Diaphorina citri psyllid: psy6339

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-----

MNNPNISSYVRLCSKSIRSSFLDYFCNTQGHTLVKSSPIVPYGDDSIAFVNSGMCQFKNVFLGLTPAPYPRVANSQKCVRVGGKHNDLSCAGRDSYHHTFFEMLGNWSFNDYYKRDACRMALEFLTKPPVSLPLDRLYFTYFGGSDQYGLPCDEETRDIWLELGVPRDHIKKEGMKCNFWEMGSTGPCGYSSEIHYDMKGEPSSALARVNADRNDLIEIWNIVFISHKRVSADTIVPLSKNYIDTGLGFERLVTILQNKTSTYDTDLFLPLLETIEKVSGAKPYGRTFTTSNRTDLDTSYRMLSDYSRMITVALADNMFPDATAKLRNVVRDALLISEDVFKVKQGKLVKELSYNIAEILGDVYPEIQDSINKIQLILGEESRIFDNLRKAAVKEWKPLVKTQPELEQFNIMEEPGLVLGVKYLTKQLARDPSITEISGDMAFTLYDTYGLSKNIIQELAAAKKLTLCHEAFEQKLNELKERSKAKAASNVPDIDLMDLKHFPVTDDKYKYDYHYDTNSKRYTFPCLDTNLVGIVIGDQVFCIDKHAIRHARSGASIDSIQLEHNAWVGLIFDKTNLYATAGGQIDDIGVAYLTNTTQENGKVEIGELASLEGKIVHFGNVVSSFKVTPGLTSRVEVDARMRLGCMRAHTTSHLLNAALRRVLTCTYQKSCRVFSDECALDFSVYGETLSVDSVAAVEKYINDVIANQVQVDRRHMRASELPFLTHLTVIPGEIYPDDVILIDISDKENVISREPCCGTHVFNTGHIESCTVIGYKSYNHGVRSIKCLTGDSSKAAVENGKHLSTAASFSQILNVGNIPYGDDSIAFVNSGMCQFKNVFLGLTPAPYPRVANSQKCIRVGGKHNDLSFAGRDSYHHTFFEMLGNWSFNDYYKRDACRMALEFLTKPPVSLPLDRLYFTFPMVMIP

cccccccccccccHHHHHHHHHHHHHcccccEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHccccccccccccEEEEEEcccccccccccHHHHHHHHHcccccccccccccccccccccccccccccccEEECccccccccccccccccccEEEEEEHHHHcccccccccccccccccccccccHHHHHHHHcccccccHHHHHHHHHHHHHHHHcccccccccccccccccccEEEEEcHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHcccccHHHccHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHccccHHHHHHHHHHHHHHHccccccCCcccccEEccccccccHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccEEEEEEEEccccEEccccHHHHccccccccccccccccEEEEEEcccccccccccccccEEEEEEcccccccEEEEEEEEEEEccEEEEEEEEEEcEEEccccEEEEEEcHHHHHHHHHccHHHHHHHHHHHHHccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHccccEEEEEccHHHcHHcccccccccccccccEEEEEcccccccccEEEccccccccccccccEEEEccccccccccEEEEEcccHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHccccccHHccccccccccccHHHHHHHHHcccccccccccccccccHHHHHHcccccccccHHHHHHHHHHHHcccccccccccEEEEccccccc

*********VRLCSKSIRSSFLDYFCNTQGHTLVKSSPIVPYGDDSIAFVNSGMCQFKNVFLGLTPAPYPRVANSQKCVRVGGKHNDLSCAGRDSYHHTFFEMLGNWSFNDYYKRDACRMALEFLTKPPVSLPLDRLYFTYFGGSDQYGLPCDEETRDIWLELGVPRDHIKKEGMKCNFWEMGSTGPCGYSSEIHYDMKGEPSSALARVNADRNDLIEIWNIVFISHKRVSADTIVPLSKNYIDTGLGFERLVTILQNKTSTYDTDLFLPLLETIEKVSGAKPYGRTFTTSNRTDLDTSYRMLSDYSRMITVALADNMFPDATAKLRNVVRDALLISEDVFKVKQGKLVKELSYNIAEILGDVYPEIQDSINKIQLILGEESRIFDNLRKAAVKEWKPLVKTQPELEQFNIMEEPGLVLGVKYLTKQLARDPSITEISGDMAFTLYDTYGLSKNIIQELAAAKKLTLCHEAFEQ*****************PDIDLMDLKHFPVTDDKYKYDYHYDTNSKRYTFPCLDTNLVGIVIGDQVFCIDKHAIRHARSGASIDSIQLEHNAWVGLIFDKTNLYATAGGQIDDIGVAYLTNTTQENGKVEIGELASLEGKIVHFGNVVSSFKVTPGLTSRVEVDARMRLGCMRAHTTSHLLNAALRRVLTCTYQKSCRVFSDECALDFSVYGETLSVDSVAAVEKYINDVIANQVQVDRRHMRASELPFLTHLTVIPGEIYPDDVILIDISDKENVISREPCCGTHVFNTGHIESCTVIGYKSYNHGVRSIKCLTGDSSKAAVENGKHLSTAASFSQILNVGNIPYGDDSIAFVNSGMCQFKNVFLGLTPAPYPRVANSQKCIRVGGKHNDLSFAGRDSYHHTFFEMLGNWSFNDYYKRDACRMALEFLTKPPVSLPLDRLYFTFPMVMI*

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MNNPNISSYVRLCSKSIRSSFLDYFCNTQGHTLVKSSPIVPYGDDSIAFVNSGMCQFKNVFLGLTPAPYPRVANSQKCVRVGGKHNDLSCAGRDSYHHTFFEMLGNWSFNDYYKRDACRMALEFLTKPPVSLPLDRLYFTYFGGSDQYGLPCDEETRDIWLELGVPRDHIKKEGMKCNFWEMGSTGPCGYSSEIHYDMKGEPSSALARVNADRNDLIEIWNIVFISHKRVSADTIVPLSKNYIDTGLGFERLVTILQNKTSTYDTDLFLPLLETIEKVSGAKPYGRTFTTSNRTDLDTSYRMLSDYSRMITVALADNMFPDATAKLRNVVRDALLISEDVFKVKQGKLVKELSYNIAEILGDVYPEIQDSINKIQLILGEESRIFDNLRKAAVKEWKPLVKTQPELEQFNIMEEPGLVLGVKYLTKQLARDPSITEISGDMAFTLYDTYGLSKNIIQELAAxxxxxxxxxxxxxxxxxxxxxSKAKAASNVPDIDLMDLKHFPVTDDKYKYDYHYDTNSKRYTFPCLDTNLVGIVIGDQVFCIDKHAIRHARSGASIDSIQLEHNAWVGLIFDKTNLYATAGGQIDDIGVAYLTNTTQENGKVEIGELASLEGKIVHFGNVVSSFKVTPGLTSRVEVDARMRLGCMRAHTTSHLLNAALRRVLTCTYQKSCRVFSDECALDFSVYGETLSVDSVAAVEKYINDVIANQVQVDRRHMRASELPFLTHLTVIPGEIYPDDVILIDISDKENVISREPCCGTHVFNTGHIESCTVIGYKSYNHGVRSIKCLTGDSSKAAVENGKHLSTAASFSQILNVGNIPYGDDSIAFVNSGMCQFKNVFLGLTPAPYPRVANSQKCIRVGGKHNDLSFAGRDSYHHTFFEMLGNWSFNDYYKRDACRMALEFLTKPPVSLPLDRLYFTFPMVMIP

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Alanine--tRNA ligase	Catalyzes the attachment of alanine to tRNA(Ala) in a two-step reaction: alanine is first activated by ATP to form Ala-AMP and then transferred to the acceptor end of tRNA(Ala). Also edits incorrectly charged Ser-tRNA(Ala) and Gly-tRNA(Ala) via its editing domain.	confident	A6L1L8
Alanine--tRNA ligase	Catalyzes the attachment of alanine to tRNA(Ala) in a two-step reaction: alanine is first activated by ATP to form Ala-AMP and then transferred to the acceptor end of tRNA(Ala). Also edits incorrectly charged Ser-tRNA(Ala) and Gly-tRNA(Ala) via its editing domain.	confident	A6U9N4
Alanine--tRNA ligase	Catalyzes the attachment of alanine to tRNA(Ala) in a two-step reaction: alanine is first activated by ATP to form Ala-AMP and then transferred to the acceptor end of tRNA(Ala). Also edits incorrectly charged tRNA(Ala) via its editing domain.	confident	P36428

Prediction of Gene Ontology Terms

No confident GO terms associated with the query are predicted

Prediction of Enzyme Commission Number

EC Number	Description	Confidence Level
6.-.-.-	Ligases.	probable
6.1.-.-	1D-1-guanidino-3-amino-1,3-dideoxy-scyllo-inositol transaminase.	probable
6.1.1.-	Ligases forming aminoacyl-tRNA and related compounds.	probable
6.1.1.7	Alanine--tRNA ligase.	probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2ZZE, chain A
Confidence level:very confident
Coverage over the Query: 29-138,175-198,217-389,418-535,568-791
View the alignment between query and template
View the model in PyMOL

Template: 2ZZE, chain A
Confidence level:very confident
Coverage over the Query: 752-780,794-916
View the alignment between query and template
View the model in PyMOL

Template: 1YFS, chain A
Confidence level:very confident
Coverage over the Query: 11-389,418-486
View the alignment between query and template
View the model in PyMOL

Template: 3HXZ, chain A
Confidence level:confident
Coverage over the Query: 14-281,294-375,391-472
View the alignment between query and template
View the model in PyMOL

Template: 2ZZF, chain A
Confidence level:confident
Coverage over the Query: 16-138,176-200,217-403,421-503,516-529,543-553,567-791
View the alignment between query and template
View the model in PyMOL