Diaphorina citri psyllid: psy6338


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-----
MLGNWSFNDYYKRDACRMALEFLTKPPVSLPLDRLYFTYFGGSDQYGLPCDEETLDIWLELGVPRDHIKKEGMKCNFWEMGSTGPCGYSSEIHYDMKGEPSSALARVNADRNDLIEIWNIVFISHKRVSADTIVP
cccccccccccHHHHHHHHHHHHHccccccccccEEEEEEcccccccccccHHHHHHHHHcccccccccccccccccccccccccccccCEEEEEccccccccccccccccccEEEEEEEEHHHccccccccccc
MLGNWSFNDYYKRDACRMALEFLTKPPVSLPLDRLYFTYFGGSDQYGLPCDEETLDIWLELGVPRDHIKKEGMKCNFWEMGSTGPCGYSSEIHYDMKGEPS**LARVNADRNDLIEIWNIVFISHKRVS******
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLGNWSFNDYYKRDACRMALEFLTKPPVSLPLDRLYFTYFGGSDQYGLPCDEETLDIWLELGVPRDHIKKEGMKCNFWEMGSTGPCGYSSEIHYDMKGEPSSALARVNADRNDLIEIWNIVFISHKRVSADTIVP

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Alanine--tRNA ligase, cytoplasmic Catalyzes the attachment of alanine to tRNA(Ala) in a two-step reaction: alanine is first activated by ATP to form Ala-AMP and then transferred to the acceptor end of tRNA(Ala). Also edits incorrectly charged tRNA(Ala) via its editing domain.confidentQ8BGQ7
Alanine--tRNA ligase Catalyzes the attachment of alanine to tRNA(Ala) in a two-step reaction: alanine is first activated by ATP to form Ala-AMP and then transferred to the acceptor end of tRNA(Ala). Also edits incorrectly charged tRNA(Ala) via its editing domain.confidentP36428
Alanine--tRNA ligase Catalyzes the attachment of alanine to tRNA(Ala) in a two-step reaction: alanine is first activated by ATP to form Ala-AMP and then transferred to the acceptor end of tRNA(Ala). Also edits incorrectly charged tRNA(Ala) via its editing domain.confidentQ5AQL1

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0006450 [BP]regulation of translational fidelityprobableGO:0009889, GO:0032268, GO:0006448, GO:0080090, GO:0019222, GO:0051246, GO:0060255, GO:0010608, GO:0031323, GO:2000112, GO:0050794, GO:0050789, GO:0010556, GO:0065007, GO:0031326, GO:0006417, GO:0008150, GO:0065008, GO:0010468
GO:0006418 [BP]tRNA aminoacylation for protein translationprobableGO:0006139, GO:0019752, GO:0090304, GO:0044249, GO:0034641, GO:0006807, GO:0044281, GO:0034645, GO:0034660, GO:1901360, GO:0044267, GO:0044710, GO:0044260, GO:0006520, GO:0071704, GO:0010467, GO:1901576, GO:0009987, GO:0006725, GO:0009058, GO:0009059, GO:0008150, GO:0008152, GO:0043436, GO:0046483, GO:0016070, GO:0044238, GO:1901564, GO:0006082, GO:0019538, GO:0044237, GO:0043170, GO:0006399, GO:0043038, GO:0043039, GO:0006412
GO:0016020 [CC]membraneprobableGO:0005575
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0002161 [MF]aminoacyl-tRNA editing activityprobableGO:0016787, GO:0003674, GO:0016788, GO:0052689, GO:0003824
GO:0005739 [CC]mitochondrionprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0043167 [MF]ion bindingprobableGO:0003674, GO:0005488

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3HY0, chain A
Confidence level:very confident
Coverage over the Query: 1-135
View the alignment between query and template
View the model in PyMOL