Diaphorina citri psyllid: psy6337

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------

DRNDLIEIWNIVFISHKRVSADTIVPLSKNYIDTGLGFERLVTILQNKTSTYDTDLFLPLLETIEKVSGAKPYGRTFTTSNRTDLDTSYRMLSDYSRMITVALADNMFPDATAKLRNVVRDALLISEDVFKVKQGKLVKELSYNIAEILGDVYPEIQDSINKIQLILGEESRIFDNLRKAAVKEWKPLVKTQPELEQFNIMEEPGLVLGVKYLTKQLARDPSITEISGDMAFTLYDTYGLSKNIIQELAAAKKLTLCHEAFEQKLNELKERSKAKAASNVPDIDLMDLKHFPVTDDKYKYDYHYDTNSKRYTFPCLDTNLVGIVIGDQVFCIDKHAIRHARSGASIDSIQLEHNAWVGLIFDKTNLYATAGGQIDDIGVAYLTNTTQENGKVEIGELASLEGKIVHFGNVVSSFKVTPGLTSRVEVDARMRLGCMRAHTTSHLLNAALRRVLTCTYQKSCRVFSDECALDFSVYGETLSVDSVAAVEKYINDVIADQVQVDRRHMRASELPSLTHLTVIPGEIYPDDVILIDISDKENVISREPCCGTHVFNTGHIESCTVIGYKSYNHGVRSIKCLTGESSKAAVENGKQLSAAVKQLAATINQNSEQTDEETLNQQNHEIKTLRELLEDDLPYAVHKQNDHLLAELSKNVKLKLRQFAKVRITEELIEKCKEDTPYLVHYIRDDAVEIQALPPLSQISKPVLVLLYSLGELKARAYVPPQCTTPGFNAQAWLTPIMDRAEGKGVSSKGSDVQHLYSMNPVKISNNVEDLVKQLVDIARRSADELRSNEKQEHKRV

ccccEEEEEEHHHHcccccccccccccccccccccccHHHHHHHHcccccccHHHcHHHHHHHHHHHHcccccccccccccccccccEEEEEccHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHccccHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHccccHHHHHHHHHHHHHHHccccccCCcccccEEccccccccHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccCEEEEEEEEccccccccccHHHcccccccccccccccccEEEEEEcccccccccccccccEEEEEEcccccccEEEEEEEEEEEccEEEEEEEEEEEEEEccccEEEEEEcHHHHHHHHHccHHHHHHHHHHHHHccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHccccEEEEEccHHHHHHcccccccccccccccEEEEEccccccccccccccccccccccccccEEEECcccccccccEEEEEccHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccEEEEEccHHHHHHHcHHHHcccccEEEEEEEccEEEEEEEcccccccccccHHHHHHHHHHHccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccc

DRNDLIEIWNIVFISHKRVSADTIVPLSKNYIDTGLGFERLVTILQNKTSTYDTDLFLPLLETIEKVSGAKPYGRTFTTSNRTDLDTSYRMLSDYSRMITVALADNMFPDATAKLRNVVRDALLISEDVFKVKQGKLVKELSYNIAEILGDVYPEIQDSINKIQLILGEESRIFDNLRKAAVKEWKPLVKTQPELEQFNIMEEPGLVLGVKYLTKQLARDPSITEISGDMAFTLYDTYGLSKNIIQELAAAKKLTLCHEAFEQ*****************PDIDLMDLKHFPVTDDKYKYDYHYDTNSKRYTFPCLDTNLVGIVIGDQVFCIDKHAIRHARSGASIDSIQLEHNAWVGLIFDKTNLYATAGGQIDDIGVAYLTNTTQENGKVEIGELASLEGKIVHFGNVVSSFKVTPGLTSRVEVDARMRLGCMRAHTTSHLLNAALRRVLTCTYQKSCRVFSDECALDFSVYGETLSVDSVAAVEKYINDVIADQVQVDRRHMRASELPSLTHLTVIPGEIYPDDVILIDISDKENVISREPCCGTHVFNTGHIESCTVIGYKSYNHGVRSIKCLTGESSKAAVENGKQLSAAVKQL*************************LRELLEDDLPYAVHKQNDHLLAELSKNVKLKLRQFAKVRITEELIEKCKEDTPYLVHYIRDDAVEIQALPPLSQISKPVLVLLYSLGELKARAYVPPQCTTPGFNAQAWLTPIMDRAEG*G**********LYSMNPVKISNNVEDLVKQLVDIARRSAD*************

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

DRNDLIEIWNIVFISHKRVSADTIVPLSKNYIDTGLGFERLVTILQNKTSTYDTDLFLPLLETIEKVSGAKPYGRTFTTSNRTDLDTSYRMLSDYSRMITVALADNMFPDATAKLRNVVRDALLISEDVFKVKQGKLVKELSYNIAEILGDVYPEIQDSINKIQLILGEESRIFDNLRKAAVKEWKPLVKTQPELEQFNIMEEPGLVLGVKYLTKQLARDPSITEISGDMAFTLYDTYGLSKNIIQELAAxxxxxxxxxxxxxxxxxxxxxSKAKAASNVPDIDLMDLKHFPVTDDKYKYDYHYDTNSKRYTFPCLDTNLVGIVIGDQVFCIDKHAIRHARSGASIDSIQLEHNAWVGLIFDKTNLYATAGGQIDDIGVAYLTNTTQENGKVEIGELASLEGKIVHFGNVVSSFKVTPGLTSRVEVDARMRLGCMRAHTTSHLLNAALRRVLTCTYQKSCRVFSDECALDFSVYGETLSVDSVAAVEKYINDVIADQVQVDRRHMRASELPSLTHLTVIPGEIYPDDVILIDISDKENVISREPCCGTHVFNTGHIESCTVIGYKSYNHGVRSIKCLTGESSKAAVENGKQLSAAVKQLAATINQNSEQTDEETLNQQNHEIKTLRELLEDDLPYAVHKQNDHLLAELSKNVKLKLRQFAKVRITEELIEKCKEDTPYLVHYIRDDAVEIQALPPLSQISKPVLVLLYSLGELKARAYVPPQCTTPGFNAQAWLTPIMDRAEGKGVSSKGSDVQHLYSMNPVKISNNVEDLVKQLVDIARRSADELRSNEKQEHKRV

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Alanine--tRNA ligase, mitochondrial	Catalyzes the attachment of alanine to tRNA(Ala) in a two-step reaction: alanine is first activated by ATP to form Ala-AMP and then transferred to the acceptor end of tRNA(Ala). Also edits incorrectly charged tRNA(Ala) via its editing domain.	confident	Q9VRJ1

Prediction of Gene Ontology Terms

No confident GO terms associated with the query are predicted

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2ZZE, chain A
Confidence level:very confident
Coverage over the Query: 5-177,206-324,357-580
View the alignment between query and template
View the model in PyMOL

Template: 3HXZ, chain A
Confidence level:confident
Coverage over the Query: 1-70,83-164,180-280
View the alignment between query and template
View the model in PyMOL

Template: 2ZVF, chain A
Confidence level:confident
Coverage over the Query: 579-624,641-785
View the alignment between query and template
View the model in PyMOL

Template: 2ZZF, chain A
Confidence level:probable
Coverage over the Query: 6-192,210-292,305-318,332-342,356-580
View the alignment between query and template
View the model in PyMOL