 1l3k_A | 196 | Heterogeneous nuclear ribonucleoprotein A1; nuclea | 99.9 | |
| 4f02_A | 213 | Polyadenylate-binding protein 1; mRNA, eukaryotic | 99.9 | |
| 1fxl_A | 167 | Paraneoplastic encephalomyelitis antigen HUD; prot | 99.89 | |
| 1b7f_A | 168 | Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP | 99.88 | |
| 2cjk_A | 167 | Nuclear polyadenylated RNA-binding protein 4; HRP1 | 99.88 | |
| 3md3_A | 166 | Nuclear and cytoplasmic polyadenylated RNA-bindin | 99.87 | |
| 2qfj_A | 216 | FBP-interacting repressor; protein-DNA complex; HE | 99.87 | |
| 4gpm_A | 169 | Engineered protein OR264; de novo protein, structu | 99.87 | |
| 1n0q_A | 93 | 3ANK, 3 ankyrin repeats; structural protein; 1.26A | 99.86 | |
| 4f25_A | 115 | Polyadenylate-binding protein 1; RRM fold, transla | 99.86 | |
| 1hbk_A | 89 | ACBP, acyl-COA binding protein; fatty acid metabol | 99.86 | |
| 3nmr_A | 175 | Cugbp ELAV-like family member 1; RRM, PRE-mRNA spl | 99.86 | |
| 1st7_A | 86 | ACBP, acyl-COA-binding protein; four helix bundle, | 99.86 | |
| 2lbb_A | 96 | Acyl COA binding protein; protein binding, structu | 99.85 | |
| 2cop_A | 109 | Acyl-coenzyme A binding domain containing 6; acyl | 99.85 | |
| 3epy_A | 89 | Acyl-COA-binding domain-containing protein 7; acyl | 99.85 | |
| 2cb8_A | 87 | Acyl-COA-binding protein; acyl-coenzyme A binding | 99.84 | |
| 4gpm_A | 169 | Engineered protein OR264; de novo protein, structu | 99.84 | |
| 4fxv_A | 99 | ELAV-like protein 1; RNA recognition motif, putati | 99.84 | |
| 2cqu_A | 116 | Peroxisomal D3,D2-enoyl-COA isomerase; acyl-COA bi | 99.84 | |
| 1fje_B | 175 | Nucleolin RBD12, protein C23; RNP, RRM, RNA bindin | 99.83 | |
| 3tyt_A | 205 | Heterogeneous nuclear ribonucleoprotein L; ferredo | 99.82 | |
| 3pgw_A | 282 | U1-A; protein-RNA complex, U1 snRNA, SM fold, SM c | 99.82 | |
| 3smz_A | 284 | Protein raver-1, ribonucleoprotein PTB-binding 1; | 99.82 | |
| 2g4b_A | 172 | Splicing factor U2AF 65 kDa subunit; protein-RNA c | 99.82 | |
| 2lxi_A | 91 | RNA-binding protein 10; NMR {Homo sapiens} | 99.81 | |
| 2wh5_A | 106 | Acyl-COA-binding domain-containing protein 4; alte | 99.8 | |
| 3s8s_A | 110 | Histone-lysine N-methyltransferase SETD1A; chromat | 99.8 | |
| 3fp5_A | 106 | Acyl-COA binding protein; ACBP, cacao disease, fat | 99.8 | |
| 3flv_A | 119 | Acyl-COA-binding domain-containing protein 5; lipi | 99.8 | |
| 2ghp_A | 292 | U4/U6 snRNA-associated splicing factor PRP24; RNA | 99.8 | |
| 2lkz_A | 95 | RNA-binding protein 5; RRM; NMR {Homo sapiens} | 99.8 | |
| 3s7r_A | 87 | Heterogeneous nuclear ribonucleoprotein A/B; ferre | 99.8 | |
| 3sde_A | 261 | Paraspeckle component 1; RRM, anti parallel right | 99.79 | |
| 2jab_A | 136 | H10-2-G3; HER2, darpin, ankyrin repeat protein, me | 99.79 | |
| 1d9s_A | 136 | Cyclin-dependent kinase 4 inhibitor B; helix-turn- | 99.79 | |
| 3aaa_C | 123 | Myotrophin, protein V-1; actin capping protein, ba | 99.79 | |
| 2adc_A | 229 | Polypyrimidine tract-binding protein 1; RBD, RRM, | 99.79 | |
| 2yh0_A | 198 | Splicing factor U2AF 65 kDa subunit; PRE-mRNA spli | 99.79 | |
| 2dgs_A | 99 | DAZ-associated protein 1; RRM domain, structural g | 99.79 | |
| 3c5r_A | 137 | BARD-1, BRCA1-associated ring domain protein 1; an | 99.79 | |
| 2l6b_A | 115 | NR1C; ankyrin, consensus, repeat protein, ising mo | 99.79 | |
| 1d9s_A | 136 | Cyclin-dependent kinase 4 inhibitor B; helix-turn- | 99.78 | |
| 2jrs_A | 108 | RNA-binding protein 39; RNA binding motif of RBM39 | 99.78 | |
| 1s79_A | 103 | Lupus LA protein; RRM, alpha/beta, RNA binding pro | 99.78 | |
| 3f6q_A | 179 | Integrin-linked protein kinase; ILK, integrin-link | 99.78 | |
| 3twr_A | 165 | Tankyrase-2; ankyrin repeat, protein-protein inter | 99.77 | |
| 3md1_A | 83 | Nuclear and cytoplasmic polyadenylated RNA-bindin | 99.77 | |
| 3p5t_L | 90 | Cleavage and polyadenylation specificity factor S; | 99.77 | |
| 1n0r_A | 126 | 4ANK, 4 ankyrin repeats; structural protein; 1.50A | 99.77 | |
| 1ihb_A | 162 | P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit | 99.77 | |
| 2ghp_A | 292 | U4/U6 snRNA-associated splicing factor PRP24; RNA | 99.77 | |
| 2mss_A | 75 | Protein (musashi1); RNA-binding domain, RNA bindin | 99.77 | |
| 3mdf_A | 85 | Peptidyl-prolyl CIS-trans isomerase E; RRM domain, | 99.77 | |
| 2rs2_A | 109 | Musashi-1, RNA-binding protein musashi homolog 1; | 99.77 | |
| 3bs9_A | 87 | Nucleolysin TIA-1 isoform P40; RNA recognition mot | 99.77 | |
| 2dh8_A | 105 | DAZ-associated protein 1; RRM domain, structural g | 99.77 | |
| 1bi7_B | 156 | P16INK4A, MTS1, multiple tumor suppressor; cyclin | 99.77 | |
| 1qm9_A | 198 | Polypyrimidine tract-binding protein; ribonucleopr | 99.77 | |
| 1whw_A | 99 | Hypothetical protein riken cDNA 1200009A02; RNA re | 99.77 | |
| 3smz_A | 284 | Protein raver-1, ribonucleoprotein PTB-binding 1; | 99.76 | |
| 3lqv_A | 115 | PRE-mRNA branch site protein P14; cysless mutant, | 99.76 | |
| 1dcq_A | 278 | PYK2-associated protein beta; zinc-binding module, | 99.76 | |
| 2y1l_E | 169 | Darpin-8.4; hydrolase-inhibitor complex, DEVD darp | 99.76 | |
| 2div_A | 99 | TRNA selenocysteine associated protein; structural | 99.76 | |
| 3ucg_A | 89 | Polyadenylate-binding protein 2; ferredoxin-like, | 99.76 | |
| 2la6_A | 99 | RNA-binding protein FUS; structural genomics, nort | 99.76 | |
| 2dnz_A | 95 | Probable RNA-binding protein 23; RNA recognition m | 99.76 | |
| 1x4h_A | 111 | RNA-binding protein 28; structural genomics, RRM d | 99.76 | |
| 2cqc_A | 95 | Arginine/serine-rich splicing factor 10; RNA recog | 99.76 | |
| 1awc_B | 153 | Protein (GA binding protein beta 1); complex (tran | 99.76 | |
| 1p27_B | 106 | RNA-binding protein 8A; nuclear protein, mRNA spli | 99.76 | |
| 3ns6_A | 100 | Eukaryotic translation initiation factor 3 subuni; | 99.76 | |
| 1x5u_A | 105 | Splicing factor 3B subunit 4 (spliceosome associat | 99.76 | |
| 2dnm_A | 103 | SRP46 splicing factor; RRM domain, RBD, structural | 99.76 | |
| 2x1f_A | 96 | MRNA 3'-END-processing protein RNA15; transcriptio | 99.76 | |
| 2dhg_A | 104 | TRNA selenocysteine associated protein (SECP43); R | 99.76 | |
| 3v30_A | 172 | DNA-binding protein rfxank; structural genomics co | 99.76 | |
| 2jab_A | 136 | H10-2-G3; HER2, darpin, ankyrin repeat protein, me | 99.75 | |
| 2dng_A | 103 | Eukaryotic translation initiation factor 4H; RRM d | 99.75 | |
| 3v31_A | 167 | Ankyrin repeat family A protein 2; structural geno | 99.75 | |
| 2do4_A | 100 | Squamous cell carcinoma antigen recognized by T- c | 99.75 | |
| 4b93_B | 269 | Ankyrin repeat domain-containing protein 27; endoc | 99.75 | |
| 2cq0_A | 103 | Eukaryotic translation initiation factor 3 subunit | 99.75 | |
| 1ihb_A | 162 | P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit | 99.75 | |
| 2cpz_A | 115 | CUG triplet repeat RNA-binding protein 1; RRM doma | 99.75 | |
| 2cqg_A | 103 | TDP-43, TAR DNA-binding protein-43; RNA recognitio | 99.75 | |
| 2zgd_A | 110 | 3 repeat synthetic ankyrin; ankyrin repeat, hydrox | 99.75 | |
| 2dgo_A | 115 | Cytotoxic granule-associated RNA binding protein 1 | 99.75 | |
| 1x5s_A | 102 | Cold-inducible RNA-binding protein; structure geno | 99.75 | |
| 2kxn_B | 129 | Transformer-2 protein homolog beta; SR protein, RR | 99.75 | |
| 2rfm_A | 192 | Putative ankyrin repeat protein TV1425; ANK repeat | 99.75 | |
| 1x5t_A | 96 | Splicing factor 3B subunit 4; structure genomics, | 99.75 | |
| 2cpf_A | 98 | RNA binding motif protein 19; RNA recognition moti | 99.75 | |
| 1iqt_A | 75 | AUF1, heterogeneous nuclear ribonucleoprotein D0; | 99.75 | |
| 1wez_A | 102 | HnRNP H', FTP-3, heterogeneous nuclear ribonucleop | 99.74 | |
| 1x4e_A | 85 | RNA binding motif, single-stranded interacting pro | 99.74 | |
| 3n9u_C | 156 | Cleavage and polyadenylation specificity factor S; | 99.74 | |
| 2e5h_A | 94 | Zinc finger CCHC-type and RNA-binding motif- conta | 99.74 | |
| 1wg5_A | 104 | Heterogeneous nuclear ribonucleoprotein H; structu | 99.74 | |
| 1x4b_A | 116 | Heterogeneous nuclear ribonucleoproteins A2/B1; st | 99.74 | |
| 2d9p_A | 103 | Polyadenylate-binding protein 3; RRM domain, struc | 99.74 | |
| 2y1l_E | 169 | Darpin-8.4; hydrolase-inhibitor complex, DEVD darp | 99.74 | |
| 2j76_E | 100 | EIF-4B, EIF4B, eukaryotic translation initiation f | 99.74 | |
| 3v30_A | 172 | DNA-binding protein rfxank; structural genomics co | 99.74 | |
| 2cqb_A | 102 | Peptidyl-prolyl CIS-trans isomerase E; RNA recogni | 99.74 | |
| 2dgp_A | 106 | Bruno-like 4, RNA binding protein; RRM domain, str | 99.74 | |
| 2ywk_A | 95 | Putative RNA-binding protein 11; RRM-domain, struc | 99.74 | |
| 1p1t_A | 104 | Cleavage stimulation factor, 64 kDa subunit; RNA r | 99.74 | |
| 2dnh_A | 105 | Bruno-like 5, RNA binding protein; RRM domain, RBD | 99.74 | |
| 1sjq_A | 105 | Polypyrimidine tract-binding protein 1; babbab mot | 99.74 | |
| 3twr_A | 165 | Tankyrase-2; ankyrin repeat, protein-protein inter | 99.73 | |
| 1oo0_B | 110 | CG8781-PA, drosophila Y14; RNA recognition motif, | 99.73 | |
| 1bd8_A | 156 | P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr | 99.73 | |
| 2fy1_A | 116 | RNA-binding motif protein, Y chromosome, family 1 | 99.73 | |
| 1oy3_D | 282 | Transcription factor inhibitor I-kappa-B-beta; pro | 99.73 | |
| 2cqd_A | 116 | RNA-binding region containing protein 1; RNA recog | 99.73 | |
| 1ycs_B | 239 | 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres | 99.73 | |
| 2cph_A | 107 | RNA binding motif protein 19; RNA recognition moti | 99.73 | |
| 2dgv_A | 92 | HnRNP M, heterogeneous nuclear ribonucleoprotein M | 99.73 | |
| 1u6f_A | 139 | Tcubp1, RNA-binding protein UBP1; trypanosome, mRN | 99.73 | |
| 1uaw_A | 77 | Mouse-musashi-1; RNP-type structure, RNA binding p | 99.73 | |
| 1wi8_A | 104 | EIF-4B, eukaryotic translation initiation factor 4 | 99.73 | |
| 4a8x_A | 88 | RNA-binding protein with serine-rich domain 1; tra | 99.73 | |
| 1bd8_A | 156 | P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr | 99.73 | |
| 2vge_A | 229 | RELA-associated inhibitor; iaspp, nucleus, apoptos | 99.73 | |
| 2hgl_A | 136 | HNRPF protein, heterogeneous nuclear ribonucleopro | 99.73 | |
| 2ki2_A | 90 | SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA | 99.73 | |
| 3lvq_E | 497 | ARF-GAP with SH3 domain, ANK repeat and PH domain | 99.73 | |
| 2cpy_A | 114 | RNA-binding protein 12; RRM domain, structural gen | 99.73 | |
| 2cpe_A | 113 | RNA-binding protein EWS; RNA recognition motif, RR | 99.73 | |
| 3deo_A | 183 | Signal recognition particle 43 kDa protein; chloro | 99.72 | |
| 2ek1_A | 95 | RNA-binding protein 12; RNA recognition motif, dim | 99.72 | |
| 2dgw_A | 91 | Probable RNA-binding protein 19; RRM domain, struc | 99.72 | |
| 2khc_A | 118 | Testis-specific RNP-type RNA binding protein; RRM, | 99.72 | |
| 2cq4_A | 114 | RNA binding motif protein 23; RRM domain, structur | 99.72 | |
| 3ehr_A | 222 | Osteoclast-stimulating factor 1; beta barrel, heli | 99.72 | |
| 3ulh_A | 107 | THO complex subunit 4; nuclear protein, RNA bindin | 99.72 | |
| 2m2b_A | 131 | RNA-binding protein 10; T-cell, JCSG, MPP, PSI-bio | 99.72 | |
| 2jwn_A | 124 | Embryonic polyadenylate-binding protein 2-B; epabp | 99.72 | |
| 1awc_B | 153 | Protein (GA binding protein beta 1); complex (tran | 99.72 | |
| 2rfm_A | 192 | Putative ankyrin repeat protein TV1425; ANK repeat | 99.72 | |
| 2hvz_A | 101 | Splicing factor, arginine/serine-rich 7; RRM, RNA | 99.72 | |
| 2lmi_A | 107 | GRSF-1, G-rich sequence factor 1; G-rich RNA seque | 99.72 | |
| 2dgx_A | 96 | KIAA0430 protein; RRM domain, structural genomics, | 99.72 | |
| 2db1_A | 118 | Heterogeneous nuclear ribonucleoprotein F; RRM dom | 99.72 | |
| 1n0r_A | 126 | 4ANK, 4 ankyrin repeats; structural protein; 1.50A | 99.72 | |
| 2xs2_A | 102 | Deleted in azoospermia-like; RNA binding protein-R | 99.72 | |
| 2hgm_A | 126 | HNRPF protein, heterogeneous nuclear ribonucleopro | 99.72 | |
| 2cq3_A | 103 | RNA-binding protein 9; RRM domain, structural geno | 99.72 | |
| 2dis_A | 109 | Unnamed protein product; structural genomics, RRM | 99.71 | |
| 2cqp_A | 98 | RNA-binding protein 12; RNA recognition motif, RRM | 99.71 | |
| 3ui2_A | 244 | Signal recognition particle 43 kDa protein, chlor; | 99.71 | |
| 2cqi_A | 103 | Nucleolysin TIAR; RNA recognition motif, RRM, RNA | 99.71 | |
| 2krb_A | 81 | Eukaryotic translation initiation factor 3 subunit | 99.71 | |
| 1bi7_B | 156 | P16INK4A, MTS1, multiple tumor suppressor; cyclin | 99.71 | |
| 4b93_B | 269 | Ankyrin repeat domain-containing protein 27; endoc | 99.71 | |
| 4hbd_A | 276 | KN motif and ankyrin repeat domain-containing Pro; | 99.71 | |
| 3v31_A | 167 | Ankyrin repeat family A protein 2; structural geno | 99.71 | |
| 2lea_A | 135 | Serine/arginine-rich splicing factor 2; SR protein | 99.71 | |
| 2f8y_A | 223 | Notch homolog 1, translocation-associated (drosoph | 99.7 | |
| 2b0o_E | 301 | UPLC1; arfgap, structural genomics, structural gen | 99.7 | |
| 1yyh_A | 253 | HN1;, notch 1, ankyrin domain; ankyrin repeats, ce | 99.7 | |
| 3ex7_B | 126 | RNA-binding protein 8A; protein-RNA complex, mRNA | 99.7 | |
| 1wel_A | 124 | RNA-binding protein 12; structural genomics, NPPSF | 99.7 | |
| 2do0_A | 114 | HnRNP M, heterogeneous nuclear ribonucleoprotein M | 99.7 | |
| 2dzn_A | 228 | Probable 26S proteasome regulatory subunit P28; an | 99.7 | |
| 2vge_A | 229 | RELA-associated inhibitor; iaspp, nucleus, apoptos | 99.7 | |
| 3f6q_A | 179 | Integrin-linked protein kinase; ILK, integrin-link | 99.7 | |
| 2err_A | 109 | Ataxin-2-binding protein 1; protein-RNA complex, R | 99.7 | |
| 1h2v_Z | 156 | 20 kDa nuclear CAP binding protein; CAP-binding-co | 99.69 | |
| 1ikn_D | 236 | Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 | 99.69 | |
| 1fj7_A | 101 | Nucleolin RBD1, protein C23; RNP, RRM, RNA binding | 99.69 | |
| 2ku7_A | 140 | MLL1 PHD3-CYP33 RRM chimeric protein; transcriptio | 99.69 | |
| 3aji_A | 231 | 26S proteasome non-ATPase regulatory subunit 10; g | 99.69 | |
| 2dnn_A | 109 | RNA-binding protein 12; RRM domain, RBD, structura | 99.69 | |
| 3hra_A | 201 | Ankyrin repeat family protein; structural protein; | 99.69 | |
| 2f8y_A | 223 | Notch homolog 1, translocation-associated (drosoph | 99.69 | |
| 2kt5_A | 124 | RNA and export factor-binding protein 2; chaperone | 99.69 | |
| 3utm_A | 351 | Tankyrase-1; tankyrase, TNKS, ankryin repeat clust | 99.69 | |
| 2nlw_A | 105 | Eukaryotic translation initiation factor 3 subunit | 99.69 | |
| 2dha_A | 123 | FLJ20171 protein; RRM domain, structural genomics, | 99.69 | |
| 2wbr_A | 89 | GW182, gawky, LD47780P; DNA-binding protein, RRM, | 99.69 | |
| 1x5o_A | 114 | RNA binding motif, single-stranded interacting pro | 99.69 | |
| 1oy3_D | 282 | Transcription factor inhibitor I-kappa-B-beta; pro | 99.69 | |
| 3ehr_A | 222 | Osteoclast-stimulating factor 1; beta barrel, heli | 99.69 | |
| 2rfa_A | 232 | Transient receptor potential cation channel subfa | 99.69 | |
| 1ikn_D | 236 | Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 | 99.69 | |
| 2cpi_A | 111 | CCR4-NOT transcription complex subunit 4; RNA reco | 99.69 | |
| 3ljn_A | 364 | Hypothetical protein; ankyrin, structural genomics | 99.69 | |
| 2kn4_A | 158 | Immunoglobulin G-binding protein G, splicing FACT | 99.68 | |
| 1ycs_B | 239 | 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres | 99.68 | |
| 2hgn_A | 139 | Heterogeneous nuclear ribonucleoprotein F; RNA rec | 99.68 | |
| 3t8k_A | 186 | Uncharacterized protein; structural genomics, PSI- | 99.68 | |
| 2a3j_A | 127 | U1 small nuclear ribonucleoprotein A; computationa | 99.68 | |
| 1k1a_A | 241 | B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa | 99.68 | |
| 4g8k_A | 337 | 2-5A-dependent ribonuclease; ankyrin-repeat domain | 99.68 | |
| 1x4a_A | 109 | Splicing factor, arginine/serine-rich 1 (splicing | 99.68 | |
| 3kea_A | 285 | K1L; tropism, ANK repeat, viral protein; 2.30A {Va | 99.68 | |
| 3jxi_A | 260 | Vanilloid receptor-related osmotically activated p | 99.68 | |
| 2etb_A | 256 | Transient receptor potential cation channel subfam | 99.68 | |
| 3q2s_C | 229 | Cleavage and polyadenylation specificity factor S; | 99.68 | |
| 2dnq_A | 90 | RNA-binding protein 4B; RRM domain,RBD, structural | 99.68 | |
| 2etb_A | 256 | Transient receptor potential cation channel subfam | 99.68 | |
| 2xai_A | 261 | ASB-9, ankyrin repeat and SOCS box protein 9; tran | 99.68 | |
| 3jue_A | 368 | Arfgap with coiled-coil, ANK repeat and PH domain | 99.68 | |
| 2rfa_A | 232 | Transient receptor potential cation channel subfa | 99.68 | |
| 3d9h_A | 285 | CDNA FLJ77766, highly similar to HOMO sapiens anky | 99.68 | |
| 2e5g_A | 94 | U6 snRNA-specific terminal uridylyltransferase 1; | 99.68 | |
| 3b7b_A | 237 | Euchromatic histone-lysine N-methyltransferase 1; | 99.67 | |
| 2pnn_A | 273 | Transient receptor potential cation channel subfa | 99.67 | |
| 1rk8_A | 165 | CG8781-PA, CG8781-PA protein; mRNA processing, RRM | 99.67 | |
| 1wdy_A | 285 | 2-5A-dependent ribonuclease; hydrolase, RNA-bindin | 99.67 | |
| 2ad9_A | 119 | Polypyrimidine tract-binding protein 1; RBD, RRM, | 99.67 | |
| 3jxi_A | 260 | Vanilloid receptor-related osmotically activated p | 99.67 | |
| 3c5r_A | 137 | BARD-1, BRCA1-associated ring domain protein 1; an | 99.67 | |
| 3hra_A | 201 | Ankyrin repeat family protein; structural protein; | 99.67 | |
| 3r27_A | 100 | HnRNP L, heterogeneous nuclear ribonucleoprotein L | 99.67 | |
| 2cq1_A | 101 | PTB-like protein L; RRM domain, structural genomic | 99.67 | |
| 2fo1_E | 373 | LIN-12 protein; beta-barrel, protein-DNA complex, | 99.67 | |
| 3aaa_C | 123 | Myotrophin, protein V-1; actin capping protein, ba | 99.67 | |
| 2pnn_A | 273 | Transient receptor potential cation channel subfa | 99.66 | |
| 2la4_A | 101 | Nuclear and cytoplasmic polyadenylated RNA-bindin | 99.66 | |
| 3deo_A | 183 | Signal recognition particle 43 kDa protein; chloro | 99.66 | |
| 2jvr_A | 111 | Nucleolar protein 3; RNA recognition motif, nucleu | 99.66 | |
| 3ui2_A | 244 | Signal recognition particle 43 kDa protein, chlor; | 99.66 | |
| 1s70_B | 299 | 130 kDa myosin-binding subunit of smooth muscle my | 99.66 | |
| 4g8k_A | 337 | 2-5A-dependent ribonuclease; ankyrin-repeat domain | 99.66 | |
| 1yyh_A | 253 | HN1;, notch 1, ankyrin domain; ankyrin repeats, ce | 99.66 | |
| 3aji_A | 231 | 26S proteasome non-ATPase regulatory subunit 10; g | 99.65 | |
| 2fc8_A | 102 | NCL protein; structure genomics, RRM_1 domain, str | 99.65 | |
| 2fc9_A | 101 | NCL protein; structure genomics, RRM_1 domain, str | 99.65 | |
| 1x4d_A | 102 | Matrin 3; structural genomics, RRM domain, NPPSFA, | 99.65 | |
| 1n11_A | 437 | Ankyrin; clathrin, BAND 3, anion exchanger, struct | 99.65 | |
| 2lcw_A | 116 | RNA-binding protein FUS; RRM, nucleic acid binding | 99.46 | |
| 1wex_A | 104 | Hypothetical protein (riken cDNA 2810036L13); stru | 99.65 | |
| 3utm_A | 351 | Tankyrase-1; tankyrase, TNKS, ankryin repeat clust | 99.65 | |
| 1s70_B | 299 | 130 kDa myosin-binding subunit of smooth muscle my | 99.65 | |
| 3ljn_A | 364 | Hypothetical protein; ankyrin, structural genomics | 99.65 | |
| 1nu4_A | 97 | U1A RNA binding domain; RNA recognition motif, U1 | 99.65 | |
| 1why_A | 97 | Hypothetical protein riken cDNA 1810017N16; RNA re | 99.65 | |
| 2e5j_A | 97 | Methenyltetrahydrofolate synthetase domain contain | 99.64 | |
| 2ytc_A | 85 | PRE-mRNA-splicing factor RBM22; RRM domain, RBD, s | 99.64 | |
| 2j8a_A | 136 | Histone-lysine N-methyltransferase, H3 lysine-4 sp | 99.64 | |
| 4hbd_A | 276 | KN motif and ankyrin repeat domain-containing Pro; | 99.64 | |
| 2cpx_A | 115 | Hypothetical protein FLJ11016; RRM domain, structu | 99.64 | |
| 1x4f_A | 112 | Matrin 3; structural genomics, RRM domain, NPPSFA, | 99.64 | |
| 2dzn_A | 228 | Probable 26S proteasome regulatory subunit P28; an | 99.64 | |
| 3t8k_A | 186 | Uncharacterized protein; structural genomics, PSI- | 99.64 | |
| 2xnq_A | 97 | Nuclear polyadenylated RNA-binding protein 3; tran | 99.64 | |
| 3kea_A | 285 | K1L; tropism, ANK repeat, viral protein; 2.30A {Va | 99.64 | |
| 3d2w_A | 89 | TAR DNA-binding protein 43; DP-43 proteinopathy, T | 99.63 | |
| 1n11_A | 437 | Ankyrin; clathrin, BAND 3, anion exchanger, struct | 99.63 | |
| 1x4g_A | 109 | Nucleolysin TIAR; structural genomics, RRM domain, | 99.63 | |
| 2cpj_A | 99 | Non-POU domain-containing octamer-binding protein; | 99.63 | |
| 1x4c_A | 108 | Splicing factor, arginine/serine-rich 1; structura | 99.63 | |
| 2xai_A | 261 | ASB-9, ankyrin repeat and SOCS box protein 9; tran | 99.63 | |
| 2jvo_A | 108 | Nucleolar protein 3; nucleus, phosphorylation, rib | 99.63 | |
| 1wdy_A | 285 | 2-5A-dependent ribonuclease; hydrolase, RNA-bindin | 99.63 | |
| 3b7b_A | 237 | Euchromatic histone-lysine N-methyltransferase 1; | 99.63 | |
| 2dnl_A | 114 | Cytoplasmic polyadenylation element binding protei | 99.62 | |
| 2dnp_A | 90 | RNA-binding protein 14; RRM domain, RBD, structura | 99.62 | |
| 2f3j_A | 177 | RNA and export factor binding protein 2; RRM domai | 99.62 | |
| 1fjc_A | 96 | Nucleolin RBD2, protein C23; RNP, RRM, RNA binding | 99.62 | |
| 2i2y_A | 150 | Fusion protein consists of immunoglobin G- binding | 99.62 | |
| 1l3k_A | 196 | Heterogeneous nuclear ribonucleoprotein A1; nuclea | 99.62 | |
| 2cqh_A | 93 | IGF-II mRNA-binding protein 2 isoform A; RNA recog | 99.62 | |
| 2dgt_A | 92 | RNA-binding protein 30; RRM domain, structural gen | 99.62 | |
| 2dgu_A | 103 | Heterogeneous nuclear ribonucleoprotein Q; RRM dom | 99.61 | |
| 2kvi_A | 96 | Nuclear polyadenylated RNA-binding protein 3; RNA- | 99.61 | |
| 1k1a_A | 241 | B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa | 99.61 | |
| 2cjk_A | 167 | Nuclear polyadenylated RNA-binding protein 4; HRP1 | 99.61 | |
| 3d9h_A | 285 | CDNA FLJ77766, highly similar to HOMO sapiens anky | 99.61 | |
| 2fo1_E | 373 | LIN-12 protein; beta-barrel, protein-DNA complex, | 99.61 | |
| 3md3_A | 166 | Nuclear and cytoplasmic polyadenylated RNA-bindin | 99.6 | |
| 3jue_A | 368 | Arfgap with coiled-coil, ANK repeat and PH domain | 99.6 | |
| 3egn_A | 143 | RNA-binding protein 40; RNA recognition motif (RRM | 99.6 | |
| 2hzc_A | 87 | Splicing factor U2AF 65 kDa subunit; RNA splicing, | 99.6 | |
| 2e44_A | 96 | Insulin-like growth factor 2 mRNA binding protein | 99.6 | |
| 1whx_A | 111 | Hypothetical protein riken cDNA 1200009A02; RNA re | 99.6 | |
| 2cpd_A | 99 | Apobec-1 stimulating protein; RNA recognition moti | 99.59 | |
| 2voo_A | 193 | Lupus LA protein; RNA-binding protein, RNA recogni | 99.59 | |
| 2g4b_A | 172 | Splicing factor U2AF 65 kDa subunit; protein-RNA c | 99.59 | |
| 2diu_A | 96 | KIAA0430 protein; structural genomics, RRM domain, | 99.59 | |
| 1wf0_A | 88 | TDP-43, TAR DNA-binding protein-43; structural gen | 99.59 | |
| 3eu9_A | 240 | Huntingtin-interacting protein 14; epigenetics, an | 99.59 | |
| 1sw6_A | 327 | Regulatory protein SWI6; transcription regulation, | 99.59 | |
| 1wf1_A | 110 | RNA-binding protein RALY; structural genomics, RRM | 99.58 | |
| 1sw6_A | 327 | Regulatory protein SWI6; transcription regulation, | 99.58 | |
| 2yh0_A | 198 | Splicing factor U2AF 65 kDa subunit; PRE-mRNA spli | 99.58 | |
| 1wg1_A | 88 | KIAA1579 protein, homolog EXC-7; RBD, structural g | 99.58 | |
| 2qfj_A | 216 | FBP-interacting repressor; protein-DNA complex; HE | 99.58 | |
| 4f02_A | 213 | Polyadenylate-binding protein 1; mRNA, eukaryotic | 99.57 | |
| 1dcq_A | 278 | PYK2-associated protein beta; zinc-binding module, | 99.56 | |
| 3eu9_A | 240 | Huntingtin-interacting protein 14; epigenetics, an | 99.56 | |
| 1sjr_A | 164 | Polypyrimidine tract-binding protein 1; extended b | 99.56 | |
| 3lvq_E | 497 | ARF-GAP with SH3 domain, ANK repeat and PH domain | 99.56 | |
| 3pgw_S | 437 | U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM | 99.56 | |
| 2b0o_E | 301 | UPLC1; arfgap, structural genomics, structural gen | 99.55 | |
| 3zzy_A | 130 | Polypyrimidine tract-binding protein 1; protein bi | 99.55 | |
| 1x5p_A | 97 | Negative elongation factor E; structure genomics, | 99.55 | |
| 1b7f_A | 168 | Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP | 99.55 | |
| 1n0q_A | 93 | 3ANK, 3 ankyrin repeats; structural protein; 1.26A | 99.54 | |
| 2cq2_A | 114 | Hypothetical protein LOC91801; RRM domain, structu | 99.54 | |
| 3beg_B | 115 | Splicing factor, arginine/serine-rich 1; kinase, S | 99.54 | |
| 1fxl_A | 167 | Paraneoplastic encephalomyelitis antigen HUD; prot | 99.53 | |
| 3sde_A | 261 | Paraspeckle component 1; RRM, anti parallel right | 99.53 | |
| 3nmr_A | 175 | Cugbp ELAV-like family member 1; RRM, PRE-mRNA spl | 99.51 | |
| 2e5i_A | 124 | Heterogeneous nuclear ribonucleoprotein L-like; RR | 99.51 | |
| 2pe8_A | 105 | Splicing factor 45; RRM, protein binding; 2.00A {H | 99.51 | |
| 2bz2_A | 121 | Negative elongation factor E; NELF E, RNA recognit | 99.49 | |
| 1fje_B | 175 | Nucleolin RBD12, protein C23; RNP, RRM, RNA bindin | 99.45 | |
| 2aja_A | 376 | Ankyrin repeat family protein; NESG, Q5ZSV0, struc | 99.45 | |
| 2zgd_A | 110 | 3 repeat synthetic ankyrin; ankyrin repeat, hydrox | 99.45 | |
| 3u1l_A | 240 | PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; | 99.44 | |
| 2dit_A | 112 | HIV TAT specific factor 1 variant; structural geno | 99.37 | |
| 2aja_A | 376 | Ankyrin repeat family protein; NESG, Q5ZSV0, struc | 99.36 | |
| 1jmt_A | 104 | Splicing factor U2AF 35 kDa subunit; RRM, RNA spli | 99.35 | |
| 2l6b_A | 115 | NR1C; ankyrin, consensus, repeat protein, ising mo | 99.35 | |
| 3tyt_A | 205 | Heterogeneous nuclear ribonucleoprotein L; ferredo | 99.34 | |
| 3pgw_A | 282 | U1-A; protein-RNA complex, U1 snRNA, SM fold, SM c | 99.33 | |
| 2d9o_A | 100 | DNAJ (HSP40) homolog, subfamily C, member 17; RRM | 99.3 | |
| 1qm9_A | 198 | Polypyrimidine tract-binding protein; ribonucleopr | 99.3 | |
| 3v4m_A | 105 | Splicing factor U2AF 65 kDa subunit; canonical RNA | 99.29 | |
| 2adc_A | 229 | Polypyrimidine tract-binding protein 1; RBD, RRM, | 99.29 | |
| 3ue2_A | 118 | Poly(U)-binding-splicing factor PUF60; RNA recogni | 99.27 | |
| 3tht_A | 345 | Alkylated DNA repair protein ALKB homolog 8; struc | 99.17 | |
| 2dnr_A | 91 | Synaptojanin-1; RRM domain, RBD, structural genomi | 98.97 | |
| 3s6e_A | 114 | RNA-binding protein 39; ferredoxin-like, structura | 98.97 | |
| 2kn4_A | 158 | Immunoglobulin G-binding protein G, splicing FACT | 98.92 | |
| 1owx_A | 121 | Lupus LA protein, SS-B, LA; RRM, transcription; NM | 98.88 | |
| 1ufw_A | 95 | Synaptojanin 2; RNP domain, structural genomics, r | 98.8 | |
| 2i2y_A | 150 | Fusion protein consists of immunoglobin G- binding | 98.59 | |
| 3dxb_A | 222 | Thioredoxin N-terminally fused to PUF60(UHM); spli | 98.58 | |
| 2dhx_A | 104 | Poly (ADP-ribose) polymerase family, member 10 var | 98.3 | |
| 3pgw_S | 437 | U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM | 98.08 | |
| 2l9w_A | 117 | U4/U6 snRNA-associated-splicing factor PRP24; RRM, | 97.91 | |
| 2lea_A | 135 | Serine/arginine-rich splicing factor 2; SR protein | 97.86 | |
| 4fxv_A | 99 | ELAV-like protein 1; RNA recognition motif, putati | 97.86 | |
| 2lxi_A | 91 | RNA-binding protein 10; NMR {Homo sapiens} | 97.68 | |
| 2lkz_A | 95 | RNA-binding protein 5; RRM; NMR {Homo sapiens} | 97.55 | |
| 3s8s_A | 110 | Histone-lysine N-methyltransferase SETD1A; chromat | 97.41 | |
| 1sjq_A | 105 | Polypyrimidine tract-binding protein 1; babbab mot | 97.41 | |
| 1uw4_A | 91 | UPF3X; nonsense mediated mRNA decay protein, RNA-b | 97.37 | |
| 2hgn_A | 139 | Heterogeneous nuclear ribonucleoprotein F; RNA rec | 97.37 | |
| 2mss_A | 75 | Protein (musashi1); RNA-binding domain, RNA bindin | 97.3 | |
| 1iqt_A | 75 | AUF1, heterogeneous nuclear ribonucleoprotein D0; | 97.29 | |
| 1wwh_A | 119 | Nucleoporin 35, nucleoporin; structural genomics, | 97.28 | |
| 3p5t_L | 90 | Cleavage and polyadenylation specificity factor S; | 97.28 | |
| 1rk8_A | 165 | CG8781-PA, CG8781-PA protein; mRNA processing, RRM | 97.28 | |
| 3mdf_A | 85 | Peptidyl-prolyl CIS-trans isomerase E; RRM domain, | 97.24 | |
| 2ad9_A | 119 | Polypyrimidine tract-binding protein 1; RBD, RRM, | 97.24 | |
| 3ns6_A | 100 | Eukaryotic translation initiation factor 3 subuni; | 97.21 | |
| 1uaw_A | 77 | Mouse-musashi-1; RNP-type structure, RNA binding p | 97.2 | |
| 2cqb_A | 102 | Peptidyl-prolyl CIS-trans isomerase E; RNA recogni | 97.2 | |
| 2jrs_A | 108 | RNA-binding protein 39; RNA binding motif of RBM39 | 97.19 | |
| 2dgp_A | 106 | Bruno-like 4, RNA binding protein; RRM domain, str | 97.19 | |
| 4f25_A | 115 | Polyadenylate-binding protein 1; RRM fold, transla | 97.18 | |
| 3r27_A | 100 | HnRNP L, heterogeneous nuclear ribonucleoprotein L | 97.17 | |
| 2x1f_A | 96 | MRNA 3'-END-processing protein RNA15; transcriptio | 97.16 | |
| 1x5s_A | 102 | Cold-inducible RNA-binding protein; structure geno | 97.16 | |
| 2m2b_A | 131 | RNA-binding protein 10; T-cell, JCSG, MPP, PSI-bio | 97.14 | |
| 3bs9_A | 87 | Nucleolysin TIA-1 isoform P40; RNA recognition mot | 97.12 | |
| 2rs2_A | 109 | Musashi-1, RNA-binding protein musashi homolog 1; | 97.11 | |
| 1whw_A | 99 | Hypothetical protein riken cDNA 1200009A02; RNA re | 97.11 | |
| 1x5t_A | 96 | Splicing factor 3B subunit 4; structure genomics, | 97.09 | |
| 1x4h_A | 111 | RNA-binding protein 28; structural genomics, RRM d | 97.09 | |
| 3s7r_A | 87 | Heterogeneous nuclear ribonucleoprotein A/B; ferre | 97.08 | |
| 1x4e_A | 85 | RNA binding motif, single-stranded interacting pro | 97.07 | |
| 2cph_A | 107 | RNA binding motif protein 19; RNA recognition moti | 97.07 | |
| 1whv_A | 100 | Poly(A)-specific ribonuclease; RNA recognition mot | 97.07 | |
| 3md1_A | 83 | Nuclear and cytoplasmic polyadenylated RNA-bindin | 97.06 | |
| 2e5h_A | 94 | Zinc finger CCHC-type and RNA-binding motif- conta | 97.05 | |
| 2cpz_A | 115 | CUG triplet repeat RNA-binding protein 1; RRM doma | 97.04 | |
| 2div_A | 99 | TRNA selenocysteine associated protein; structural | 97.03 | |
| 2lcw_A | 116 | RNA-binding protein FUS; RRM, nucleic acid binding | 96.09 | |
| 1oo0_B | 110 | CG8781-PA, drosophila Y14; RNA recognition motif, | 97.01 | |
| 2dnz_A | 95 | Probable RNA-binding protein 23; RNA recognition m | 97.01 | |
| 1x5u_A | 105 | Splicing factor 3B subunit 4 (spliceosome associat | 97.01 | |
| 2cq1_A | 101 | PTB-like protein L; RRM domain, structural genomic | 97.0 | |
| 2la6_A | 99 | RNA-binding protein FUS; structural genomics, nort | 97.0 | |
| 1p27_B | 106 | RNA-binding protein 8A; nuclear protein, mRNA spli | 96.98 | |
| 2cqc_A | 95 | Arginine/serine-rich splicing factor 10; RNA recog | 96.97 | |
| 2dgs_A | 99 | DAZ-associated protein 1; RRM domain, structural g | 96.97 | |
| 2cpe_A | 113 | RNA-binding protein EWS; RNA recognition motif, RR | 96.96 | |
| 2fy1_A | 116 | RNA-binding motif protein, Y chromosome, family 1 | 96.95 | |
| 2dgx_A | 96 | KIAA0430 protein; RRM domain, structural genomics, | 96.95 | |
| 2kxn_B | 129 | Transformer-2 protein homolog beta; SR protein, RR | 96.95 | |
| 2cqg_A | 103 | TDP-43, TAR DNA-binding protein-43; RNA recognitio | 96.94 | |
| 1x4b_A | 116 | Heterogeneous nuclear ribonucleoproteins A2/B1; st | 96.94 | |
| 3ex7_B | 126 | RNA-binding protein 8A; protein-RNA complex, mRNA | 96.93 | |
| 2do4_A | 100 | Squamous cell carcinoma antigen recognized by T- c | 96.93 | |
| 2dnl_A | 114 | Cytoplasmic polyadenylation element binding protei | 96.92 | |
| 2cq4_A | 114 | RNA binding motif protein 23; RRM domain, structur | 96.92 | |
| 2cqd_A | 116 | RNA-binding region containing protein 1; RNA recog | 96.92 | |
| 2jvr_A | 111 | Nucleolar protein 3; RNA recognition motif, nucleu | 96.92 | |
| 1s79_A | 103 | Lupus LA protein; RRM, alpha/beta, RNA binding pro | 96.9 | |
| 1p1t_A | 104 | Cleavage stimulation factor, 64 kDa subunit; RNA r | 96.89 | |
| 2dnh_A | 105 | Bruno-like 5, RNA binding protein; RRM domain, RBD | 96.88 | |
| 2err_A | 109 | Ataxin-2-binding protein 1; protein-RNA complex, R | 96.88 | |
| 3n9u_C | 156 | Cleavage and polyadenylation specificity factor S; | 96.87 | |
| 3ucg_A | 89 | Polyadenylate-binding protein 2; ferredoxin-like, | 96.86 | |
| 3d2w_A | 89 | TAR DNA-binding protein 43; DP-43 proteinopathy, T | 96.86 | |
| 2jvo_A | 108 | Nucleolar protein 3; nucleus, phosphorylation, rib | 96.85 | |
| 2ek1_A | 95 | RNA-binding protein 12; RNA recognition motif, dim | 96.84 | |
| 2cpy_A | 114 | RNA-binding protein 12; RRM domain, structural gen | 96.81 | |
| 2dgo_A | 115 | Cytotoxic granule-associated RNA binding protein 1 | 96.81 | |
| 2dnm_A | 103 | SRP46 splicing factor; RRM domain, RBD, structural | 96.81 | |
| 2dh8_A | 105 | DAZ-associated protein 1; RRM domain, structural g | 96.81 | |
| 1x4d_A | 102 | Matrin 3; structural genomics, RRM domain, NPPSFA, | 96.8 | |
| 2ku7_A | 140 | MLL1 PHD3-CYP33 RRM chimeric protein; transcriptio | 96.8 | |
| 2j8a_A | 136 | Histone-lysine N-methyltransferase, H3 lysine-4 sp | 96.79 | |
| 2wbr_A | 89 | GW182, gawky, LD47780P; DNA-binding protein, RRM, | 96.79 | |
| 2dha_A | 123 | FLJ20171 protein; RRM domain, structural genomics, | 96.79 | |
| 2jwn_A | 124 | Embryonic polyadenylate-binding protein 2-B; epabp | 96.78 | |
| 2krb_A | 81 | Eukaryotic translation initiation factor 3 subunit | 96.78 | |
| 1wg5_A | 104 | Heterogeneous nuclear ribonucleoprotein H; structu | 96.77 | |
| 2dis_A | 109 | Unnamed protein product; structural genomics, RRM | 96.76 | |
| 1wey_A | 104 | Calcipressin 1; structural genomics, RRM domain, r | 96.75 | |
| 1wf0_A | 88 | TDP-43, TAR DNA-binding protein-43; structural gen | 96.75 | |
| 2cq0_A | 103 | Eukaryotic translation initiation factor 3 subunit | 96.75 | |
| 2j76_E | 100 | EIF-4B, EIF4B, eukaryotic translation initiation f | 96.74 | |
| 1whx_A | 111 | Hypothetical protein riken cDNA 1200009A02; RNA re | 96.72 | |
| 2do0_A | 114 | HnRNP M, heterogeneous nuclear ribonucleoprotein M | 96.72 | |
| 3beg_B | 115 | Splicing factor, arginine/serine-rich 1; kinase, S | 96.72 | |
| 1wf1_A | 110 | RNA-binding protein RALY; structural genomics, RRM | 96.71 | |
| 2cqp_A | 98 | RNA-binding protein 12; RNA recognition motif, RRM | 96.71 | |
| 2d9p_A | 103 | Polyadenylate-binding protein 3; RRM domain, struc | 96.7 | |
| 2lmi_A | 107 | GRSF-1, G-rich sequence factor 1; G-rich RNA seque | 96.7 | |
| 2kt5_A | 124 | RNA and export factor-binding protein 2; chaperone | 96.7 | |
| 2dgv_A | 92 | HnRNP M, heterogeneous nuclear ribonucleoprotein M | 96.69 | |
| 1why_A | 97 | Hypothetical protein riken cDNA 1810017N16; RNA re | 96.68 | |
| 2dnn_A | 109 | RNA-binding protein 12; RRM domain, RBD, structura | 96.67 | |
| 1x4f_A | 112 | Matrin 3; structural genomics, RRM domain, NPPSFA, | 96.67 | |
| 2dgt_A | 92 | RNA-binding protein 30; RRM domain, structural gen | 96.66 | |
| 1wi8_A | 104 | EIF-4B, eukaryotic translation initiation factor 4 | 96.65 | |
| 2la4_A | 101 | Nuclear and cytoplasmic polyadenylated RNA-bindin | 96.65 | |
| 2ki2_A | 90 | SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA | 96.64 | |
| 2khc_A | 118 | Testis-specific RNP-type RNA binding protein; RRM, | 96.63 | |
| 1nu4_A | 97 | U1A RNA binding domain; RNA recognition motif, U1 | 96.63 | |
| 1x4c_A | 108 | Splicing factor, arginine/serine-rich 1; structura | 96.62 | |
| 2hgl_A | 136 | HNRPF protein, heterogeneous nuclear ribonucleopro | 96.61 | |
| 2dnp_A | 90 | RNA-binding protein 14; RRM domain, RBD, structura | 96.6 | |
| 2dnq_A | 90 | RNA-binding protein 4B; RRM domain,RBD, structural | 96.59 | |
| 2hvz_A | 101 | Splicing factor, arginine/serine-rich 7; RRM, RNA | 96.58 | |
| 1wel_A | 124 | RNA-binding protein 12; structural genomics, NPPSF | 96.57 | |
| 1x4g_A | 109 | Nucleolysin TIAR; structural genomics, RRM domain, | 96.56 | |
| 3ulh_A | 107 | THO complex subunit 4; nuclear protein, RNA bindin | 96.55 | |
| 1u6f_A | 139 | Tcubp1, RNA-binding protein UBP1; trypanosome, mRN | 96.54 | |
| 1wex_A | 104 | Hypothetical protein (riken cDNA 2810036L13); stru | 96.53 | |
| 1sjr_A | 164 | Polypyrimidine tract-binding protein 1; extended b | 96.51 | |
| 3lqv_A | 115 | PRE-mRNA branch site protein P14; cysless mutant, | 96.51 | |
| 2db1_A | 118 | Heterogeneous nuclear ribonucleoprotein F; RRM dom | 96.5 | |
| 1wez_A | 102 | HnRNP H', FTP-3, heterogeneous nuclear ribonucleop | 96.5 | |
| 3zzy_A | 130 | Polypyrimidine tract-binding protein 1; protein bi | 96.48 | |
| 2voo_A | 193 | Lupus LA protein; RNA-binding protein, RNA recogni | 96.47 | |
| 1h2v_Z | 156 | 20 kDa nuclear CAP binding protein; CAP-binding-co | 96.47 | |
| 3p3d_A | 132 | Nucleoporin 53; structural genomics, PSI-2, protei | 96.46 | |
| 2dgu_A | 103 | Heterogeneous nuclear ribonucleoprotein Q; RRM dom | 96.44 | |
| 2f3j_A | 177 | RNA and export factor binding protein 2; RRM domai | 96.35 | |
| 2e5j_A | 97 | Methenyltetrahydrofolate synthetase domain contain | 96.35 | |
| 2cq2_A | 114 | Hypothetical protein LOC91801; RRM domain, structu | 96.32 | |
| 4a8x_A | 88 | RNA-binding protein with serine-rich domain 1; tra | 96.3 | |
| 2cqh_A | 93 | IGF-II mRNA-binding protein 2 isoform A; RNA recog | 96.29 | |
| 2cpx_A | 115 | Hypothetical protein FLJ11016; RRM domain, structu | 96.29 | |
| 1fj7_A | 101 | Nucleolin RBD1, protein C23; RNP, RRM, RNA binding | 96.29 | |
| 2e5i_A | 124 | Heterogeneous nuclear ribonucleoprotein L-like; RR | 96.27 | |
| 2ywk_A | 95 | Putative RNA-binding protein 11; RRM-domain, struc | 96.26 | |
| 3q2s_C | 229 | Cleavage and polyadenylation specificity factor S; | 96.26 | |
| 3ctr_A | 101 | Poly(A)-specific ribonuclease PARN; protein-RNA-co | 96.25 | |
| 3pq1_A | 464 | Poly(A) RNA polymerase; nucleotidyl transferase, R | 96.16 | |
| 2hgm_A | 126 | HNRPF protein, heterogeneous nuclear ribonucleopro | 96.16 | |
| 2e44_A | 96 | Insulin-like growth factor 2 mRNA binding protein | 96.14 | |
| 2cqi_A | 103 | Nucleolysin TIAR; RNA recognition motif, RRM, RNA | 96.14 | |
| 1wg1_A | 88 | KIAA1579 protein, homolog EXC-7; RBD, structural g | 96.13 | |
| 3egn_A | 143 | RNA-binding protein 40; RNA recognition motif (RRM | 96.12 | |
| 2cq3_A | 103 | RNA-binding protein 9; RRM domain, structural geno | 96.09 | |
| 2dgw_A | 91 | Probable RNA-binding protein 19; RRM domain, struc | 96.07 | |
| 1x4a_A | 109 | Splicing factor, arginine/serine-rich 1 (splicing | 96.07 | |
| 2nlw_A | 105 | Eukaryotic translation initiation factor 3 subunit | 96.06 | |
| 2dng_A | 103 | Eukaryotic translation initiation factor 4H; RRM d | 96.05 | |
| 2cpf_A | 98 | RNA binding motif protein 19; RNA recognition moti | 96.05 | |
| 1x5o_A | 114 | RNA binding motif, single-stranded interacting pro | 96.05 | |
| 2l08_A | 97 | Regulator of nonsense transcripts 3A; NESG, nonsen | 96.02 | |
| 2ytc_A | 85 | PRE-mRNA-splicing factor RBM22; RRM domain, RBD, s | 96.02 | |
| 2fc9_A | 101 | NCL protein; structure genomics, RRM_1 domain, str | 95.99 | |
| 2xs2_A | 102 | Deleted in azoospermia-like; RNA binding protein-R | 95.97 | |
| 2dhg_A | 104 | TRNA selenocysteine associated protein (SECP43); R | 95.95 | |
| 2cpj_A | 99 | Non-POU domain-containing octamer-binding protein; | 95.95 | |
| 2a3j_A | 127 | U1 small nuclear ribonucleoprotein A; computationa | 95.81 | |
| 2kvi_A | 96 | Nuclear polyadenylated RNA-binding protein 3; RNA- | 95.79 | |
| 2cpi_A | 111 | CCR4-NOT transcription complex subunit 4; RNA reco | 95.74 | |
| 2xnq_A | 97 | Nuclear polyadenylated RNA-binding protein 3; tran | 95.63 | |
| 2e5g_A | 94 | U6 snRNA-specific terminal uridylyltransferase 1; | 95.51 | |
| 3u1l_A | 240 | PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; | 95.34 | |
| 2cpd_A | 99 | Apobec-1 stimulating protein; RNA recognition moti | 94.89 | |
| 2hzc_A | 87 | Splicing factor U2AF 65 kDa subunit; RNA splicing, | 94.87 | |
| 1fjc_A | 96 | Nucleolin RBD2, protein C23; RNP, RRM, RNA binding | 94.42 | |
| 2bz2_A | 121 | Negative elongation factor E; NELF E, RNA recognit | 93.72 | |
| 3tht_A | 345 | Alkylated DNA repair protein ALKB homolog 8; struc | 93.18 |
| >1l3k_A Heterogeneous nuclear ribonucleoprotein A1; nuclear protein hnRNP A1, RNA-recognition motif, RNA- binding, UP1, RNA binding protein; 1.10A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1u1k_A* 1u1l_A* 1u1m_A* 1u1n_A* 1u1o_A 1u1p_A* 1u1q_A 1u1r_A* 1pgz_A* 1ha1_A 1po6_A* 2up1_A* 1up1_A | Back alignment and structure |
|---|
Probab=99.90 E-value=2.2e-24 Score=181.52 Aligned_cols=155 Identities=21% Similarity=0.359 Sum_probs=122.9
Q ss_pred cccCCCeEEEeCCCCCCCHHHHHHHHhccCCeeEEEEeeeCCCCCceeEEEEEEcCHHHHHHHHhcCCCccCCccccccC
Q psy630 4 SIRQLNKIFVGNLPWTVSHNELKKFFSEYGQIMNASVMFDKNTGLSKGFGFVTFQNKEAVDKVFSTDSHVLEGSRLSIQP 83 (347)
Q Consensus 4 ~~~~~~~l~V~nLp~~~t~~~l~~~f~~~G~i~~~~i~~~~~t~~~~g~afV~f~~~~~a~~a~~~~~~~~~g~~l~v~~ 83 (347)
++.+.++|||+|||+++|+++|+++|++||.|..|.+++++.+|.++|||||+|.+.++|.+|+..++..+.|+.|.|.+
T Consensus 9 ~~~~~~~l~V~nLp~~~te~~l~~~F~~~G~i~~v~i~~~~~~g~~~g~afV~f~~~~~A~~A~~~~~~~~~g~~l~v~~ 88 (196)
T 1l3k_A 9 EPEQLRKLFIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPNTKRSRGFGFVTYATVEEVDAAMNARPHKVDGRVVEPKR 88 (196)
T ss_dssp CCGGGGEEEEESCCTTCCHHHHHHHHGGGSCEEEEEEEECTTTCCEEEEEEEEESSHHHHHHHHHTCSCEETTEECEEEE
T ss_pred CCCCCCEEEEeCCCCCCCHHHHHHHHHhCCCEEEEEEEEcCCCCCccceEEEEeCCHHHHHHHHhcCCCEECCEEeeeec
Confidence 45677899999999999999999999999999999999999999999999999999999999999999999999999998
Q ss_pred CCcccccchhhhhhcccccccccCCcccccchhhHHHHhhccccceecccCCCCCccchhHHHHHHHHHHcCCCCHHHHH
Q psy630 84 SDSHNRMAENMEDRFNQACDYLPSLVKKLDSSTLLKFYALYKQATVGQCNIDKPSWYNMEAKSKYNAWNSLGQMAKSEAM 163 (347)
Q Consensus 84 ~~~~~~~~~~~~~~f~~~~~~v~~l~~~~~~e~l~~~f~~fg~v~~g~~~~~~p~~~~~~~~~K~~aw~~~~~~~~~eA~ 163 (347)
+.+...... ........++||+|||..+++++|+++|+.||.|....+..++. .|+.|+.|+.. ..+.++|.
T Consensus 89 ~~~~~~~~~-~~~~~~~~~l~V~nLp~~~t~~~l~~~F~~~G~i~~v~i~~~~~-----~g~~~g~afV~--F~~~~~A~ 160 (196)
T 1l3k_A 89 AVSREDSQR-PGAHLTVKKIFVGGIKEDTEEHHLRDYFEQYGKIEVIEIMTDRG-----SGKKRGFAFVT--FDDHDSVD 160 (196)
T ss_dssp CCC------------CCSEEEEECCTTTCCHHHHHHHHTTTSCEEEEEEEECTT-----TCCEEEEEEEE--ESSHHHHH
T ss_pred ccCcccccc-cccCCCcceEEEeCCCCCCCHHHHHHHHhcCCCeEEEEEeecCC-----CCCccceEEEE--ECCHHHHH
Confidence 876543221 12223457899999999999999999999999998777765532 22333334443 34577777
Q ss_pred HHH
Q psy630 164 SKY 166 (347)
Q Consensus 164 ~~y 166 (347)
++.
T Consensus 161 ~A~ 163 (196)
T 1l3k_A 161 KIV 163 (196)
T ss_dssp HHH
T ss_pred HHH
Confidence 664
|
| >4f02_A Polyadenylate-binding protein 1; mRNA, eukaryotic initiation factors PAIP1 and PAIP2, translation-RNA complex; 2.00A {Homo sapiens} PDB: 1cvj_A* | Back alignment and structure |
|---|
| >1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A | Back alignment and structure |
|---|
| >1b7f_A Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP*GP*UP*UP*UP*UP*UP*UP*UP*U)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A | Back alignment and structure |
|---|
| >2cjk_A Nuclear polyadenylated RNA-binding protein 4; HRP1, RNA-binding, RNA processing, mRNA processing, nonsense-mediated mRNA decay, cleavage; NMR {Saccharomyces cerevisiae} PDB: 2km8_C | Back alignment and structure |
|---|
| >3md3_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNP, RBD, poly(U) binding, tandem, acetylation, cytopla nucleus; 2.70A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A | Back alignment and structure |
|---|
| >4gpm_A Engineered protein OR264; de novo protein, structural genomics, PSI-biology, northeast structural genomics consortium, NESG; 2.00A {Synthetic construct} PDB: 4gmr_A | Back alignment and structure |
|---|
| >1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 | Back alignment and structure |
|---|
| >4f25_A Polyadenylate-binding protein 1; RRM fold, translation initiation, RNA-binding, EIF4G-binding translation; 1.90A {Homo sapiens} PDB: 4f26_A 2k8g_A | Back alignment and structure |
|---|
| >1hbk_A ACBP, acyl-COA binding protein; fatty acid metabolism; HET: COA MYR; 2.0A {Plasmodium falciparum} SCOP: a.11.1.1 | Back alignment and structure |
|---|
| >3nmr_A Cugbp ELAV-like family member 1; RRM, PRE-mRNA splicing, RNA binding protein-RNA complex; 1.85A {Homo sapiens} PDB: 3nna_A 3nnc_A 2dhs_A 3nnh_A | Back alignment and structure |
|---|
| >1st7_A ACBP, acyl-COA-binding protein; four helix bundle, transport protein; NMR {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2lbb_A Acyl COA binding protein; protein binding, structural genomi seattle structural genomics center for infectious disease,; NMR {Babesia bovis} | Back alignment and structure |
|---|
| >2cop_A Acyl-coenzyme A binding domain containing 6; acyl COA binding protein, COA binding protein, lipid binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3epy_A Acyl-COA-binding domain-containing protein 7; acyl-COA binding protein, fatty acid, lipid metabolism, structural genomics; HET: COA PLM; 2.00A {Homo sapiens} SCOP: a.11.1.1 | Back alignment and structure |
|---|
| >2cb8_A Acyl-COA-binding protein; acyl-coenzyme A binding protein, fatty acid, acetylation, alternative splicing, lipid-binding, transport; HET: MYA; 1.4A {Homo sapiens} PDB: 2fj9_A 1aca_A* 1hb6_A 1hb8_A 1nti_A 1nvl_A* 2abd_A 2fdq_A | Back alignment and structure |
|---|
| >4gpm_A Engineered protein OR264; de novo protein, structural genomics, PSI-biology, northeast structural genomics consortium, NESG; 2.00A {Synthetic construct} PDB: 4gmr_A | Back alignment and structure |
|---|
| >4fxv_A ELAV-like protein 1; RNA recognition motif, putative RNA-binding domain, transcri structural genomics, joint center for structural genomics; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
| >2cqu_A Peroxisomal D3,D2-enoyl-COA isomerase; acyl-COA binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1fje_B Nucleolin RBD12, protein C23; RNP, RRM, RNA binding domain, RNA-protein complex, nucleolus, structural protein/RNA complex; NMR {Mesocricetus auratus} SCOP: d.58.7.1 d.58.7.1 PDB: 1rkj_A 2krr_A | Back alignment and structure |
|---|
| >3tyt_A Heterogeneous nuclear ribonucleoprotein L; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 1.60A {Mus musculus} PDB: 3s01_A 3to8_A | Back alignment and structure |
|---|
| >3pgw_A U1-A; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 1fht_A 2u1a_A 2aym_A 2b0g_A | Back alignment and structure |
|---|
| >3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3vf0_B* 3h2u_B 3h2v_E | Back alignment and structure |
|---|
| >2g4b_A Splicing factor U2AF 65 kDa subunit; protein-RNA complex, RNA splicing factor, RNA recognition motif, RNA binding protein/RNA complex; 2.50A {Homo sapiens} PDB: 2u2f_A | Back alignment and structure |
|---|
| >2lxi_A RNA-binding protein 10; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2wh5_A Acyl-COA-binding domain-containing protein 4; alternative splicing, fatty acid metabolism, lipid transport, lipid binding protein; HET: STE ST9 COA; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >3s8s_A Histone-lysine N-methyltransferase SETD1A; chromatin modification, transcription regulation, structural genomics, structural genomics consortium; 1.30A {Homo sapiens} | Back alignment and structure |
|---|
| >3fp5_A Acyl-COA binding protein; ACBP, cacao disease, fatty acid metabolism, lipid binding protein; HET: MES; 1.61A {Moniliophthora perniciosa} SCOP: a.11.1.0 | Back alignment and structure |
|---|
| >3flv_A Acyl-COA-binding domain-containing protein 5; lipid binding, structural genomics, struct genomics consortium, SGC, lipid-binding, membrane; HET: STE COA; 1.70A {Homo sapiens} | Back alignment and structure |
|---|
| >2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A | Back alignment and structure |
|---|
| >2lkz_A RNA-binding protein 5; RRM; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3s7r_A Heterogeneous nuclear ribonucleoprotein A/B; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 2.15A {Homo sapiens} PDB: 1hd0_A 1hd1_A | Back alignment and structure |
|---|
| >3sde_A Paraspeckle component 1; RRM, anti parallel right handed coiled-coil, NOPS, DBHS, RNA protein, RNA binding; 1.90A {Homo sapiens} PDB: 3sde_B | Back alignment and structure |
|---|
| >2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C | Back alignment and structure |
|---|
| >1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 | Back alignment and structure |
|---|
| >3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A | Back alignment and structure |
|---|
| >2adc_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 2evz_A | Back alignment and structure |
|---|
| >2yh0_A Splicing factor U2AF 65 kDa subunit; PRE-mRNA splicing, transcription, RNA binding protein, mRNA processing; NMR {Homo sapiens} PDB: 2yh1_A | Back alignment and structure |
|---|
| >2dgs_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 | Back alignment and structure |
|---|
| >2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} | Back alignment and structure |
|---|
| >1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 | Back alignment and structure |
|---|
| >2jrs_A RNA-binding protein 39; RNA binding motif of RBM39_human (caper), RRM2 domain, solution structure, structural genomics, PSI-2; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1s79_A Lupus LA protein; RRM, alpha/beta, RNA binding protein, translation; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A | Back alignment and structure |
|---|
| >3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} SCOP: d.211.1.0 PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* | Back alignment and structure |
|---|
| >3md1_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RBD, RNP, poly(U) binding, nucleus, RNA-binding, binding protein; 1.60A {Saccharomyces cerevisiae} SCOP: d.58.7.0 | Back alignment and structure |
|---|
| >3p5t_L Cleavage and polyadenylation specificity factor S; RRM domain, poly(A) site recognition, RNA, nuclear, RNA BIND protein; 2.70A {Homo sapiens} PDB: 3p6y_C | Back alignment and structure |
|---|
| >1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 | Back alignment and structure |
|---|
| >1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A | Back alignment and structure |
|---|
| >2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A | Back alignment and structure |
|---|
| >2mss_A Protein (musashi1); RNA-binding domain, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 PDB: 2mst_A | Back alignment and structure |
|---|
| >3mdf_A Peptidyl-prolyl CIS-trans isomerase E; RRM domain, PHD finger, CYP33, MLL, RNA binding protein, ISO mRNA processing, mRNA splicing, nucleus; 1.85A {Homo sapiens} SCOP: d.58.7.1 PDB: 2kyx_A 3lpy_A* | Back alignment and structure |
|---|
| >2rs2_A Musashi-1, RNA-binding protein musashi homolog 1; protein-RNA complex, RRM, RBD, RNA binding protein- complex; NMR {Mus musculus} | Back alignment and structure |
|---|
| >3bs9_A Nucleolysin TIA-1 isoform P40; RNA recognition motif, RRM, RNA binding domain, RBD, RNA splicing, apoptosis, phosphoprotein, RNA-binding; 1.95A {Homo sapiens} | Back alignment and structure |
|---|
| >2dh8_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A | Back alignment and structure |
|---|
| >1qm9_A Polypyrimidine tract-binding protein; ribonucleoprotein, RNP, RNA, spicing, translation; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 | Back alignment and structure |
|---|
| >1whw_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3vf0_B* 3h2u_B 3h2v_E | Back alignment and structure |
|---|
| >3lqv_A PRE-mRNA branch site protein P14; cysless mutant, PRE-mRNA splicing, adenine, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: ADE; 2.38A {Homo sapiens} SCOP: d.58.7.1 PDB: 2f9d_A 2f9j_A 2fho_B | Back alignment and structure |
|---|
| >1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 | Back alignment and structure |
|---|
| >2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* | Back alignment and structure |
|---|
| >2div_A TRNA selenocysteine associated protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3ucg_A Polyadenylate-binding protein 2; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative; HET: PGE; 1.95A {Homo sapiens} PDB: 3b4d_A 3b4m_A | Back alignment and structure |
|---|
| >2la6_A RNA-binding protein FUS; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, RNA recognition; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dnz_A Probable RNA-binding protein 23; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1x4h_A RNA-binding protein 28; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2cqc_A Arginine/serine-rich splicing factor 10; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 | Back alignment and structure |
|---|
| >1p27_B RNA-binding protein 8A; nuclear protein, mRNA splicing; 2.00A {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >3ns6_A Eukaryotic translation initiation factor 3 subuni; 1.25A {Saccharomyces cerevisiae} PDB: 3ns5_A | Back alignment and structure |
|---|
| >1x5u_A Splicing factor 3B subunit 4 (spliceosome associated protein 49) (SAP 49) (SF3B50)...; structure genomics,RRM domain,splicing factor 3B; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2dnm_A SRP46 splicing factor; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2x1f_A MRNA 3'-END-processing protein RNA15; transcription-RNA complex, mRNA processing; 1.60A {Saccharomyces cerevisiae} PDB: 2x1b_A 2x1a_A 2km8_B | Back alignment and structure |
|---|
| >2dhg_A TRNA selenocysteine associated protein (SECP43); RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A | Back alignment and structure |
|---|
| >2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C | Back alignment and structure |
|---|
| >2dng_A Eukaryotic translation initiation factor 4H; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} | Back alignment and structure |
|---|
| >3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A | Back alignment and structure |
|---|
| >2do4_A Squamous cell carcinoma antigen recognized by T- cells 3; RRM domaim, RDB, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4b93_B Ankyrin repeat domain-containing protein 27; endocytosis, exocytosis, snare; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2cq0_A Eukaryotic translation initiation factor 3 subunit 4; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A | Back alignment and structure |
|---|
| >2cpz_A CUG triplet repeat RNA-binding protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2rq4_A 2rqc_A | Back alignment and structure |
|---|
| >2cqg_A TDP-43, TAR DNA-binding protein-43; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A | Back alignment and structure |
|---|
| >2dgo_A Cytotoxic granule-associated RNA binding protein 1; RRM domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2rne_A 2dh7_A | Back alignment and structure |
|---|
| >1x5s_A Cold-inducible RNA-binding protein; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2kxn_B Transformer-2 protein homolog beta; SR protein, RRM, splicing factor, RNA protein complex, SMN, binding protein-RNA complex; NMR {Homo sapiens} PDB: 2rra_A 2rrb_A | Back alignment and structure |
|---|
| >2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} | Back alignment and structure |
|---|
| >1x5t_A Splicing factor 3B subunit 4; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2cpf_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >1iqt_A AUF1, heterogeneous nuclear ribonucleoprotein D0; RNA-binding protein, hnRNP, telomere, DNA-binding protein, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wtb_A 1x0f_A | Back alignment and structure |
|---|
| >1wez_A HnRNP H', FTP-3, heterogeneous nuclear ribonucleoprotein H'; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >1x4e_A RNA binding motif, single-stranded interacting protein 2; structural genomics, RRM domain, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >3n9u_C Cleavage and polyadenylation specificity factor S; protein-protein complex, coexpression, heterotetramer, mRNA maturation, mRNA cleavage; 1.92A {Homo sapiens} | Back alignment and structure |
|---|
| >2e5h_A Zinc finger CCHC-type and RNA-binding motif- containing protein 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1wg5_A Heterogeneous nuclear ribonucleoprotein H; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >1x4b_A Heterogeneous nuclear ribonucleoproteins A2/B1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2d9p_A Polyadenylate-binding protein 3; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* | Back alignment and structure |
|---|
| >2j76_E EIF-4B, EIF4B, eukaryotic translation initiation factor 4B; protein biosynthesis, RNA recognition motif, RNA binding domain, RRM, RBD, RNP; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A | Back alignment and structure |
|---|
| >2cqb_A Peptidyl-prolyl CIS-trans isomerase E; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2dgp_A Bruno-like 4, RNA binding protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dgq_A | Back alignment and structure |
|---|
| >2ywk_A Putative RNA-binding protein 11; RRM-domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.54A {Homo sapiens} | Back alignment and structure |
|---|
| >1p1t_A Cleavage stimulation factor, 64 kDa subunit; RNA recognition motif, C-terminal helix, N-terminal helix, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2dnh_A Bruno-like 5, RNA binding protein; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dnk_A 2dno_A | Back alignment and structure |
|---|
| >1sjq_A Polypyrimidine tract-binding protein 1; babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} SCOP: d.211.1.0 PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* | Back alignment and structure |
|---|
| >1oo0_B CG8781-PA, drosophila Y14; RNA recognition motif, splicing, protein complex, EXON junct complex, signaling protein; 1.85A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 2hyi_B* 2j0s_D* 2xb2_D* | Back alignment and structure |
|---|
| >1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B | Back alignment and structure |
|---|
| >2fy1_A RNA-binding motif protein, Y chromosome, family 1 member A1; RNA binding protein, structure, protein-RNA complex, RNA stem-loop, structural protein/RNA complex; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D | Back alignment and structure |
|---|
| >2cqd_A RNA-binding region containing protein 1; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B | Back alignment and structure |
|---|
| >2cph_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2dgv_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2dh9_A | Back alignment and structure |
|---|
| >1u6f_A Tcubp1, RNA-binding protein UBP1; trypanosome, mRNA-binding protein, GU-rich RNA, structure; NMR {Trypanosoma cruzi} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >1uaw_A Mouse-musashi-1; RNP-type structure, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >1wi8_A EIF-4B, eukaryotic translation initiation factor 4B; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >4a8x_A RNA-binding protein with serine-rich domain 1; transcription, splicing, RNA processing, nonsense mediated D NMD, HDAC, histone deacetylation; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
| >1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B | Back alignment and structure |
|---|
| >2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >2hgl_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative, splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kfy_A | Back alignment and structure |
|---|
| >2ki2_A SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA binding proteins, RNA binding protein/SS-DNA binding protein complex; NMR {Helicobacter pylori} | Back alignment and structure |
|---|
| >3lvq_E ARF-GAP with SH3 domain, ANK repeat and PH domain containing protein 3, ADP-ribosylation...; GDP, ASAP3, UPLC1, linkers, alternat splicing; HET: GDP; 3.38A {Homo sapiens} PDB: 3lvr_E* | Back alignment and structure |
|---|
| >2cpy_A RNA-binding protein 12; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2cpe_A RNA-binding protein EWS; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A | Back alignment and structure |
|---|
| >2ek1_A RNA-binding protein 12; RNA recognition motif, dimer, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.00A {Homo sapiens} PDB: 2ek6_A | Back alignment and structure |
|---|
| >2dgw_A Probable RNA-binding protein 19; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2khc_A Testis-specific RNP-type RNA binding protein; RRM, RNA recognition motif, bruno; NMR {Drosophila melanogaster} | Back alignment and structure |
|---|
| >2cq4_A RNA binding motif protein 23; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A | Back alignment and structure |
|---|
| >3ulh_A THO complex subunit 4; nuclear protein, RNA binding, structural genomi center for structural genomics, JCSG, protein structure INI PSI-biology; 2.54A {Homo sapiens} PDB: 1no8_A | Back alignment and structure |
|---|
| >2m2b_A RNA-binding protein 10; T-cell, JCSG, MPP, PSI-biology; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2jwn_A Embryonic polyadenylate-binding protein 2-B; epabp2, poly(A) binding, structural genomics, protein structure initiative, PSI-2; NMR {Xenopus laevis} | Back alignment and structure |
|---|
| >1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 | Back alignment and structure |
|---|
| >2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} | Back alignment and structure |
|---|
| >2hvz_A Splicing factor, arginine/serine-rich 7; RRM, RNA binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2lmi_A GRSF-1, G-rich sequence factor 1; G-rich RNA sequence binding factor, RNA binding domain, STRU genomics, joint center for structural genomics, JCSG; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dgx_A KIAA0430 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2db1_A Heterogeneous nuclear ribonucleoprotein F; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 | Back alignment and structure |
|---|
| >2xs2_A Deleted in azoospermia-like; RNA binding protein-RNA complex; 1.35A {Mus musculus} PDB: 2xs7_A 2xs5_A 2xsf_A | Back alignment and structure |
|---|
| >2hgm_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg0_A | Back alignment and structure |
|---|
| >2cq3_A RNA-binding protein 9; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2dis_A Unnamed protein product; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2cqp_A RNA-binding protein 12; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A | Back alignment and structure |
|---|
| >2cqi_A Nucleolysin TIAR; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, ST genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2krb_A Eukaryotic translation initiation factor 3 subunit B; EIF3, eukaryotic initiation factor, EIF3B, EIF3J; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A | Back alignment and structure |
|---|
| >4b93_B Ankyrin repeat domain-containing protein 27; endocytosis, exocytosis, snare; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >4hbd_A KN motif and ankyrin repeat domain-containing Pro; structural genomics consortium, SGC, protein binding; 1.72A {Homo sapiens} | Back alignment and structure |
|---|
| >3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A | Back alignment and structure |
|---|
| >2lea_A Serine/arginine-rich splicing factor 2; SR protein, RNA binding protein; NMR {Homo sapiens} PDB: 2leb_A 2lec_A | Back alignment and structure |
|---|
| >2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A | Back alignment and structure |
|---|
| >2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} | Back alignment and structure |
|---|
| >1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A | Back alignment and structure |
|---|
| >3ex7_B RNA-binding protein 8A; protein-RNA complex, mRNA processing, mRNA splicing, mRNA transport, nonsense-mediated mRNA decay, nucleus; HET: ADP; 2.30A {Homo sapiens} PDB: 2j0q_D* | Back alignment and structure |
|---|
| >1wel_A RNA-binding protein 12; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2do0_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RNA recognition motif, RRM, RNA binding domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A | Back alignment and structure |
|---|
| >2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A | Back alignment and structure |
|---|
| >2err_A Ataxin-2-binding protein 1; protein-RNA complex, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >1h2v_Z 20 kDa nuclear CAP binding protein; CAP-binding-complex, RNP domain, MIF4G domain, RNA maturation, RNA export, nuclear protein, RNA-binding; 2.0A {Homo sapiens} SCOP: d.58.7.1 PDB: 1h2u_X* 1h2t_Z 1n52_B* 1n54_B 3fex_B 3fey_B 1h6k_X | Back alignment and structure |
|---|
| >1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E | Back alignment and structure |
|---|
| >1fj7_A Nucleolin RBD1, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2ku7_A MLL1 PHD3-CYP33 RRM chimeric protein; transcriptional regulation, RRM domain, transcr; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A | Back alignment and structure |
|---|
| >2dnn_A RNA-binding protein 12; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} | Back alignment and structure |
|---|
| >2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A | Back alignment and structure |
|---|
| >2kt5_A RNA and export factor-binding protein 2; chaperone, mRNA processing, mRNA splicing, transport, nucleus, RNA-binding, spliceosome, transport; NMR {Mus musculus} | Back alignment and structure |
|---|
| >3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} | Back alignment and structure |
|---|
| >2nlw_A Eukaryotic translation initiation factor 3 subunit 9; eukaryotic initiation factor 3 complex, RNA recognition motif; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dha_A FLJ20171 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2wbr_A GW182, gawky, LD47780P; DNA-binding protein, RRM, RBD, TNRC6A, mirnas, P-bodies, argonaute, mRNA decay; NMR {Drosophila melanogaster} | Back alignment and structure |
|---|
| >1x5o_A RNA binding motif, single-stranded interacting protein 1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D | Back alignment and structure |
|---|
| >3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A | Back alignment and structure |
|---|
| >2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} | Back alignment and structure |
|---|
| >1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E | Back alignment and structure |
|---|
| >2cpi_A CCR4-NOT transcription complex subunit 4; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} | Back alignment and structure |
|---|
| >2kn4_A Immunoglobulin G-binding protein G, splicing FACT arginine/serine-rich 2, S35, splicing factor SC35,; RRM domain, cell WALL; NMR {Streptococcus SP} | Back alignment and structure |
|---|
| >1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B | Back alignment and structure |
|---|
| >2hgn_A Heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg1_A | Back alignment and structure |
|---|
| >3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} | Back alignment and structure |
|---|
| >2a3j_A U1 small nuclear ribonucleoprotein A; computationally designed protein, RRM, U1A, RNA binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A | Back alignment and structure |
|---|
| >4g8k_A 2-5A-dependent ribonuclease; ankyrin-repeat domain, single-stranded RNA, hydrolase; 2.40A {Homo sapiens} PDB: 4g8l_A* | Back alignment and structure |
|---|
| >1x4a_A Splicing factor, arginine/serine-rich 1 (splicing factor 2, alternate splicing factor)...; structure genomics, SURP domain, splicing factor SF2; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} | Back alignment and structure |
|---|
| >3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A 4dx1_A 4dx2_A* | Back alignment and structure |
|---|
| >2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A | Back alignment and structure |
|---|
| >3q2s_C Cleavage and polyadenylation specificity factor S; CFIM, CFIM25, CFIM68, CPSF5, CPSF6, CPSF, 3' END processing, processing, cleavage factor; 2.90A {Homo sapiens} PDB: 3q2t_C | Back alignment and structure |
|---|
| >2dnq_A RNA-binding protein 4B; RRM domain,RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A | Back alignment and structure |
|---|
| >3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} PDB: 3t9k_A 4f1p_A | Back alignment and structure |
|---|
| >2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} | Back alignment and structure |
|---|
| >3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >2e5g_A U6 snRNA-specific terminal uridylyltransferase 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* | Back alignment and structure |
|---|
| >2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* | Back alignment and structure |
|---|
| >1rk8_A CG8781-PA, CG8781-PA protein; mRNA processing, RRM, RBD, NMD, oskar mRNA localization, translation; 1.90A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 1hl6_A 2x1g_A | Back alignment and structure |
|---|
| >1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 | Back alignment and structure |
|---|
| >2ad9_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A 4dx1_A 4dx2_A* | Back alignment and structure |
|---|
| >3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 | Back alignment and structure |
|---|
| >3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} | Back alignment and structure |
|---|
| >3r27_A HnRNP L, heterogeneous nuclear ribonucleoprotein L; RBD fold, protein binding, nucleus; 2.04A {Homo sapiens} | Back alignment and structure |
|---|
| >2cq1_A PTB-like protein L; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 | Back alignment and structure |
|---|
| >3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A | Back alignment and structure |
|---|
| >2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* | Back alignment and structure |
|---|
| >2la4_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNA recognition, stress granules, nucleus, RNA-binding, transcription; NMR {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A | Back alignment and structure |
|---|
| >2jvr_A Nucleolar protein 3; RNA recognition motif, nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding; NMR {Saccharomyces cerevisiae} PDB: 2osr_A | Back alignment and structure |
|---|
| >3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A | Back alignment and structure |
|---|
| >1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 | Back alignment and structure |
|---|
| >4g8k_A 2-5A-dependent ribonuclease; ankyrin-repeat domain, single-stranded RNA, hydrolase; 2.40A {Homo sapiens} PDB: 4g8l_A* | Back alignment and structure |
|---|
| >1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A | Back alignment and structure |
|---|
| >3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A | Back alignment and structure |
|---|
| >2fc8_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2fc9_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1x4d_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 | Back alignment and structure |
|---|
| >2lcw_A RNA-binding protein FUS; RRM, nucleic acid binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1wex_A Hypothetical protein (riken cDNA 2810036L13); structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} | Back alignment and structure |
|---|
| >1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 | Back alignment and structure |
|---|
| >3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} | Back alignment and structure |
|---|
| >1nu4_A U1A RNA binding domain; RNA recognition motif, U1 small nuclear ribonucleoprotein, R binding domain, RNA binding protein; HET: MLA; 1.80A {Homo sapiens} SCOP: d.58.7.1 PDB: 1drz_A* 1urn_A 3hhn_B* 3egz_A* 1zzn_A* 1u6b_A* 3cun_A* 3cul_A* 3g8s_A* 3g8t_A* 3g96_A* 3g9c_A* 3irw_P* 3mum_P* 3mur_P* 3mut_P* 3muv_P* 3mxh_P* 3p49_B 3r1h_A* ... | Back alignment and structure |
|---|
| >1why_A Hypothetical protein riken cDNA 1810017N16; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2e5j_A Methenyltetrahydrofolate synthetase domain containing; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ytc_A PRE-mRNA-splicing factor RBM22; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2j8a_A Histone-lysine N-methyltransferase, H3 lysine-4 specific; histone methyltransferase, RRM fold, telomere, nuclear protein; 3.0A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4hbd_A KN motif and ankyrin repeat domain-containing Pro; structural genomics consortium, SGC, protein binding; 1.72A {Homo sapiens} | Back alignment and structure |
|---|
| >2cpx_A Hypothetical protein FLJ11016; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >1x4f_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A | Back alignment and structure |
|---|
| >3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} | Back alignment and structure |
|---|
| >2xnq_A Nuclear polyadenylated RNA-binding protein 3; transcription termination, RNA processi recognition, RRM; HET: CAF; 1.30A {Saccharomyces cerevisiae} PDB: 2xnr_A 2l41_A | Back alignment and structure |
|---|
| >3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} | Back alignment and structure |
|---|
| >3d2w_A TAR DNA-binding protein 43; DP-43 proteinopathy, TDP-43 inclusions, RNA recognition MOTI U, ALS, RRM; HET: DNA; 1.65A {Mus musculus} | Back alignment and structure |
|---|
| >1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 | Back alignment and structure |
|---|
| >1x4g_A Nucleolysin TIAR; structural genomics, RRM domain, TIA-1 related protein, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2cpj_A Non-POU domain-containing octamer-binding protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >1x4c_A Splicing factor, arginine/serine-rich 1; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2jvo_A Nucleolar protein 3; nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding, rRNA processing; NMR {Saccharomyces cerevisiae} PDB: 2osq_A | Back alignment and structure |
|---|
| >1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 | Back alignment and structure |
|---|
| >3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* | Back alignment and structure |
|---|
| >2dnl_A Cytoplasmic polyadenylation element binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dnp_A RNA-binding protein 14; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2f3j_A RNA and export factor binding protein 2; RRM domain, RBD domain., transport protein; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1fjc_A Nucleolin RBD2, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2i2y_A Fusion protein consists of immunoglobin G- binding protein G and splicing factor,...; protein-RNA complex RRM alpha-beta sandwich BETA1-alpha1- BETA2-BETA3-alpha2-BETA4; NMR {Streptococcus SP} PDB: 2i38_A | Back alignment and structure |
|---|
| >1l3k_A Heterogeneous nuclear ribonucleoprotein A1; nuclear protein hnRNP A1, RNA-recognition motif, RNA- binding, UP1, RNA binding protein; 1.10A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1u1k_A* 1u1l_A* 1u1m_A* 1u1n_A* 1u1o_A 1u1p_A* 1u1q_A 1u1r_A* 1pgz_A* 1ha1_A 1po6_A* 2up1_A* 1up1_A | Back alignment and structure |
|---|
| >2cqh_A IGF-II mRNA-binding protein 2 isoform A; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2dgt_A RNA-binding protein 30; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dgu_A Heterogeneous nuclear ribonucleoprotein Q; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dk2_A | Back alignment and structure |
|---|
| >2kvi_A Nuclear polyadenylated RNA-binding protein 3; RNA-binding motif, RRM, transcription termination, NUC phosphoprotein; NMR {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A | Back alignment and structure |
|---|
| >2cjk_A Nuclear polyadenylated RNA-binding protein 4; HRP1, RNA-binding, RNA processing, mRNA processing, nonsense-mediated mRNA decay, cleavage; NMR {Saccharomyces cerevisiae} PDB: 2km8_C | Back alignment and structure |
|---|
| >3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 | Back alignment and structure |
|---|
| >3md3_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNP, RBD, poly(U) binding, tandem, acetylation, cytopla nucleus; 2.70A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} PDB: 3t9k_A 4f1p_A | Back alignment and structure |
|---|
| >3egn_A RNA-binding protein 40; RNA recognition motif (RRM), RNP motif, U11/U12-65K protein, DI-snRNP, U1A protein, U2B protein; 2.50A {Homo sapiens} | Back alignment and structure |
|---|
| >2hzc_A Splicing factor U2AF 65 kDa subunit; RNA splicing, RRM, RNA recognition, alternative conformation binding protein; HET: P6G; 1.47A {Homo sapiens} PDB: 1u2f_A | Back alignment and structure |
|---|
| >2e44_A Insulin-like growth factor 2 mRNA binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1whx_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2cpd_A Apobec-1 stimulating protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2voo_A Lupus LA protein; RNA-binding protein, RNA recognition motif, systemic lupus erythematosus, phosphoprotein, RNA maturation; 1.8A {Homo sapiens} SCOP: a.4.5.46 d.58.7.1 PDB: 2von_A 2vod_A 2vop_A 1zh5_A 1yty_A 1s7a_A | Back alignment and structure |
|---|
| >2g4b_A Splicing factor U2AF 65 kDa subunit; protein-RNA complex, RNA splicing factor, RNA recognition motif, RNA binding protein/RNA complex; 2.50A {Homo sapiens} PDB: 2u2f_A | Back alignment and structure |
|---|
| >2diu_A KIAA0430 protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1wf0_A TDP-43, TAR DNA-binding protein-43; structural genomics, RRM domain, riken structural genomics/proteomics initiative RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} | Back alignment and structure |
|---|
| >1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 | Back alignment and structure |
|---|
| >1wf1_A RNA-binding protein RALY; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wf2_A | Back alignment and structure |
|---|
| >1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 | Back alignment and structure |
|---|
| >2yh0_A Splicing factor U2AF 65 kDa subunit; PRE-mRNA splicing, transcription, RNA binding protein, mRNA processing; NMR {Homo sapiens} PDB: 2yh1_A | Back alignment and structure |
|---|
| >1wg1_A KIAA1579 protein, homolog EXC-7; RBD, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wi6_A | Back alignment and structure |
|---|
| >2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A | Back alignment and structure |
|---|
| >4f02_A Polyadenylate-binding protein 1; mRNA, eukaryotic initiation factors PAIP1 and PAIP2, translation-RNA complex; 2.00A {Homo sapiens} PDB: 1cvj_A* | Back alignment and structure |
|---|
| >1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 | Back alignment and structure |
|---|
| >3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} | Back alignment and structure |
|---|
| >1sjr_A Polypyrimidine tract-binding protein 1; extended babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2adb_A | Back alignment and structure |
|---|
| >3lvq_E ARF-GAP with SH3 domain, ANK repeat and PH domain containing protein 3, ADP-ribosylation...; GDP, ASAP3, UPLC1, linkers, alternat splicing; HET: GDP; 3.38A {Homo sapiens} PDB: 3lvr_E* | Back alignment and structure |
|---|
| >3pgw_S U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_K 2l5i_A 2l5j_A* | Back alignment and structure |
|---|
| >2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} | Back alignment and structure |
|---|
| >3zzy_A Polypyrimidine tract-binding protein 1; protein binding, peptide binding, RNA recognition motif; 1.40A {Homo sapiens} PDB: 3zzz_A | Back alignment and structure |
|---|
| >1x5p_A Negative elongation factor E; structure genomics, RRM domain, PARP14, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >1b7f_A Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP*GP*UP*UP*UP*UP*UP*UP*UP*U)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A | Back alignment and structure |
|---|
| >1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 | Back alignment and structure |
|---|
| >2cq2_A Hypothetical protein LOC91801; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >3beg_B Splicing factor, arginine/serine-rich 1; kinase, SR protein kinase, SR protein, PRE-mRNA splicing, at binding, chromosome partition; HET: SEP ANP; 2.90A {Homo sapiens} SCOP: d.58.7.1 PDB: 2o3d_A 1wg4_A | Back alignment and structure |
|---|
| >1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A | Back alignment and structure |
|---|
| >3sde_A Paraspeckle component 1; RRM, anti parallel right handed coiled-coil, NOPS, DBHS, RNA protein, RNA binding; 1.90A {Homo sapiens} PDB: 3sde_B | Back alignment and structure |
|---|
| >3nmr_A Cugbp ELAV-like family member 1; RRM, PRE-mRNA splicing, RNA binding protein-RNA complex; 1.85A {Homo sapiens} PDB: 3nna_A 3nnc_A 2dhs_A 3nnh_A | Back alignment and structure |
|---|
| >2e5i_A Heterogeneous nuclear ribonucleoprotein L-like; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2pe8_A Splicing factor 45; RRM, protein binding; 2.00A {Homo sapiens} PDB: 2peh_A | Back alignment and structure |
|---|
| >1fje_B Nucleolin RBD12, protein C23; RNP, RRM, RNA binding domain, RNA-protein complex, nucleolus, structural protein/RNA complex; NMR {Mesocricetus auratus} SCOP: d.58.7.1 d.58.7.1 PDB: 1rkj_A 2krr_A | Back alignment and structure |
|---|
| >2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 | Back alignment and structure |
|---|
| >2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A | Back alignment and structure |
|---|
| >3u1l_A PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 1.64A {Saccharomyces cerevisiae} PDB: 3u1m_A 3tp2_A | Back alignment and structure |
|---|
| >2dit_A HIV TAT specific factor 1 variant; structural genomics, RRM_1 domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 | Back alignment and structure |
|---|
| >1jmt_A Splicing factor U2AF 35 kDa subunit; RRM, RNA splicing, proline, PPII helix, peptide recognition, RNA binding protein; 2.20A {Homo sapiens} SCOP: d.58.7.3 | Back alignment and structure |
|---|
| >2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} | Back alignment and structure |
|---|
| >3tyt_A Heterogeneous nuclear ribonucleoprotein L; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 1.60A {Mus musculus} PDB: 3s01_A 3to8_A | Back alignment and structure |
|---|
| >3pgw_A U1-A; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 1fht_A 2u1a_A 2aym_A 2b0g_A | Back alignment and structure |
|---|
| >2d9o_A DNAJ (HSP40) homolog, subfamily C, member 17; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1qm9_A Polypyrimidine tract-binding protein; ribonucleoprotein, RNP, RNA, spicing, translation; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 | Back alignment and structure |
|---|
| >3v4m_A Splicing factor U2AF 65 kDa subunit; canonical RNA binding protein, RNA splicing, structural GENO joint center for structural genomics, JCSG; HET: MSE; 1.80A {Mus musculus} PDB: 1o0p_A 1opi_A | Back alignment and structure |
|---|
| >2adc_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 2evz_A | Back alignment and structure |
|---|
| >3ue2_A Poly(U)-binding-splicing factor PUF60; RNA recognition motif, RRM, RNA binding domain, ST genomics, joint center for structural genomics, JCSG; HET: MSE; 1.23A {Homo sapiens} SCOP: d.58.7.0 PDB: 3us5_A 2dny_A | Back alignment and structure |
|---|
| >3tht_A Alkylated DNA repair protein ALKB homolog 8; structural genomics, PSI-biology, northeast structural genom consortium, NESG; HET: AKG; 3.01A {Homo sapiens} PDB: 3thp_A* | Back alignment and structure |
|---|
| >2dnr_A Synaptojanin-1; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3s6e_A RNA-binding protein 39; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative, PSI-biology; HET: MSE CIT; 0.95A {Mus musculus} PDB: 2lq5_A | Back alignment and structure |
|---|
| >2kn4_A Immunoglobulin G-binding protein G, splicing FACT arginine/serine-rich 2, S35, splicing factor SC35,; RRM domain, cell WALL; NMR {Streptococcus SP} | Back alignment and structure |
|---|
| >1owx_A Lupus LA protein, SS-B, LA; RRM, transcription; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >1ufw_A Synaptojanin 2; RNP domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2i2y_A Fusion protein consists of immunoglobin G- binding protein G and splicing factor,...; protein-RNA complex RRM alpha-beta sandwich BETA1-alpha1- BETA2-BETA3-alpha2-BETA4; NMR {Streptococcus SP} PDB: 2i38_A | Back alignment and structure |
|---|
| >3dxb_A Thioredoxin N-terminally fused to PUF60(UHM); splicing, FBP interacting repressor, RRM, electron TRAN redox-active center, transport; 2.20A {Escherichia coli O157} | Back alignment and structure |
|---|
| >2dhx_A Poly (ADP-ribose) polymerase family, member 10 variant; RRM domain, RNA- binding, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3pgw_S U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_K 2l5i_A 2l5j_A* | Back alignment and structure |
|---|
| >2l9w_A U4/U6 snRNA-associated-splicing factor PRP24; RRM, U6 snRNP, RNA binding protein; NMR {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2lea_A Serine/arginine-rich splicing factor 2; SR protein, RNA binding protein; NMR {Homo sapiens} PDB: 2leb_A 2lec_A | Back alignment and structure |
|---|
| >4fxv_A ELAV-like protein 1; RNA recognition motif, putative RNA-binding domain, transcri structural genomics, joint center for structural genomics; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
| >2lxi_A RNA-binding protein 10; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2lkz_A RNA-binding protein 5; RRM; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3s8s_A Histone-lysine N-methyltransferase SETD1A; chromatin modification, transcription regulation, structural genomics, structural genomics consortium; 1.30A {Homo sapiens} | Back alignment and structure |
|---|
| >1sjq_A Polypyrimidine tract-binding protein 1; babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >1uw4_A UPF3X; nonsense mediated mRNA decay protein, RNA-binding protein, N domain, MIF4G domain; 1.95A {Homo sapiens} SCOP: d.58.7.4 | Back alignment and structure |
|---|
| >2hgn_A Heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg1_A | Back alignment and structure |
|---|
| >2mss_A Protein (musashi1); RNA-binding domain, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 PDB: 2mst_A | Back alignment and structure |
|---|
| >1iqt_A AUF1, heterogeneous nuclear ribonucleoprotein D0; RNA-binding protein, hnRNP, telomere, DNA-binding protein, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wtb_A 1x0f_A | Back alignment and structure |
|---|
| >1wwh_A Nucleoporin 35, nucleoporin; structural genomics, MPPN, riken structural genomics/proteomics initiative, RSGI, protein transport; 2.70A {Mus musculus} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >3p5t_L Cleavage and polyadenylation specificity factor S; RRM domain, poly(A) site recognition, RNA, nuclear, RNA BIND protein; 2.70A {Homo sapiens} PDB: 3p6y_C | Back alignment and structure |
|---|
| >1rk8_A CG8781-PA, CG8781-PA protein; mRNA processing, RRM, RBD, NMD, oskar mRNA localization, translation; 1.90A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 1hl6_A 2x1g_A | Back alignment and structure |
|---|
| >3mdf_A Peptidyl-prolyl CIS-trans isomerase E; RRM domain, PHD finger, CYP33, MLL, RNA binding protein, ISO mRNA processing, mRNA splicing, nucleus; 1.85A {Homo sapiens} SCOP: d.58.7.1 PDB: 2kyx_A 3lpy_A* | Back alignment and structure |
|---|
| >2ad9_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >3ns6_A Eukaryotic translation initiation factor 3 subuni; 1.25A {Saccharomyces cerevisiae} PDB: 3ns5_A | Back alignment and structure |
|---|
| >1uaw_A Mouse-musashi-1; RNP-type structure, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2cqb_A Peptidyl-prolyl CIS-trans isomerase E; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2jrs_A RNA-binding protein 39; RNA binding motif of RBM39_human (caper), RRM2 domain, solution structure, structural genomics, PSI-2; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dgp_A Bruno-like 4, RNA binding protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dgq_A | Back alignment and structure |
|---|
| >4f25_A Polyadenylate-binding protein 1; RRM fold, translation initiation, RNA-binding, EIF4G-binding translation; 1.90A {Homo sapiens} PDB: 4f26_A 2k8g_A | Back alignment and structure |
|---|
| >3r27_A HnRNP L, heterogeneous nuclear ribonucleoprotein L; RBD fold, protein binding, nucleus; 2.04A {Homo sapiens} | Back alignment and structure |
|---|
| >2x1f_A MRNA 3'-END-processing protein RNA15; transcription-RNA complex, mRNA processing; 1.60A {Saccharomyces cerevisiae} PDB: 2x1b_A 2x1a_A 2km8_B | Back alignment and structure |
|---|
| >1x5s_A Cold-inducible RNA-binding protein; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2m2b_A RNA-binding protein 10; T-cell, JCSG, MPP, PSI-biology; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3bs9_A Nucleolysin TIA-1 isoform P40; RNA recognition motif, RRM, RNA binding domain, RBD, RNA splicing, apoptosis, phosphoprotein, RNA-binding; 1.95A {Homo sapiens} | Back alignment and structure |
|---|
| >2rs2_A Musashi-1, RNA-binding protein musashi homolog 1; protein-RNA complex, RRM, RBD, RNA binding protein- complex; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1whw_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >1x5t_A Splicing factor 3B subunit 4; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >1x4h_A RNA-binding protein 28; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >3s7r_A Heterogeneous nuclear ribonucleoprotein A/B; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 2.15A {Homo sapiens} PDB: 1hd0_A 1hd1_A | Back alignment and structure |
|---|
| >1x4e_A RNA binding motif, single-stranded interacting protein 2; structural genomics, RRM domain, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2cph_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >1whv_A Poly(A)-specific ribonuclease; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, PARN, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 PDB: 2rok_A* | Back alignment and structure |
|---|
| >3md1_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RBD, RNP, poly(U) binding, nucleus, RNA-binding, binding protein; 1.60A {Saccharomyces cerevisiae} SCOP: d.58.7.0 | Back alignment and structure |
|---|
| >2e5h_A Zinc finger CCHC-type and RNA-binding motif- containing protein 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2cpz_A CUG triplet repeat RNA-binding protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2rq4_A 2rqc_A | Back alignment and structure |
|---|
| >2div_A TRNA selenocysteine associated protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2lcw_A RNA-binding protein FUS; RRM, nucleic acid binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1oo0_B CG8781-PA, drosophila Y14; RNA recognition motif, splicing, protein complex, EXON junct complex, signaling protein; 1.85A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 2hyi_B* 2j0s_D* 2xb2_D* | Back alignment and structure |
|---|
| >2dnz_A Probable RNA-binding protein 23; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1x5u_A Splicing factor 3B subunit 4 (spliceosome associated protein 49) (SAP 49) (SF3B50)...; structure genomics,RRM domain,splicing factor 3B; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2cq1_A PTB-like protein L; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2la6_A RNA-binding protein FUS; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, RNA recognition; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1p27_B RNA-binding protein 8A; nuclear protein, mRNA splicing; 2.00A {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2cqc_A Arginine/serine-rich splicing factor 10; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2dgs_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2cpe_A RNA-binding protein EWS; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2fy1_A RNA-binding motif protein, Y chromosome, family 1 member A1; RNA binding protein, structure, protein-RNA complex, RNA stem-loop, structural protein/RNA complex; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dgx_A KIAA0430 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2kxn_B Transformer-2 protein homolog beta; SR protein, RRM, splicing factor, RNA protein complex, SMN, binding protein-RNA complex; NMR {Homo sapiens} PDB: 2rra_A 2rrb_A | Back alignment and structure |
|---|
| >2cqg_A TDP-43, TAR DNA-binding protein-43; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >1x4b_A Heterogeneous nuclear ribonucleoproteins A2/B1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >3ex7_B RNA-binding protein 8A; protein-RNA complex, mRNA processing, mRNA splicing, mRNA transport, nonsense-mediated mRNA decay, nucleus; HET: ADP; 2.30A {Homo sapiens} PDB: 2j0q_D* | Back alignment and structure |
|---|
| >2do4_A Squamous cell carcinoma antigen recognized by T- cells 3; RRM domaim, RDB, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dnl_A Cytoplasmic polyadenylation element binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2cq4_A RNA binding motif protein 23; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2cqd_A RNA-binding region containing protein 1; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2jvr_A Nucleolar protein 3; RNA recognition motif, nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding; NMR {Saccharomyces cerevisiae} PDB: 2osr_A | Back alignment and structure |
|---|
| >1s79_A Lupus LA protein; RRM, alpha/beta, RNA binding protein, translation; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >1p1t_A Cleavage stimulation factor, 64 kDa subunit; RNA recognition motif, C-terminal helix, N-terminal helix, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2dnh_A Bruno-like 5, RNA binding protein; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dnk_A 2dno_A | Back alignment and structure |
|---|
| >2err_A Ataxin-2-binding protein 1; protein-RNA complex, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >3n9u_C Cleavage and polyadenylation specificity factor S; protein-protein complex, coexpression, heterotetramer, mRNA maturation, mRNA cleavage; 1.92A {Homo sapiens} | Back alignment and structure |
|---|
| >3ucg_A Polyadenylate-binding protein 2; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative; HET: PGE; 1.95A {Homo sapiens} PDB: 3b4d_A 3b4m_A | Back alignment and structure |
|---|
| >3d2w_A TAR DNA-binding protein 43; DP-43 proteinopathy, TDP-43 inclusions, RNA recognition MOTI U, ALS, RRM; HET: DNA; 1.65A {Mus musculus} | Back alignment and structure |
|---|
| >2jvo_A Nucleolar protein 3; nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding, rRNA processing; NMR {Saccharomyces cerevisiae} PDB: 2osq_A | Back alignment and structure |
|---|
| >2ek1_A RNA-binding protein 12; RNA recognition motif, dimer, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.00A {Homo sapiens} PDB: 2ek6_A | Back alignment and structure |
|---|
| >2cpy_A RNA-binding protein 12; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2dgo_A Cytotoxic granule-associated RNA binding protein 1; RRM domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2rne_A 2dh7_A | Back alignment and structure |
|---|
| >2dnm_A SRP46 splicing factor; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dh8_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1x4d_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2ku7_A MLL1 PHD3-CYP33 RRM chimeric protein; transcriptional regulation, RRM domain, transcr; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2j8a_A Histone-lysine N-methyltransferase, H3 lysine-4 specific; histone methyltransferase, RRM fold, telomere, nuclear protein; 3.0A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2wbr_A GW182, gawky, LD47780P; DNA-binding protein, RRM, RBD, TNRC6A, mirnas, P-bodies, argonaute, mRNA decay; NMR {Drosophila melanogaster} | Back alignment and structure |
|---|
| >2dha_A FLJ20171 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2jwn_A Embryonic polyadenylate-binding protein 2-B; epabp2, poly(A) binding, structural genomics, protein structure initiative, PSI-2; NMR {Xenopus laevis} | Back alignment and structure |
|---|
| >2krb_A Eukaryotic translation initiation factor 3 subunit B; EIF3, eukaryotic initiation factor, EIF3B, EIF3J; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1wg5_A Heterogeneous nuclear ribonucleoprotein H; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2dis_A Unnamed protein product; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >1wey_A Calcipressin 1; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >1wf0_A TDP-43, TAR DNA-binding protein-43; structural genomics, RRM domain, riken structural genomics/proteomics initiative RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2cq0_A Eukaryotic translation initiation factor 3 subunit 4; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2j76_E EIF-4B, EIF4B, eukaryotic translation initiation factor 4B; protein biosynthesis, RNA recognition motif, RNA binding domain, RRM, RBD, RNP; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1whx_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2do0_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RNA recognition motif, RRM, RNA binding domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3beg_B Splicing factor, arginine/serine-rich 1; kinase, SR protein kinase, SR protein, PRE-mRNA splicing, at binding, chromosome partition; HET: SEP ANP; 2.90A {Homo sapiens} SCOP: d.58.7.1 PDB: 2o3d_A 1wg4_A | Back alignment and structure |
|---|
| >1wf1_A RNA-binding protein RALY; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wf2_A | Back alignment and structure |
|---|
| >2cqp_A RNA-binding protein 12; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2d9p_A Polyadenylate-binding protein 3; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2lmi_A GRSF-1, G-rich sequence factor 1; G-rich RNA sequence binding factor, RNA binding domain, STRU genomics, joint center for structural genomics, JCSG; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2kt5_A RNA and export factor-binding protein 2; chaperone, mRNA processing, mRNA splicing, transport, nucleus, RNA-binding, spliceosome, transport; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2dgv_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2dh9_A | Back alignment and structure |
|---|
| >1why_A Hypothetical protein riken cDNA 1810017N16; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2dnn_A RNA-binding protein 12; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1x4f_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2dgt_A RNA-binding protein 30; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1wi8_A EIF-4B, eukaryotic translation initiation factor 4B; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2la4_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNA recognition, stress granules, nucleus, RNA-binding, transcription; NMR {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2ki2_A SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA binding proteins, RNA binding protein/SS-DNA binding protein complex; NMR {Helicobacter pylori} | Back alignment and structure |
|---|
| >2khc_A Testis-specific RNP-type RNA binding protein; RRM, RNA recognition motif, bruno; NMR {Drosophila melanogaster} | Back alignment and structure |
|---|
| >1nu4_A U1A RNA binding domain; RNA recognition motif, U1 small nuclear ribonucleoprotein, R binding domain, RNA binding protein; HET: MLA; 1.80A {Homo sapiens} SCOP: d.58.7.1 PDB: 1drz_A* 1urn_A 3hhn_B* 3egz_A* 1zzn_A* 1u6b_A* 3cun_A* 3cul_A* 3g8s_A* 3g8t_A* 3g96_A* 3g9c_A* 3irw_P* 3mum_P* 3mur_P* 3mut_P* 3muv_P* 3mxh_P* 3p49_B 3r1h_A* ... | Back alignment and structure |
|---|
| >1x4c_A Splicing factor, arginine/serine-rich 1; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2hgl_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative, splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kfy_A | Back alignment and structure |
|---|
| >2dnp_A RNA-binding protein 14; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dnq_A RNA-binding protein 4B; RRM domain,RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2hvz_A Splicing factor, arginine/serine-rich 7; RRM, RNA binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1wel_A RNA-binding protein 12; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >1x4g_A Nucleolysin TIAR; structural genomics, RRM domain, TIA-1 related protein, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >3ulh_A THO complex subunit 4; nuclear protein, RNA binding, structural genomi center for structural genomics, JCSG, protein structure INI PSI-biology; 2.54A {Homo sapiens} PDB: 1no8_A | Back alignment and structure |
|---|
| >1u6f_A Tcubp1, RNA-binding protein UBP1; trypanosome, mRNA-binding protein, GU-rich RNA, structure; NMR {Trypanosoma cruzi} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >1wex_A Hypothetical protein (riken cDNA 2810036L13); structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >1sjr_A Polypyrimidine tract-binding protein 1; extended babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2adb_A | Back alignment and structure |
|---|
| >3lqv_A PRE-mRNA branch site protein P14; cysless mutant, PRE-mRNA splicing, adenine, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: ADE; 2.38A {Homo sapiens} SCOP: d.58.7.1 PDB: 2f9d_A 2f9j_A 2fho_B | Back alignment and structure |
|---|
| >2db1_A Heterogeneous nuclear ribonucleoprotein F; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1wez_A HnRNP H', FTP-3, heterogeneous nuclear ribonucleoprotein H'; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >3zzy_A Polypyrimidine tract-binding protein 1; protein binding, peptide binding, RNA recognition motif; 1.40A {Homo sapiens} PDB: 3zzz_A | Back alignment and structure |
|---|
| >2voo_A Lupus LA protein; RNA-binding protein, RNA recognition motif, systemic lupus erythematosus, phosphoprotein, RNA maturation; 1.8A {Homo sapiens} SCOP: a.4.5.46 d.58.7.1 PDB: 2von_A 2vod_A 2vop_A 1zh5_A 1yty_A 1s7a_A | Back alignment and structure |
|---|
| >1h2v_Z 20 kDa nuclear CAP binding protein; CAP-binding-complex, RNP domain, MIF4G domain, RNA maturation, RNA export, nuclear protein, RNA-binding; 2.0A {Homo sapiens} SCOP: d.58.7.1 PDB: 1h2u_X* 1h2t_Z 1n52_B* 1n54_B 3fex_B 3fey_B 1h6k_X | Back alignment and structure |
|---|
| >3p3d_A Nucleoporin 53; structural genomics, PSI-2, protein structure initiative, NE structural genomix research consortium, nysgxrc; 2.35A {Pichia guilliermondii} | Back alignment and structure |
|---|
| >2dgu_A Heterogeneous nuclear ribonucleoprotein Q; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dk2_A | Back alignment and structure |
|---|
| >2f3j_A RNA and export factor binding protein 2; RRM domain, RBD domain., transport protein; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2e5j_A Methenyltetrahydrofolate synthetase domain containing; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2cq2_A Hypothetical protein LOC91801; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >4a8x_A RNA-binding protein with serine-rich domain 1; transcription, splicing, RNA processing, nonsense mediated D NMD, HDAC, histone deacetylation; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
| >2cqh_A IGF-II mRNA-binding protein 2 isoform A; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2cpx_A Hypothetical protein FLJ11016; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >1fj7_A Nucleolin RBD1, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2e5i_A Heterogeneous nuclear ribonucleoprotein L-like; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2ywk_A Putative RNA-binding protein 11; RRM-domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.54A {Homo sapiens} | Back alignment and structure |
|---|
| >3q2s_C Cleavage and polyadenylation specificity factor S; CFIM, CFIM25, CFIM68, CPSF5, CPSF6, CPSF, 3' END processing, processing, cleavage factor; 2.90A {Homo sapiens} PDB: 3q2t_C | Back alignment and structure |
|---|
| >3ctr_A Poly(A)-specific ribonuclease PARN; protein-RNA-complex, M7G-CAP, M7GTP, RNA recognition motif, RRM, cytoplasm, exonuclease, hydrolase, magnesium; HET: MGP; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >3pq1_A Poly(A) RNA polymerase; nucleotidyl transferase, RNP-type RNA binding domain, poly(A polymerase, mitochondria, transferase; 3.10A {Homo sapiens} | Back alignment and structure |
|---|
| >2hgm_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg0_A | Back alignment and structure |
|---|
| >2e44_A Insulin-like growth factor 2 mRNA binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2cqi_A Nucleolysin TIAR; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, ST genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >1wg1_A KIAA1579 protein, homolog EXC-7; RBD, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wi6_A | Back alignment and structure |
|---|
| >3egn_A RNA-binding protein 40; RNA recognition motif (RRM), RNP motif, U11/U12-65K protein, DI-snRNP, U1A protein, U2B protein; 2.50A {Homo sapiens} | Back alignment and structure |
|---|
| >2cq3_A RNA-binding protein 9; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2dgw_A Probable RNA-binding protein 19; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1x4a_A Splicing factor, arginine/serine-rich 1 (splicing factor 2, alternate splicing factor)...; structure genomics, SURP domain, splicing factor SF2; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2nlw_A Eukaryotic translation initiation factor 3 subunit 9; eukaryotic initiation factor 3 complex, RNA recognition motif; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dng_A Eukaryotic translation initiation factor 4H; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2cpf_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >1x5o_A RNA binding motif, single-stranded interacting protein 1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2l08_A Regulator of nonsense transcripts 3A; NESG, nonsense regulator, structural genomics, PSI-2, protei structure initiative; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ytc_A PRE-mRNA-splicing factor RBM22; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2fc9_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2xs2_A Deleted in azoospermia-like; RNA binding protein-RNA complex; 1.35A {Mus musculus} PDB: 2xs7_A 2xs5_A 2xsf_A | Back alignment and structure |
|---|
| >2dhg_A TRNA selenocysteine associated protein (SECP43); RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2cpj_A Non-POU domain-containing octamer-binding protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2a3j_A U1 small nuclear ribonucleoprotein A; computationally designed protein, RRM, U1A, RNA binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2kvi_A Nuclear polyadenylated RNA-binding protein 3; RNA-binding motif, RRM, transcription termination, NUC phosphoprotein; NMR {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2cpi_A CCR4-NOT transcription complex subunit 4; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2xnq_A Nuclear polyadenylated RNA-binding protein 3; transcription termination, RNA processi recognition, RRM; HET: CAF; 1.30A {Saccharomyces cerevisiae} PDB: 2xnr_A 2l41_A | Back alignment and structure |
|---|
| >2e5g_A U6 snRNA-specific terminal uridylyltransferase 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3u1l_A PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 1.64A {Saccharomyces cerevisiae} PDB: 3u1m_A 3tp2_A | Back alignment and structure |
|---|
| >2cpd_A Apobec-1 stimulating protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2hzc_A Splicing factor U2AF 65 kDa subunit; RNA splicing, RRM, RNA recognition, alternative conformation binding protein; HET: P6G; 1.47A {Homo sapiens} PDB: 1u2f_A | Back alignment and structure |
|---|
| >1fjc_A Nucleolin RBD2, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >3tht_A Alkylated DNA repair protein ALKB homolog 8; structural genomics, PSI-biology, northeast structural genom consortium, NESG; HET: AKG; 3.01A {Homo sapiens} PDB: 3thp_A* | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 347 | ||||
| d1hbka_ | 89 | a.11.1.1 (A:) Acyl-CoA binding protein {Plasmodium | 5e-28 | |
| d1hb6a_ | 86 | a.11.1.1 (A:) Acyl-CoA binding protein {Cow (Bos t | 2e-24 | |
| d1uawa_ | 77 | d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [Tax | 3e-17 | |
| d1x0fa1 | 75 | d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0 | 5e-17 | |
| d2cq4a1 | 101 | d.58.7.1 (A:132-232) RNA binding protein 23 {Human | 8e-17 | |
| d1l3ka1 | 84 | d.58.7.1 (A:8-91) Nuclear ribonucleoprotein A1 (RN | 1e-16 | |
| d2cpha1 | 94 | d.58.7.1 (A:454-547) Probable RNA-binding protein | 2e-16 | |
| d1x4ba1 | 103 | d.58.7.1 (A:8-110) Heterogeneous nuclear ribonucle | 6e-16 | |
| d1hd0a_ | 75 | d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprot | 2e-15 | |
| d2cqga1 | 90 | d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TD | 3e-15 | |
| d1u2fa_ | 90 | d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit | 1e-14 | |
| d1cvja1 | 80 | d.58.7.1 (A:11-90) Poly(A)-binding protein {Human | 5e-14 | |
| d2u2fa_ | 85 | d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit | 2e-13 | |
| d2cpfa1 | 85 | d.58.7.1 (A:362-446) Probable RNA-binding protein | 4e-13 | |
| d1l3ka2 | 79 | d.58.7.1 (A:103-181) Nuclear ribonucleoprotein A1 | 5e-13 | |
| d1b7fa2 | 85 | d.58.7.1 (A:205-289) Sex-lethal protein {Drosophil | 6e-13 | |
| d2msta_ | 75 | d.58.7.1 (A:) Neural RNA-binding protein Musashi-1 | 1e-12 | |
| d1wdya_ | 285 | d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas | 2e-12 | |
| d1wdya_ | 285 | d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas | 2e-08 | |
| d1wdya_ | 285 | d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas | 9e-07 | |
| d1wdya_ | 285 | d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas | 3e-05 | |
| d1wdya_ | 285 | d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas | 4e-05 | |
| d2cqda1 | 103 | d.58.7.1 (A:1-103) RNA-binding region containing p | 2e-12 | |
| d1h2vz_ | 93 | d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding pro | 3e-12 | |
| d1wi8a_ | 104 | d.58.7.1 (A:) Eukaryotic translation initiation fa | 6e-12 | |
| d1fxla2 | 85 | d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Ho | 7e-12 | |
| d1no8a_ | 78 | d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus muscu | 7e-12 | |
| d2fo1e1 | 277 | d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele | 1e-11 | |
| d2fo1e1 | 277 | d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele | 1e-04 | |
| d2fo1e1 | 277 | d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele | 2e-04 | |
| d2cqpa1 | 86 | d.58.7.1 (A:917-1002) RNA-binding protein 12 {Mous | 2e-11 | |
| d1x5ua1 | 93 | d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Hu | 2e-11 | |
| d1b7fa1 | 82 | d.58.7.1 (A:123-204) Sex-lethal protein {Drosophil | 2e-11 | |
| d1whwa_ | 99 | d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm | 3e-11 | |
| d1u1qa_ | 183 | d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1 | 3e-11 | |
| d1u1qa_ | 183 | d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1 | 4e-11 | |
| d1n11a_ | 408 | d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta | 4e-11 | |
| d1n11a_ | 408 | d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta | 2e-10 | |
| d1n11a_ | 408 | d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta | 6e-09 | |
| d1n11a_ | 408 | d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta | 6e-08 | |
| d1n11a_ | 408 | d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta | 1e-06 | |
| d1n11a_ | 408 | d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta | 4e-04 | |
| d1n11a_ | 408 | d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta | 7e-04 | |
| d2f9da1 | 114 | d.58.7.1 (A:12-125) Pre-mRNA branch site protein p | 4e-11 | |
| d1wf2a_ | 98 | d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprot | 4e-11 | |
| d1sw6a_ | 301 | d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker | 2e-10 | |
| d1sw6a_ | 301 | d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker | 9e-09 | |
| d1sw6a_ | 301 | d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker | 1e-05 | |
| d2cqca1 | 83 | d.58.7.1 (A:109-191) Arginine/serine-rich splicing | 2e-10 | |
| d2cqba1 | 89 | d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomer | 3e-10 | |
| d1wf0a_ | 88 | d.58.7.1 (A:) TAR DNA-binding protein 43, TDP-43 { | 4e-10 | |
| d1x5ta1 | 83 | d.58.7.1 (A:8-90) Splicing factor 3B subunit 4 {Hu | 4e-10 | |
| d1wg5a_ | 104 | d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprot | 5e-10 | |
| d2cpya1 | 103 | d.58.7.1 (A:536-638) RNA-binding protein 12 {Human | 8e-10 | |
| d1fjca_ | 96 | d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocrice | 1e-09 | |
| d1x4aa1 | 95 | d.58.7.1 (A:9-103) Splicing factor, arginine/serin | 1e-09 | |
| d1cvja2 | 89 | d.58.7.1 (A:91-179) Poly(A)-binding protein {Human | 1e-09 | |
| d1fxla1 | 82 | d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Hom | 1e-09 | |
| d2disa1 | 96 | d.58.7.1 (A:8-103) Hypothetical protein FLJ20273 { | 2e-09 | |
| d2cq0a1 | 90 | d.58.7.1 (A:231-320) Eukaryotic translation initia | 2e-09 | |
| d2cqha1 | 80 | d.58.7.1 (A:2-81) IGF-II mRNA-binding protein 2 is | 3e-09 | |
| d1x4ha1 | 98 | d.58.7.1 (A:8-105) RNA-binding protein 28 {Mouse ( | 4e-09 | |
| d2cq3a1 | 93 | d.58.7.1 (A:110-202) RNA-binding protein 9 {Human | 4e-09 | |
| d2cpja1 | 86 | d.58.7.1 (A:65-150) Non-POU domain-containing octa | 6e-09 | |
| d2cpza1 | 102 | d.58.7.1 (A:383-484) CUG triplet repeat RNA-bindin | 6e-09 | |
| d2ghpa1 | 81 | d.58.7.1 (A:116-196) U4/U6 snRNA-associated-splici | 9e-09 | |
| d1weza_ | 102 | d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprot | 2e-08 | |
| d1nu4a_ | 91 | d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo | 3e-08 | |
| d1x5sa1 | 90 | d.58.7.1 (A:8-97) Cold-inducible RNA-binding prote | 4e-08 | |
| d2ajaa1 | 346 | a.118.24.1 (A:3-348) Hypothetical protein LPG2416 | 4e-08 | |
| d2ajaa1 | 346 | a.118.24.1 (A:3-348) Hypothetical protein LPG2416 | 7e-06 | |
| d2ajaa1 | 346 | a.118.24.1 (A:3-348) Hypothetical protein LPG2416 | 4e-04 | |
| d1k1aa_ | 228 | d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: | 5e-08 | |
| d1k1aa_ | 228 | d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: | 2e-06 | |
| d1k1aa_ | 228 | d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: | 0.003 | |
| d1s70b_ | 291 | d.211.1.1 (B:) Myosin phosphatase targeting subuni | 7e-08 | |
| d1s70b_ | 291 | d.211.1.1 (B:) Myosin phosphatase targeting subuni | 2e-06 | |
| d1s70b_ | 291 | d.211.1.1 (B:) Myosin phosphatase targeting subuni | 6e-06 | |
| d2ghpa3 | 86 | d.58.7.1 (A:206-291) U4/U6 snRNA-associated-splici | 8e-08 | |
| d1wela1 | 112 | d.58.7.1 (A:412-523) RNA-binding protein 12 {Human | 9e-08 | |
| d1rk8a_ | 88 | d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Dr | 1e-07 | |
| d1p1ta_ | 104 | d.58.7.1 (A:) Cleavage stimulation factor, 64 kda | 1e-07 | |
| d2cpea1 | 101 | d.58.7.1 (A:353-453) RNA-binding protein EWS {Huma | 1e-07 | |
| d1ixva_ | 229 | d.211.1.1 (A:) 26S proteasome non-ATPase regulator | 2e-07 | |
| d1ixva_ | 229 | d.211.1.1 (A:) 26S proteasome non-ATPase regulator | 1e-06 | |
| d2cpxa1 | 102 | d.58.7.1 (A:291-392) RNA-binding protein 41, RBM41 | 2e-07 | |
| d2adba1 | 108 | d.58.7.1 (A:177-284) Polypyrimidine tract-binding | 3e-07 | |
| d1zh5a2 | 85 | d.58.7.1 (A:105-189) Lupus LA protein {Human (Homo | 3e-07 | |
| d2ghpa2 | 75 | d.58.7.1 (A:41-115) U4/U6 snRNA-associated-splicin | 3e-07 | |
| d1fjeb1 | 91 | d.58.7.1 (B:1-91) Nucleolin {Golden hamster (Mesoc | 3e-07 | |
| d2cpia1 | 89 | d.58.7.1 (A:101-189) E3 ubiquitin protein ligase C | 3e-07 | |
| d2cpda1 | 86 | d.58.7.1 (A:223-308) APOBEC1 stimulating protein { | 3e-07 | |
| d1x4ga1 | 96 | d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo s | 3e-07 | |
| d2cqia1 | 90 | d.58.7.1 (A:1-90) Nucleolysin TIAR {Human (Homo sa | 4e-07 | |
| d1uoha_ | 223 | d.211.1.1 (A:) 26S proteasome non-ATPase regulator | 6e-07 | |
| d1uoha_ | 223 | d.211.1.1 (A:) 26S proteasome non-ATPase regulator | 2e-05 | |
| d1uoha_ | 223 | d.211.1.1 (A:) 26S proteasome non-ATPase regulator | 2e-04 | |
| d1uoha_ | 223 | d.211.1.1 (A:) 26S proteasome non-ATPase regulator | 0.002 | |
| d1u6fa1 | 139 | d.58.7.1 (A:1-139) RNA-binding protein UBP1 {Trypa | 1e-06 | |
| d2bz2a1 | 79 | d.58.7.1 (A:35-113) Negative elongation factor E, | 2e-06 | |
| d1wwha1 | 81 | d.58.7.1 (A:169-249) Nucleoporin 35 {Mouse (Mus mu | 2e-06 | |
| d1oy3d_ | 255 | d.211.1.1 (D:) Transcription factor inhibitor I-ka | 2e-06 | |
| d1oy3d_ | 255 | d.211.1.1 (D:) Transcription factor inhibitor I-ka | 2e-06 | |
| d1oy3d_ | 255 | d.211.1.1 (D:) Transcription factor inhibitor I-ka | 1e-04 | |
| d1weya_ | 104 | d.58.7.1 (A:) Calcipressin-1 {Mouse (Mus musculus) | 1e-05 | |
| d1wg4a_ | 98 | d.58.7.1 (A:) Splicing factor, arginine/serine-ric | 1e-05 | |
| d1ot8a_ | 209 | d.211.1.1 (A:) Neurogenic locus notch receptor dom | 1e-05 | |
| d1x4ea1 | 72 | d.58.7.1 (A:8-79) RNA-binding motif, single-strand | 2e-05 | |
| d1ihba_ | 156 | d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens | 4e-05 | |
| d1wg1a_ | 88 | d.58.7.1 (A:) Probable RNA-binding protein KIAA157 | 5e-05 | |
| d1bd8a_ | 156 | d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Huma | 7e-05 | |
| d1bd8a_ | 156 | d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Huma | 0.002 | |
| U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]} Length = 104" target="_blank" href="http://scop.mrc-lmb.cam.ac.uk/scop/search.cgi?sid=d1jmta_">d1jmta_ | 104 | d.58.7.3 (A:) 7e-05 | ||
| d1whya_ | 97 | d.58.7.1 (A:) Putative RNA-binding protein 15B, Rb | 2e-04 | |
| d1wi6a1 | 75 | d.58.7.1 (A:69-143) Ribonucleoprotein PTB-binding | 2e-04 | |
| d1iknd_ | 221 | d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien | 3e-04 | |
| d1iknd_ | 221 | d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien | 3e-04 | |
| d1x4da1 | 89 | d.58.7.1 (A:8-96) Matrin 3 {Mouse (Mus musculus) [ | 3e-04 | |
| d2adca1 | 109 | d.58.7.1 (A:335-443) Polypyrimidine tract-binding | 5e-04 | |
| d2dita1 | 99 | d.58.7.1 (A:8-106) HIV Tat-specific factor 1 {Huma | 0.001 | |
| d2adca2 | 88 | d.58.7.1 (A:444-531) Polypyrimidine tract-binding | 0.001 | |
| d1x5oa1 | 101 | d.58.7.1 (A:8-108) RNA-binding motif, single-stran | 0.001 | |
| d1awcb_ | 153 | d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 { | 0.002 | |
| d2cq2a1 | 101 | d.58.7.1 (A:25-125) Alkylation repair AlkB homolog | 0.002 | |
| d1ycsb1 | 130 | d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) | 0.003 |
| >d1hbka_ a.11.1.1 (A:) Acyl-CoA binding protein {Plasmodium falciparum [TaxId: 5833]} Length = 89 | Back information, alignment and structure |
|---|
class: All alpha proteins fold: Acyl-CoA binding protein-like superfamily: Acyl-CoA binding protein family: Acyl-CoA binding protein domain: Acyl-CoA binding protein species: Plasmodium falciparum [TaxId: 5833]
Score = 102 bits (256), Expect = 5e-28
Identities = 26/89 (29%), Positives = 47/89 (52%), Gaps = 2/89 (2%)
Query: 93 NMEDRFNQACDYLPSLVK--KLDSSTLLKFYALYKQATVGQCNIDKPSWYNMEAKSKYNA 150
+M F + ++ L + L + L Y YKQ+T+G CNI +PS + + KY A
Sbjct: 1 HMAQVFEECVSFINGLPRTINLPNELKLDLYKYYKQSTIGNCNIKEPSAHKYIDRKKYEA 60
Query: 151 WNSLGQMAKSEAMSKYIALLKEVDAGWED 179
W S+ + + +A +Y+ ++ E+ W+D
Sbjct: 61 WKSVENLNREDAQKRYVDIVSEIFPYWQD 89
|
| >d1hb6a_ a.11.1.1 (A:) Acyl-CoA binding protein {Cow (Bos taurus) [TaxId: 9913]} Length = 86 | Back information, alignment and structure |
|---|
| >d1uawa_ d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 77 | Back information, alignment and structure |
|---|
| >d1x0fa1 d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo sapiens) [TaxId: 9606]} Length = 75 | Back information, alignment and structure |
|---|
| >d2cq4a1 d.58.7.1 (A:132-232) RNA binding protein 23 {Human (Homo sapiens) [TaxId: 9606]} Length = 101 | Back information, alignment and structure |
|---|
| >d1l3ka1 d.58.7.1 (A:8-91) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 84 | Back information, alignment and structure |
|---|
| >d2cpha1 d.58.7.1 (A:454-547) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 94 | Back information, alignment and structure |
|---|
| >d1x4ba1 d.58.7.1 (A:8-110) Heterogeneous nuclear ribonucleoproteins A2/B1 {Human (Homo sapiens) [TaxId: 9606]} Length = 103 | Back information, alignment and structure |
|---|
| >d1hd0a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein d0 {Human (Homo sapiens) [TaxId: 9606]} Length = 75 | Back information, alignment and structure |
|---|
| >d2cqga1 d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Length = 90 | Back information, alignment and structure |
|---|
| >d1u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 90 | Back information, alignment and structure |
|---|
| >d1cvja1 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 80 | Back information, alignment and structure |
|---|
| >d2u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 85 | Back information, alignment and structure |
|---|
| >d2cpfa1 d.58.7.1 (A:362-446) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 85 | Back information, alignment and structure |
|---|
| >d1l3ka2 d.58.7.1 (A:103-181) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 79 | Back information, alignment and structure |
|---|
| >d1b7fa2 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Length = 85 | Back information, alignment and structure |
|---|
| >d2msta_ d.58.7.1 (A:) Neural RNA-binding protein Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 75 | Back information, alignment and structure |
|---|
| >d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 | Back information, alignment and structure |
|---|
| >d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 | Back information, alignment and structure |
|---|
| >d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 | Back information, alignment and structure |
|---|
| >d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 | Back information, alignment and structure |
|---|
| >d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 | Back information, alignment and structure |
|---|
| >d2cqda1 d.58.7.1 (A:1-103) RNA-binding region containing protein 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 103 | Back information, alignment and structure |
|---|
| >d1h2vz_ d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 93 | Back information, alignment and structure |
|---|
| >d1wi8a_ d.58.7.1 (A:) Eukaryotic translation initiation factor 4B {Human (Homo sapiens) [TaxId: 9606]} Length = 104 | Back information, alignment and structure |
|---|
| >d1fxla2 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Length = 85 | Back information, alignment and structure |
|---|
| >d1no8a_ d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 10090]} Length = 78 | Back information, alignment and structure |
|---|
| >d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 | Back information, alignment and structure |
|---|
| >d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 | Back information, alignment and structure |
|---|
| >d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 | Back information, alignment and structure |
|---|
| >d2cqpa1 d.58.7.1 (A:917-1002) RNA-binding protein 12 {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 | Back information, alignment and structure |
|---|
| >d1x5ua1 d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Length = 93 | Back information, alignment and structure |
|---|
| >d1b7fa1 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Length = 82 | Back information, alignment and structure |
|---|
| >d1whwa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 99 | Back information, alignment and structure |
|---|
| >d1u1qa_ d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 183 | Back information, alignment and structure |
|---|
| >d1u1qa_ d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 183 | Back information, alignment and structure |
|---|
| >d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 | Back information, alignment and structure |
|---|
| >d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 | Back information, alignment and structure |
|---|
| >d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 | Back information, alignment and structure |
|---|
| >d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 | Back information, alignment and structure |
|---|
| >d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 | Back information, alignment and structure |
|---|
| >d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 | Back information, alignment and structure |
|---|
| >d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 | Back information, alignment and structure |
|---|
| >d2f9da1 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p14 {Human (Homo sapiens) [TaxId: 9606]} Length = 114 | Back information, alignment and structure |
|---|
| >d1wf2a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoproteins C1/C2 {Human (Homo sapiens) [TaxId: 9606]} Length = 98 | Back information, alignment and structure |
|---|
| >d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 | Back information, alignment and structure |
|---|
| >d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 | Back information, alignment and structure |
|---|
| >d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 | Back information, alignment and structure |
|---|
| >d2cqca1 d.58.7.1 (A:109-191) Arginine/serine-rich splicing factor 10 {Human (Homo sapiens) [TaxId: 9606]} Length = 83 | Back information, alignment and structure |
|---|
| >d2cqba1 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomerase E, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 89 | Back information, alignment and structure |
|---|
| >d1wf0a_ d.58.7.1 (A:) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 | Back information, alignment and structure |
|---|
| >d1x5ta1 d.58.7.1 (A:8-90) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Length = 83 | Back information, alignment and structure |
|---|
| >d1wg5a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} Length = 104 | Back information, alignment and structure |
|---|
| >d2cpya1 d.58.7.1 (A:536-638) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} Length = 103 | Back information, alignment and structure |
|---|
| >d1fjca_ d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Length = 96 | Back information, alignment and structure |
|---|
| >d1x4aa1 d.58.7.1 (A:9-103) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Length = 95 | Back information, alignment and structure |
|---|
| >d1cvja2 d.58.7.1 (A:91-179) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 89 | Back information, alignment and structure |
|---|
| >d1fxla1 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Length = 82 | Back information, alignment and structure |
|---|
| >d2disa1 d.58.7.1 (A:8-103) Hypothetical protein FLJ20273 {Human (Homo sapiens) [TaxId: 9606]} Length = 96 | Back information, alignment and structure |
|---|
| >d2cq0a1 d.58.7.1 (A:231-320) Eukaryotic translation initiation factor 3 subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Length = 90 | Back information, alignment and structure |
|---|
| >d2cqha1 d.58.7.1 (A:2-81) IGF-II mRNA-binding protein 2 isoform A {Human (Homo sapiens) [TaxId: 9606]} Length = 80 | Back information, alignment and structure |
|---|
| >d1x4ha1 d.58.7.1 (A:8-105) RNA-binding protein 28 {Mouse (Mus musculus) [TaxId: 10090]} Length = 98 | Back information, alignment and structure |
|---|
| >d2cq3a1 d.58.7.1 (A:110-202) RNA-binding protein 9 {Human (Homo sapiens) [TaxId: 9606]} Length = 93 | Back information, alignment and structure |
|---|
| >d2cpja1 d.58.7.1 (A:65-150) Non-POU domain-containing octamer-binding protein, NonO {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 | Back information, alignment and structure |
|---|
| >d2cpza1 d.58.7.1 (A:383-484) CUG triplet repeat RNA-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 102 | Back information, alignment and structure |
|---|
| >d2ghpa1 d.58.7.1 (A:116-196) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 81 | Back information, alignment and structure |
|---|
| >d1weza_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} Length = 102 | Back information, alignment and structure |
|---|
| >d1nu4a_ d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo sapiens) [TaxId: 9606]} Length = 91 | Back information, alignment and structure |
|---|
| >d1x5sa1 d.58.7.1 (A:8-97) Cold-inducible RNA-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 90 | Back information, alignment and structure |
|---|
| >d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 | Back information, alignment and structure |
|---|
| >d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 | Back information, alignment and structure |
|---|
| >d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 | Back information, alignment and structure |
|---|
| >d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 | Back information, alignment and structure |
|---|
| >d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 | Back information, alignment and structure |
|---|
| >d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 | Back information, alignment and structure |
|---|
| >d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 | Back information, alignment and structure |
|---|
| >d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 | Back information, alignment and structure |
|---|
| >d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 | Back information, alignment and structure |
|---|
| >d2ghpa3 d.58.7.1 (A:206-291) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 86 | Back information, alignment and structure |
|---|
| >d1wela1 d.58.7.1 (A:412-523) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} Length = 112 | Back information, alignment and structure |
|---|
| >d1rk8a_ d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 88 | Back information, alignment and structure |
|---|
| >d1p1ta_ d.58.7.1 (A:) Cleavage stimulation factor, 64 kda subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 104 | Back information, alignment and structure |
|---|
| >d2cpea1 d.58.7.1 (A:353-453) RNA-binding protein EWS {Human (Homo sapiens) [TaxId: 9606]} Length = 101 | Back information, alignment and structure |
|---|
| >d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 | Back information, alignment and structure |
|---|
| >d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 | Back information, alignment and structure |
|---|
| >d2cpxa1 d.58.7.1 (A:291-392) RNA-binding protein 41, RBM41 {Human (Homo sapiens) [TaxId: 9606]} Length = 102 | Back information, alignment and structure |
|---|
| >d2adba1 d.58.7.1 (A:177-284) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 108 | Back information, alignment and structure |
|---|
| >d1zh5a2 d.58.7.1 (A:105-189) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Length = 85 | Back information, alignment and structure |
|---|
| >d2ghpa2 d.58.7.1 (A:41-115) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 75 | Back information, alignment and structure |
|---|
| >d1fjeb1 d.58.7.1 (B:1-91) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Length = 91 | Back information, alignment and structure |
|---|
| >d2cpia1 d.58.7.1 (A:101-189) E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musculus) [TaxId: 10090]} Length = 89 | Back information, alignment and structure |
|---|
| >d2cpda1 d.58.7.1 (A:223-308) APOBEC1 stimulating protein {Human (Homo sapiens) [TaxId: 9606]} Length = 86 | Back information, alignment and structure |
|---|
| >d1x4ga1 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Length = 96 | Back information, alignment and structure |
|---|
| >d2cqia1 d.58.7.1 (A:1-90) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Length = 90 | Back information, alignment and structure |
|---|
| >d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 | Back information, alignment and structure |
|---|
| >d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 | Back information, alignment and structure |
|---|
| >d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 | Back information, alignment and structure |
|---|
| >d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 | Back information, alignment and structure |
|---|
| >d1u6fa1 d.58.7.1 (A:1-139) RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId: 5693]} Length = 139 | Back information, alignment and structure |
|---|
| >d2bz2a1 d.58.7.1 (A:35-113) Negative elongation factor E, NELF-E {Human (Homo sapiens) [TaxId: 9606]} Length = 79 | Back information, alignment and structure |
|---|
| >d1wwha1 d.58.7.1 (A:169-249) Nucleoporin 35 {Mouse (Mus musculus) [TaxId: 10090]} Length = 81 | Back information, alignment and structure |
|---|
| >d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 | Back information, alignment and structure |
|---|
| >d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 | Back information, alignment and structure |
|---|
| >d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 | Back information, alignment and structure |
|---|
| >d1weya_ d.58.7.1 (A:) Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 104 | Back information, alignment and structure |
|---|
| >d1wg4a_ d.58.7.1 (A:) Splicing factor, arginine/serine-rich 9 (SFRS9) {Mouse (Mus musculus) [TaxId: 10090]} Length = 98 | Back information, alignment and structure |
|---|
| >d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 | Back information, alignment and structure |
|---|
| >d1x4ea1 d.58.7.1 (A:8-79) RNA-binding motif, single-stranded-interacting protein 2, RBMS2 {Human (Homo sapiens) [TaxId: 9606]} Length = 72 | Back information, alignment and structure |
|---|
| >d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Length = 156 | Back information, alignment and structure |
|---|
| >d1wg1a_ d.58.7.1 (A:) Probable RNA-binding protein KIAA1579 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 | Back information, alignment and structure |
|---|
| >d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Length = 156 | Back information, alignment and structure |
|---|
| >d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Length = 156 | Back information, alignment and structure |
|---|
| >d1jmta_ d.58.7.3 (A:) U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]} Length = 104 | Back information, alignment and structure |
|---|
| >d1whya_ d.58.7.1 (A:) Putative RNA-binding protein 15B, Rbm15b {Mouse (Mus musculus) [TaxId: 10090]} Length = 97 | Back information, alignment and structure |
|---|
| >d1wi6a1 d.58.7.1 (A:69-143) Ribonucleoprotein PTB-binding 1, Raver-1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 75 | Back information, alignment and structure |
|---|
| >d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 | Back information, alignment and structure |
|---|
| >d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 | Back information, alignment and structure |
|---|
| >d1x4da1 d.58.7.1 (A:8-96) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} Length = 89 | Back information, alignment and structure |
|---|
| >d2adca1 d.58.7.1 (A:335-443) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 109 | Back information, alignment and structure |
|---|
| >d2dita1 d.58.7.1 (A:8-106) HIV Tat-specific factor 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 99 | Back information, alignment and structure |
|---|
| >d2adca2 d.58.7.1 (A:444-531) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 88 | Back information, alignment and structure |
|---|
| >d1x5oa1 d.58.7.1 (A:8-108) RNA-binding motif, single-stranded-interacting protein 1, RBMS1 {Human (Homo sapiens) [TaxId: 9606]} Length = 101 | Back information, alignment and structure |
|---|
| >d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 153 | Back information, alignment and structure |
|---|
| >d2cq2a1 d.58.7.1 (A:25-125) Alkylation repair AlkB homolog 8, ALKBH8 {Human (Homo sapiens) [TaxId: 9606]} Length = 101 | Back information, alignment and structure |
|---|
| >d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 130 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 347 | |||
| d1u1qa_ | 183 | Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human | 99.87 | |
| d1l3ka1 | 84 | Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human | 99.86 | |
| d2cqga1 | 90 | TAR DNA-binding protein 43, TDP-43 {Human (Homo sa | 99.85 | |
| d1hd0a_ | 75 | Heterogeneous nuclear ribonucleoprotein d0 {Human | 99.84 | |
| d1uawa_ | 77 | Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} | 99.84 | |
| d1x0fa1 | 75 | Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo s | 99.84 | |
| d1x4ba1 | 103 | Heterogeneous nuclear ribonucleoproteins A2/B1 {Hu | 99.84 | |
| d1x5ua1 | 93 | Splicing factor 3B subunit 4 {Human (Homo sapiens) | 99.83 | |
| d1l3ka2 | 79 | Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human | 99.83 | |
| d1hbka_ | 89 | Acyl-CoA binding protein {Plasmodium falciparum [T | 99.83 | |
| d1hb6a_ | 86 | Acyl-CoA binding protein {Cow (Bos taurus) [TaxId: | 99.83 | |
| d1b7fa1 | 82 | Sex-lethal protein {Drosophila melanogaster [TaxId | 99.83 | |
| d1cvja1 | 80 | Poly(A)-binding protein {Human (Homo sapiens) [Tax | 99.83 | |
| d2u2fa_ | 85 | Splicing factor U2AF 65 KDa subunit {Human (Homo s | 99.82 | |
| d2cq4a1 | 101 | RNA binding protein 23 {Human (Homo sapiens) [TaxI | 99.82 | |
| d2cqba1 | 89 | Peptidyl-prolyl cis-trans isomerase E, N-terminal | 99.82 | |
| d1rk8a_ | 88 | RNA-binding protein 8 {Fruit fly (Drosophila melan | 99.82 | |
| d1fxla1 | 82 | Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9 | 99.82 | |
| d1h2vz_ | 93 | CBP20, 20KDa nuclear cap-binding protein {Human (H | 99.82 | |
| d2cqca1 | 83 | Arginine/serine-rich splicing factor 10 {Human (Ho | 99.82 | |
| d2cq0a1 | 90 | Eukaryotic translation initiation factor 3 subunit | 99.81 | |
| d1fxla2 | 85 | Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9 | 99.81 | |
| d1whwa_ | 99 | Probable RNA-binding protein 19, Rbm19 {Mouse (Mus | 99.81 | |
| d2cqda1 | 103 | RNA-binding region containing protein 1 {Human (Ho | 99.81 | |
| d1ycsb1 | 130 | 53BP2 {Human (Homo sapiens) [TaxId: 9606]} | 99.81 | |
| d1b7fa2 | 85 | Sex-lethal protein {Drosophila melanogaster [TaxId | 99.81 | |
| d2cpza1 | 102 | CUG triplet repeat RNA-binding protein 1 {Human (H | 99.81 | |
| d1x5sa1 | 90 | Cold-inducible RNA-binding protein {Human (Homo sa | 99.81 | |
| d1dcqa1 | 154 | Pyk2-associated protein beta {Mouse (Mus musculus) | 99.8 | |
| d1myoa_ | 118 | Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116] | 99.8 | |
| d1u6fa1 | 139 | RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId | 99.8 | |
| d2msta_ | 75 | Neural RNA-binding protein Musashi-1 {Mouse (Mus m | 99.8 | |
| d2cpha1 | 94 | Probable RNA-binding protein 19, Rbm19 {Mouse (Mus | 99.8 | |
| d1p1ta_ | 104 | Cleavage stimulation factor, 64 kda subunit {Human | 99.8 | |
| d2cqia1 | 90 | Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 960 | 99.79 | |
| d1x4ha1 | 98 | RNA-binding protein 28 {Mouse (Mus musculus) [TaxI | 99.79 | |
| d1no8a_ | 78 | Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 1 | 99.79 | |
| d1x5ta1 | 83 | Splicing factor 3B subunit 4 {Human (Homo sapiens) | 99.79 | |
| d2cpfa1 | 85 | Probable RNA-binding protein 19, Rbm19 {Mouse (Mus | 99.79 | |
| d2ghpa3 | 86 | U4/U6 snRNA-associated-splicing factor PRP24 {Bake | 99.79 | |
| d2ghpa1 | 81 | U4/U6 snRNA-associated-splicing factor PRP24 {Bake | 99.78 | |
| d1zh5a2 | 85 | Lupus LA protein {Human (Homo sapiens) [TaxId: 960 | 99.78 | |
| d2cq3a1 | 93 | RNA-binding protein 9 {Human (Homo sapiens) [TaxId | 99.77 | |
| d1cvja2 | 89 | Poly(A)-binding protein {Human (Homo sapiens) [Tax | 99.77 | |
| d2f9da1 | 114 | Pre-mRNA branch site protein p14 {Human (Homo sapi | 99.76 | |
| d1fjeb1 | 91 | Nucleolin {Golden hamster (Mesocricetus auratus) [ | 99.76 | |
| d2ghpa2 | 75 | U4/U6 snRNA-associated-splicing factor PRP24 {Bake | 99.75 | |
| d2cpea1 | 101 | RNA-binding protein EWS {Human (Homo sapiens) [Tax | 99.75 | |
| d1x5oa1 | 101 | RNA-binding motif, single-stranded-interacting pro | 99.75 | |
| d1bi7b_ | 125 | Cell cycle inhibitor p16ink4A {Human (Homo sapiens | 99.74 | |
| d1oy3d_ | 255 | Transcription factor inhibitor I-kappa-B-beta, IKB | 99.74 | |
| d2cpxa1 | 102 | RNA-binding protein 41, RBM41 {Human (Homo sapiens | 99.73 | |
| d1wg5a_ | 104 | Heterogeneous nuclear ribonucleoprotein H' {Human | 99.73 | |
| d1x4aa1 | 95 | Splicing factor, arginine/serine-rich 1, SFRS1 {Hu | 99.72 | |
| d1x4ea1 | 72 | RNA-binding motif, single-stranded-interacting pro | 99.72 | |
| d1wi8a_ | 104 | Eukaryotic translation initiation factor 4B {Human | 99.71 | |
| d2disa1 | 96 | Hypothetical protein FLJ20273 {Human (Homo sapiens | 99.71 | |
| d2cpia1 | 89 | E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musc | 99.71 | |
| d1wf0a_ | 88 | TAR DNA-binding protein 43, TDP-43 {Human (Homo sa | 99.7 | |
| d1fjca_ | 96 | Nucleolin {Golden hamster (Mesocricetus auratus) [ | 99.7 | |
| d1x4ga1 | 96 | Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 960 | 99.7 | |
| d1ycsb1 | 130 | 53BP2 {Human (Homo sapiens) [TaxId: 9606]} | 99.69 | |
| d1weza_ | 102 | Heterogeneous nuclear ribonucleoprotein H' {Human | 99.69 | |
| d2cqha1 | 80 | IGF-II mRNA-binding protein 2 isoform A {Human (Ho | 99.69 | |
| d2cpda1 | 86 | APOBEC1 stimulating protein {Human (Homo sapiens) | 99.69 | |
| d1ot8a_ | 209 | Neurogenic locus notch receptor domain {Fruit fly | 99.69 | |
| d2cqpa1 | 86 | RNA-binding protein 12 {Mouse (Mus musculus) [TaxI | 99.69 | |
| d2cpja1 | 86 | Non-POU domain-containing octamer-binding protein, | 99.69 | |
| d1bd8a_ | 156 | Cell cycle inhibitor p19ink4D {Human (Homo sapiens | 99.69 | |
| d1myoa_ | 118 | Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116] | 99.68 | |
| d2bz2a1 | 79 | Negative elongation factor E, NELF-E {Human (Homo | 99.68 | |
| d1wela1 | 112 | RNA-binding protein 12 {Human (Homo sapiens) [TaxI | 99.68 | |
| d2cpya1 | 103 | RNA-binding protein 12 {Human (Homo sapiens) [TaxI | 99.68 | |
| d1nu4a_ | 91 | Splicesomal U1A protein {Human (Homo sapiens) [Tax | 99.67 | |
| d1uoha_ | 223 | 26S proteasome non-ATPase regulatory subunit 10, g | 99.67 | |
| d1whxa_ | 111 | Probable RNA-binding protein 19, Rbm19 {Mouse (Mus | 99.67 | |
| d1bi7b_ | 125 | Cell cycle inhibitor p16ink4A {Human (Homo sapiens | 99.67 | |
| d3begb1 | 87 | Splicing factor, arginine/serine-rich 1, SFRS1 {Hu | 99.66 | |
| d1oy3d_ | 255 | Transcription factor inhibitor I-kappa-B-beta, IKB | 99.66 | |
| d2b0ga1 | 83 | Splicesomal U1A protein {Drosophila melanogaster [ | 99.65 | |
| d2adca2 | 88 | Polypyrimidine tract-binding protein {Human (Homo | 99.65 | |
| d2adca1 | 109 | Polypyrimidine tract-binding protein {Human (Homo | 99.65 | |
| d1u2fa_ | 90 | Splicing factor U2AF 65 KDa subunit {Human (Homo s | 99.65 | |
| d1ixva_ | 229 | 26S proteasome non-ATPase regulatory subunit 10, g | 99.65 | |
| d1wf2a_ | 98 | Heterogeneous nuclear ribonucleoproteins C1/C2 {Hu | 99.64 | |
| d1wdya_ | 285 | RNase L, 2-5a-dependent ribonuclease {Human (Homo | 99.64 | |
| d1u1qa_ | 183 | Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human | 99.64 | |
| d1wi6a1 | 75 | Ribonucleoprotein PTB-binding 1, Raver-1 {Mouse (M | 99.64 | |
| d1awcb_ | 153 | GA bindinig protein (GABP) beta 1 {Mouse (Mus musc | 99.64 | |
| d1dcqa1 | 154 | Pyk2-associated protein beta {Mouse (Mus musculus) | 99.63 | |
| d2cq1a1 | 88 | Polypyrimidine tract-binding protein 2, PTBP2 {Hum | 99.63 | |
| d1wg1a_ | 88 | Probable RNA-binding protein KIAA1579 {Human (Homo | 99.63 | |
| d2adba1 | 108 | Polypyrimidine tract-binding protein {Human (Homo | 99.62 | |
| d1uoha_ | 223 | 26S proteasome non-ATPase regulatory subunit 10, g | 99.62 | |
| d2ajaa1 | 346 | Hypothetical protein LPG2416 {Legionella pneumophi | 99.62 | |
| d2fo1e1 | 277 | Lin-12 {Caenorhabditis elegans [TaxId: 6239]} | 99.62 | |
| d1n11a_ | 408 | Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} | 99.62 | |
| d1wg4a_ | 98 | Splicing factor, arginine/serine-rich 9 (SFRS9) {M | 99.6 | |
| d1whya_ | 97 | Putative RNA-binding protein 15B, Rbm15b {Mouse (M | 99.59 | |
| d1n11a_ | 408 | Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} | 99.59 | |
| d1x4fa1 | 99 | Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} | 99.58 | |
| d1sw6a_ | 301 | Swi6 ankyrin-repeat fragment {Baker's yeast (Sacch | 99.58 | |
| d1wexa_ | 104 | Heterogeneous nuclear ribonucleoprotein L-like {Mo | 99.58 | |
| d1k1aa_ | 228 | bcl-3 {Human (Homo sapiens) [TaxId: 9606]} | 99.58 | |
| d2fo1e1 | 277 | Lin-12 {Caenorhabditis elegans [TaxId: 6239]} | 99.57 | |
| d1bd8a_ | 156 | Cell cycle inhibitor p19ink4D {Human (Homo sapiens | 99.56 | |
| d1ihba_ | 156 | p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606] | 99.56 | |
| d1awcb_ | 153 | GA bindinig protein (GABP) beta 1 {Mouse (Mus musc | 99.55 | |
| d1x4da1 | 89 | Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} | 99.54 | |
| d1s70b_ | 291 | Myosin phosphatase targeting subunit 1, MYPT1 {Chi | 99.53 | |
| d1iknd_ | 221 | I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606 | 99.52 | |
| d2ajaa1 | 346 | Hypothetical protein LPG2416 {Legionella pneumophi | 99.52 | |
| d1iknd_ | 221 | I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606 | 99.51 | |
| d1wwha1 | 81 | Nucleoporin 35 {Mouse (Mus musculus) [TaxId: 10090 | 99.49 | |
| d1ixva_ | 229 | 26S proteasome non-ATPase regulatory subunit 10, g | 99.47 | |
| d1k1aa_ | 228 | bcl-3 {Human (Homo sapiens) [TaxId: 9606]} | 99.46 | |
| d1weya_ | 104 | Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090 | 99.46 | |
| d1s70b_ | 291 | Myosin phosphatase targeting subunit 1, MYPT1 {Chi | 99.45 | |
| U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]}" target="_blank" href="http://scop.mrc-lmb.cam.ac.uk/scop/search.cgi?sid=d1jmta_">d1jmta_ | 104 | U2 | 99.43 | |
| d1ihba_ | 156 | p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606] | 99.42 | |
| d1ot8a_ | 209 | Neurogenic locus notch receptor domain {Fruit fly | 99.38 | |
| d1owxa_ | 113 | Lupus LA protein {Human (Homo sapiens) [TaxId: 960 | 99.34 | |
| d2cq2a1 | 101 | Alkylation repair AlkB homolog 8, ALKBH8 {Human (H | 99.34 | |
| d2dita1 | 99 | HIV Tat-specific factor 1 {Human (Homo sapiens) [T | 99.26 | |
| d1wdya_ | 285 | RNase L, 2-5a-dependent ribonuclease {Human (Homo | 99.24 | |
| d1sw6a_ | 301 | Swi6 ankyrin-repeat fragment {Baker's yeast (Sacch | 99.21 | |
| d1o0pa_ | 104 | Splicing factor U2AF 65 KDa subunit {Human (Homo s | 99.07 | |
| d1fxla2 | 85 | Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9 | 97.95 | |
| d1b7fa1 | 82 | Sex-lethal protein {Drosophila melanogaster [TaxId | 97.85 | |
| d1cvja1 | 80 | Poly(A)-binding protein {Human (Homo sapiens) [Tax | 97.84 | |
| d2cqba1 | 89 | Peptidyl-prolyl cis-trans isomerase E, N-terminal | 97.83 | |
| d1x0fa1 | 75 | Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo s | 97.76 | |
| d2cpha1 | 94 | Probable RNA-binding protein 19, Rbm19 {Mouse (Mus | 97.75 | |
| d1hd0a_ | 75 | Heterogeneous nuclear ribonucleoprotein d0 {Human | 97.75 | |
| d1fxla1 | 82 | Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9 | 97.74 | |
| d1uawa_ | 77 | Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} | 97.74 | |
| d1x5sa1 | 90 | Cold-inducible RNA-binding protein {Human (Homo sa | 97.72 | |
| d2cqga1 | 90 | TAR DNA-binding protein 43, TDP-43 {Human (Homo sa | 97.67 | |
| d2msta_ | 75 | Neural RNA-binding protein Musashi-1 {Mouse (Mus m | 97.67 | |
| d2ghpa1 | 81 | U4/U6 snRNA-associated-splicing factor PRP24 {Bake | 97.66 | |
| d1b7fa2 | 85 | Sex-lethal protein {Drosophila melanogaster [TaxId | 97.66 | |
| d2cpza1 | 102 | CUG triplet repeat RNA-binding protein 1 {Human (H | 97.64 | |
| d1rk8a_ | 88 | RNA-binding protein 8 {Fruit fly (Drosophila melan | 97.63 | |
| d1x4ea1 | 72 | RNA-binding motif, single-stranded-interacting pro | 97.63 | |
| d1no8a_ | 78 | Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 1 | 97.62 | |
| d1x5ua1 | 93 | Splicing factor 3B subunit 4 {Human (Homo sapiens) | 97.61 | |
| d2u2fa_ | 85 | Splicing factor U2AF 65 KDa subunit {Human (Homo s | 97.59 | |
| d1h2vz_ | 93 | CBP20, 20KDa nuclear cap-binding protein {Human (H | 97.59 | |
| d1x4ba1 | 103 | Heterogeneous nuclear ribonucleoproteins A2/B1 {Hu | 97.57 | |
| d2cqda1 | 103 | RNA-binding region containing protein 1 {Human (Ho | 97.54 | |
| d2cqca1 | 83 | Arginine/serine-rich splicing factor 10 {Human (Ho | 97.53 | |
| d1uw4a_ | 91 | RNA processing protein UPF3x, RRM domain {Human (H | 97.52 | |
| d1whwa_ | 99 | Probable RNA-binding protein 19, Rbm19 {Mouse (Mus | 97.5 | |
| d1l3ka1 | 84 | Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human | 97.48 | |
| d1p1ta_ | 104 | Cleavage stimulation factor, 64 kda subunit {Human | 97.43 | |
| d2cq0a1 | 90 | Eukaryotic translation initiation factor 3 subunit | 97.43 | |
| d2cq3a1 | 93 | RNA-binding protein 9 {Human (Homo sapiens) [TaxId | 97.36 | |
| d1x5ta1 | 83 | Splicing factor 3B subunit 4 {Human (Homo sapiens) | 97.35 | |
| d1x4ha1 | 98 | RNA-binding protein 28 {Mouse (Mus musculus) [TaxI | 97.34 | |
| d2cq4a1 | 101 | RNA binding protein 23 {Human (Homo sapiens) [TaxI | 97.33 | |
| d1whxa_ | 111 | Probable RNA-binding protein 19, Rbm19 {Mouse (Mus | 97.29 | |
| d1zh5a2 | 85 | Lupus LA protein {Human (Homo sapiens) [TaxId: 960 | 97.29 | |
| d2cpea1 | 101 | RNA-binding protein EWS {Human (Homo sapiens) [Tax | 97.27 | |
| d2disa1 | 96 | Hypothetical protein FLJ20273 {Human (Homo sapiens | 97.27 | |
| d2adba1 | 108 | Polypyrimidine tract-binding protein {Human (Homo | 97.23 | |
| d2adca2 | 88 | Polypyrimidine tract-binding protein {Human (Homo | 97.18 | |
| d2ghpa3 | 86 | U4/U6 snRNA-associated-splicing factor PRP24 {Bake | 97.14 | |
| d1fjeb1 | 91 | Nucleolin {Golden hamster (Mesocricetus auratus) [ | 97.11 | |
| d3begb1 | 87 | Splicing factor, arginine/serine-rich 1, SFRS1 {Hu | 97.1 | |
| d1wf0a_ | 88 | TAR DNA-binding protein 43, TDP-43 {Human (Homo sa | 97.09 | |
| d1u6fa1 | 139 | RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId | 97.08 | |
| d2cpia1 | 89 | E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musc | 97.05 | |
| d1ufwa_ | 95 | Synaptojanin 2 {Human (Homo sapiens) [TaxId: 9606] | 97.05 | |
| d2ghpa2 | 75 | U4/U6 snRNA-associated-splicing factor PRP24 {Bake | 97.03 | |
| d1l3ka2 | 79 | Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human | 97.02 | |
| d1whya_ | 97 | Putative RNA-binding protein 15B, Rbm15b {Mouse (M | 97.0 | |
| d1u2fa_ | 90 | Splicing factor U2AF 65 KDa subunit {Human (Homo s | 97.0 | |
| d2f9da1 | 114 | Pre-mRNA branch site protein p14 {Human (Homo sapi | 97.0 | |
| d2cqha1 | 80 | IGF-II mRNA-binding protein 2 isoform A {Human (Ho | 96.95 | |
| d2cqia1 | 90 | Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 960 | 96.93 | |
| d1x5oa1 | 101 | RNA-binding motif, single-stranded-interacting pro | 96.92 | |
| d1x4ga1 | 96 | Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 960 | 96.9 | |
| d1cvja2 | 89 | Poly(A)-binding protein {Human (Homo sapiens) [Tax | 96.89 | |
| d2cpya1 | 103 | RNA-binding protein 12 {Human (Homo sapiens) [TaxI | 96.85 | |
| d2cpda1 | 86 | APOBEC1 stimulating protein {Human (Homo sapiens) | 96.84 | |
| d2cpja1 | 86 | Non-POU domain-containing octamer-binding protein, | 96.82 | |
| d2cpxa1 | 102 | RNA-binding protein 41, RBM41 {Human (Homo sapiens | 96.8 | |
| d2cpfa1 | 85 | Probable RNA-binding protein 19, Rbm19 {Mouse (Mus | 96.77 | |
| d1wg5a_ | 104 | Heterogeneous nuclear ribonucleoprotein H' {Human | 96.75 | |
| d1wexa_ | 104 | Heterogeneous nuclear ribonucleoprotein L-like {Mo | 96.74 | |
| d2b0ga1 | 83 | Splicesomal U1A protein {Drosophila melanogaster [ | 96.69 | |
| d2cqpa1 | 86 | RNA-binding protein 12 {Mouse (Mus musculus) [TaxI | 96.69 | |
| d2adca1 | 109 | Polypyrimidine tract-binding protein {Human (Homo | 96.67 | |
| d1x4aa1 | 95 | Splicing factor, arginine/serine-rich 1, SFRS1 {Hu | 96.64 | |
| d2bz2a1 | 79 | Negative elongation factor E, NELF-E {Human (Homo | 96.58 | |
| d1wg1a_ | 88 | Probable RNA-binding protein KIAA1579 {Human (Homo | 96.57 | |
| d1wi8a_ | 104 | Eukaryotic translation initiation factor 4B {Human | 96.53 | |
| d1nu4a_ | 91 | Splicesomal U1A protein {Human (Homo sapiens) [Tax | 96.52 | |
| d1wi6a1 | 75 | Ribonucleoprotein PTB-binding 1, Raver-1 {Mouse (M | 96.5 | |
| d2cq1a1 | 88 | Polypyrimidine tract-binding protein 2, PTBP2 {Hum | 96.4 | |
| d1wg4a_ | 98 | Splicing factor, arginine/serine-rich 9 (SFRS9) {M | 96.33 | |
| d1wela1 | 112 | RNA-binding protein 12 {Human (Homo sapiens) [TaxI | 96.31 | |
| d1owxa_ | 113 | Lupus LA protein {Human (Homo sapiens) [TaxId: 960 | 96.27 | |
| d2cq2a1 | 101 | Alkylation repair AlkB homolog 8, ALKBH8 {Human (H | 96.13 | |
| d1x4fa1 | 99 | Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} | 96.05 | |
| d1x4da1 | 89 | Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} | 96.04 | |
| d1fjca_ | 96 | Nucleolin {Golden hamster (Mesocricetus auratus) [ | 96.0 | |
| d1weza_ | 102 | Heterogeneous nuclear ribonucleoprotein H' {Human | 95.66 | |
| d1whva_ | 100 | Poly(A)-specific ribonuclease PARN {Mouse (Mus mus | 95.21 | |
| d1wf2a_ | 98 | Heterogeneous nuclear ribonucleoproteins C1/C2 {Hu | 94.8 | |
| U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]}" target="_blank" href="http://scop.mrc-lmb.cam.ac.uk/scop/search.cgi?sid=d1jmta_">d1jmta_ | 104 | U2 | 94.19 | |
| d2dgxa1 | 73 | Limkain-b1, LKAP {Human (Homo sapiens) [TaxId: 960 | 93.79 | |
| d1wwha1 | 81 | Nucleoporin 35 {Mouse (Mus musculus) [TaxId: 10090 | 93.31 | |
| d1weya_ | 104 | Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090 | 92.57 | |
| d1gg3a1 | 106 | Erythroid membrane protein 4.1R {Human (Homo sapie | 88.8 | |
| d2dita1 | 99 | HIV Tat-specific factor 1 {Human (Homo sapiens) [T | 83.23 | |
| d1h4ra1 | 111 | Merlin {Human (Homo sapiens) [TaxId: 9606]} | 81.43 | |
| d1mixa1 | 114 | Talin {Chicken (Gallus gallus) [TaxId: 9031]} | 80.17 |
| >d1u1qa_ d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: Ferredoxin-like superfamily: RNA-binding domain, RBD family: Canonical RBD domain: Nuclear ribonucleoprotein A1 (RNP A1, UP1) species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.87 E-value=2.2e-23 Score=171.69 Aligned_cols=154 Identities=21% Similarity=0.364 Sum_probs=123.9
Q ss_pred cccCCCeEEEeCCCCCCCHHHHHHHHhccCCeeEEEEeeeCCCCCceeEEEEEEcCHHHHHHHHhcCCCccCCccccccC
Q psy630 4 SIRQLNKIFVGNLPWTVSHNELKKFFSEYGQIMNASVMFDKNTGLSKGFGFVTFQNKEAVDKVFSTDSHVLEGSRLSIQP 83 (347)
Q Consensus 4 ~~~~~~~l~V~nLp~~~t~~~l~~~f~~~G~i~~~~i~~~~~t~~~~g~afV~f~~~~~a~~a~~~~~~~~~g~~l~v~~ 83 (347)
+|++.|+|||||||+++|+++|+++|++||.|..+.+++++.+|.++|||||+|.+.++|.+|+...+..+.++.+.+.+
T Consensus 2 ep~~~r~lfV~nLp~~~te~~L~~~F~~~G~v~~~~~~~~~~~~~~~g~afv~f~~~~~a~~a~~~~~~~~~~~~~~~~~ 81 (183)
T d1u1qa_ 2 EPEQLRKLFIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPNTKRSRGFGFVTYATVEEVDAAMNARPHKVDGRVVEPKR 81 (183)
T ss_dssp CCHHHHEEEEESCCTTCCHHHHHHHHGGGSCEEEEEEEECTTTCCEEEEEEEEESSHHHHHHHHHTCSCEETTEECEEEE
T ss_pred CCCCCCEEEEECCCCCCCHHHHHHHHHHcCCEEEEEeeecccCCCccCceecccCCHHHHHHHHHhcCCcccccchhhhh
Confidence 46778999999999999999999999999999999999999999999999999999999999999988888888888776
Q ss_pred CCcccccchhhhhhcccccccccCCcccccchhhHHHHhhccccceecccCCCCCccchhHHHHHHHHHHcCCCCHHHHH
Q psy630 84 SDSHNRMAENMEDRFNQACDYLPSLVKKLDSSTLLKFYALYKQATVGQCNIDKPSWYNMEAKSKYNAWNSLGQMAKSEAM 163 (347)
Q Consensus 84 ~~~~~~~~~~~~~~f~~~~~~v~~l~~~~~~e~l~~~f~~fg~v~~g~~~~~~p~~~~~~~~~K~~aw~~~~~~~~~eA~ 163 (347)
..+...... ........++||+|||..+++++|+++|+.||.+....+..+++ .++.|+.|+.. ..+.++|.
T Consensus 82 ~~~~~~~~~-~~~~~~~~~i~V~~lp~~~te~~L~~~f~~~G~v~~~~i~~~~~-----~~~~~g~~fV~--f~~~e~A~ 153 (183)
T d1u1qa_ 82 AVSREDSQR-PGAHLTVKKIFVGGIKEDTEEHHLRDYFEQYGKIEVIEIMTDRG-----SGKKRGFAFVT--FDDHDSVD 153 (183)
T ss_dssp CCCTTGGGS-TTTTCCCSEEEEECCCTTCCHHHHHHHHGGGSCEEEEEEEECTT-----TCCEEEEEEEE--ESCHHHHH
T ss_pred hhhcccccc-cccccccceeEEccCCCcCCHHHHhhhhccCCceeeeeeecccc-----cCccceeEEEE--ECCHHHHH
Confidence 655443221 12234457899999999999999999999999998877766543 12233333433 44577777
Q ss_pred HH
Q psy630 164 SK 165 (347)
Q Consensus 164 ~~ 165 (347)
++
T Consensus 154 ~A 155 (183)
T d1u1qa_ 154 KI 155 (183)
T ss_dssp HH
T ss_pred HH
Confidence 65
|
| >d1l3ka1 d.58.7.1 (A:8-91) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cqga1 d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1hd0a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein d0 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uawa_ d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1x0fa1 d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x4ba1 d.58.7.1 (A:8-110) Heterogeneous nuclear ribonucleoproteins A2/B1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x5ua1 d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1l3ka2 d.58.7.1 (A:103-181) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1hbka_ a.11.1.1 (A:) Acyl-CoA binding protein {Plasmodium falciparum [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d1hb6a_ a.11.1.1 (A:) Acyl-CoA binding protein {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1b7fa1 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1cvja1 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cq4a1 d.58.7.1 (A:132-232) RNA binding protein 23 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cqba1 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomerase E, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rk8a_ d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1fxla1 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1h2vz_ d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cqca1 d.58.7.1 (A:109-191) Arginine/serine-rich splicing factor 10 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cq0a1 d.58.7.1 (A:231-320) Eukaryotic translation initiation factor 3 subunit 4 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fxla2 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1whwa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2cqda1 d.58.7.1 (A:1-103) RNA-binding region containing protein 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1b7fa2 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d2cpza1 d.58.7.1 (A:383-484) CUG triplet repeat RNA-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x5sa1 d.58.7.1 (A:8-97) Cold-inducible RNA-binding protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1u6fa1 d.58.7.1 (A:1-139) RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId: 5693]} | Back information, alignment and structure |
|---|
| >d2msta_ d.58.7.1 (A:) Neural RNA-binding protein Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2cpha1 d.58.7.1 (A:454-547) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1p1ta_ d.58.7.1 (A:) Cleavage stimulation factor, 64 kda subunit {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cqia1 d.58.7.1 (A:1-90) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x4ha1 d.58.7.1 (A:8-105) RNA-binding protein 28 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1no8a_ d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1x5ta1 d.58.7.1 (A:8-90) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cpfa1 d.58.7.1 (A:362-446) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2ghpa3 d.58.7.1 (A:206-291) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2ghpa1 d.58.7.1 (A:116-196) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1zh5a2 d.58.7.1 (A:105-189) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cq3a1 d.58.7.1 (A:110-202) RNA-binding protein 9 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1cvja2 d.58.7.1 (A:91-179) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2f9da1 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p14 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fjeb1 d.58.7.1 (B:1-91) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} | Back information, alignment and structure |
|---|
| >d2ghpa2 d.58.7.1 (A:41-115) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2cpea1 d.58.7.1 (A:353-453) RNA-binding protein EWS {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x5oa1 d.58.7.1 (A:8-108) RNA-binding motif, single-stranded-interacting protein 1, RBMS1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2cpxa1 d.58.7.1 (A:291-392) RNA-binding protein 41, RBM41 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wg5a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x4aa1 d.58.7.1 (A:9-103) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x4ea1 d.58.7.1 (A:8-79) RNA-binding motif, single-stranded-interacting protein 2, RBMS2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wi8a_ d.58.7.1 (A:) Eukaryotic translation initiation factor 4B {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2disa1 d.58.7.1 (A:8-103) Hypothetical protein FLJ20273 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cpia1 d.58.7.1 (A:101-189) E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wf0a_ d.58.7.1 (A:) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fjca_ d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} | Back information, alignment and structure |
|---|
| >d1x4ga1 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1weza_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cqha1 d.58.7.1 (A:2-81) IGF-II mRNA-binding protein 2 isoform A {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cpda1 d.58.7.1 (A:223-308) APOBEC1 stimulating protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d2cqpa1 d.58.7.1 (A:917-1002) RNA-binding protein 12 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2cpja1 d.58.7.1 (A:65-150) Non-POU domain-containing octamer-binding protein, NonO {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2bz2a1 d.58.7.1 (A:35-113) Negative elongation factor E, NELF-E {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wela1 d.58.7.1 (A:412-523) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cpya1 d.58.7.1 (A:536-638) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nu4a_ d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1whxa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3begb1 d.58.7.1 (B:121-207) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2b0ga1 d.58.7.1 (A:1-83) Splicesomal U1A protein {Drosophila melanogaster [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d2adca2 d.58.7.1 (A:444-531) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2adca1 d.58.7.1 (A:335-443) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1wf2a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoproteins C1/C2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1u1qa_ d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wi6a1 d.58.7.1 (A:69-143) Ribonucleoprotein PTB-binding 1, Raver-1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2cq1a1 d.58.7.1 (A:51-138) Polypyrimidine tract-binding protein 2, PTBP2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wg1a_ d.58.7.1 (A:) Probable RNA-binding protein KIAA1579 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2adba1 d.58.7.1 (A:177-284) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} | Back information, alignment and structure |
|---|
| >d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wg4a_ d.58.7.1 (A:) Splicing factor, arginine/serine-rich 9 (SFRS9) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1whya_ d.58.7.1 (A:) Putative RNA-binding protein 15B, Rbm15b {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x4fa1 d.58.7.1 (A:8-106) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1wexa_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein L-like {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1x4da1 d.58.7.1 (A:8-96) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} | Back information, alignment and structure |
|---|
| >d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wwha1 d.58.7.1 (A:169-249) Nucleoporin 35 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1weya_ d.58.7.1 (A:) Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1jmta_ d.58.7.3 (A:) U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1owxa_ d.58.7.1 (A:) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cq2a1 d.58.7.1 (A:25-125) Alkylation repair AlkB homolog 8, ALKBH8 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dita1 d.58.7.1 (A:8-106) HIV Tat-specific factor 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1o0pa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fxla2 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1b7fa1 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1cvja1 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cqba1 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomerase E, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x0fa1 d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cpha1 d.58.7.1 (A:454-547) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1hd0a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein d0 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fxla1 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uawa_ d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1x5sa1 d.58.7.1 (A:8-97) Cold-inducible RNA-binding protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cqga1 d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2msta_ d.58.7.1 (A:) Neural RNA-binding protein Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2ghpa1 d.58.7.1 (A:116-196) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1b7fa2 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d2cpza1 d.58.7.1 (A:383-484) CUG triplet repeat RNA-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rk8a_ d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1x4ea1 d.58.7.1 (A:8-79) RNA-binding motif, single-stranded-interacting protein 2, RBMS2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1no8a_ d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1x5ua1 d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1h2vz_ d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x4ba1 d.58.7.1 (A:8-110) Heterogeneous nuclear ribonucleoproteins A2/B1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cqda1 d.58.7.1 (A:1-103) RNA-binding region containing protein 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cqca1 d.58.7.1 (A:109-191) Arginine/serine-rich splicing factor 10 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uw4a_ d.58.7.4 (A:) RNA processing protein UPF3x, RRM domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1whwa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1l3ka1 d.58.7.1 (A:8-91) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1p1ta_ d.58.7.1 (A:) Cleavage stimulation factor, 64 kda subunit {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cq0a1 d.58.7.1 (A:231-320) Eukaryotic translation initiation factor 3 subunit 4 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cq3a1 d.58.7.1 (A:110-202) RNA-binding protein 9 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x5ta1 d.58.7.1 (A:8-90) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x4ha1 d.58.7.1 (A:8-105) RNA-binding protein 28 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2cq4a1 d.58.7.1 (A:132-232) RNA binding protein 23 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1whxa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1zh5a2 d.58.7.1 (A:105-189) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cpea1 d.58.7.1 (A:353-453) RNA-binding protein EWS {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2disa1 d.58.7.1 (A:8-103) Hypothetical protein FLJ20273 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2adba1 d.58.7.1 (A:177-284) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2adca2 d.58.7.1 (A:444-531) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ghpa3 d.58.7.1 (A:206-291) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1fjeb1 d.58.7.1 (B:1-91) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} | Back information, alignment and structure |
|---|
| >d3begb1 d.58.7.1 (B:121-207) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wf0a_ d.58.7.1 (A:) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1u6fa1 d.58.7.1 (A:1-139) RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId: 5693]} | Back information, alignment and structure |
|---|
| >d2cpia1 d.58.7.1 (A:101-189) E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ufwa_ d.58.7.1 (A:) Synaptojanin 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ghpa2 d.58.7.1 (A:41-115) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1l3ka2 d.58.7.1 (A:103-181) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1whya_ d.58.7.1 (A:) Putative RNA-binding protein 15B, Rbm15b {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2f9da1 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p14 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cqha1 d.58.7.1 (A:2-81) IGF-II mRNA-binding protein 2 isoform A {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cqia1 d.58.7.1 (A:1-90) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x5oa1 d.58.7.1 (A:8-108) RNA-binding motif, single-stranded-interacting protein 1, RBMS1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x4ga1 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1cvja2 d.58.7.1 (A:91-179) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cpya1 d.58.7.1 (A:536-638) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cpda1 d.58.7.1 (A:223-308) APOBEC1 stimulating protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cpja1 d.58.7.1 (A:65-150) Non-POU domain-containing octamer-binding protein, NonO {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2cpxa1 d.58.7.1 (A:291-392) RNA-binding protein 41, RBM41 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cpfa1 d.58.7.1 (A:362-446) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wg5a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wexa_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein L-like {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2b0ga1 d.58.7.1 (A:1-83) Splicesomal U1A protein {Drosophila melanogaster [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d2cqpa1 d.58.7.1 (A:917-1002) RNA-binding protein 12 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2adca1 d.58.7.1 (A:335-443) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x4aa1 d.58.7.1 (A:9-103) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2bz2a1 d.58.7.1 (A:35-113) Negative elongation factor E, NELF-E {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wg1a_ d.58.7.1 (A:) Probable RNA-binding protein KIAA1579 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wi8a_ d.58.7.1 (A:) Eukaryotic translation initiation factor 4B {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nu4a_ d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wi6a1 d.58.7.1 (A:69-143) Ribonucleoprotein PTB-binding 1, Raver-1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2cq1a1 d.58.7.1 (A:51-138) Polypyrimidine tract-binding protein 2, PTBP2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wg4a_ d.58.7.1 (A:) Splicing factor, arginine/serine-rich 9 (SFRS9) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wela1 d.58.7.1 (A:412-523) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1owxa_ d.58.7.1 (A:) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cq2a1 d.58.7.1 (A:25-125) Alkylation repair AlkB homolog 8, ALKBH8 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x4fa1 d.58.7.1 (A:8-106) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1x4da1 d.58.7.1 (A:8-96) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1fjca_ d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} | Back information, alignment and structure |
|---|
| >d1weza_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1whva_ d.58.7.1 (A:) Poly(A)-specific ribonuclease PARN {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wf2a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoproteins C1/C2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jmta_ d.58.7.3 (A:) U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dgxa1 d.58.7.1 (A:563-635) Limkain-b1, LKAP {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wwha1 d.58.7.1 (A:169-249) Nucleoporin 35 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1weya_ d.58.7.1 (A:) Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1gg3a1 a.11.2.1 (A:82-187) Erythroid membrane protein 4.1R {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dita1 d.58.7.1 (A:8-106) HIV Tat-specific factor 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1h4ra1 a.11.2.1 (A:104-214) Merlin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1mixa1 a.11.2.1 (A:195-308) Talin {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|